Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: John D. Lafferty
@article{DBLP:journals/corr/abs-2402-08856,
author = {Awni Altabaa and
John Lafferty},
title = {Approximation of relation functions and attention mechanisms},
journal = {CoRR},
volume = {abs/2402.08856},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.08856},
doi = {10.48550/ARXIV.2402.08856},
eprinttype = {arXiv},
eprint = {2402.08856},
timestamp = {Mon, 19 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-08856.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-10392,
author = {Qi Lin and
Zifan Li and
John Lafferty and
Ilker Yildirim},
title = {From seeing to remembering: Images with harder-to-reconstruct representations
leave stronger memory traces},
journal = {CoRR},
volume = {abs/2302.10392},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.10392},
doi = {10.48550/ARXIV.2302.10392},
eprinttype = {arXiv},
eprint = {2302.10392},
timestamp = {Thu, 23 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-10392.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-00195,
author = {Awni Altabaa and
Taylor Webb and
Jonathan D. Cohen and
John Lafferty},
title = {Abstractors: Transformer Modules for Symbolic Message Passing and
Relational Reasoning},
journal = {CoRR},
volume = {abs/2304.00195},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.00195},
doi = {10.48550/ARXIV.2304.00195},
eprinttype = {arXiv},
eprint = {2304.00195},
timestamp = {Wed, 19 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-00195.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-06629,
author = {Taylor W. Webb and
Steven M. Frankland and
Awni Altabaa and
Kamesh Krishnamurthy and
Declan Campbell and
Jacob L. Russin and
Randall C. O'Reilly and
John Lafferty and
Jonathan D. Cohen},
title = {The Relational Bottleneck as an Inductive Bias for Efficient Abstraction},
journal = {CoRR},
volume = {abs/2309.06629},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.06629},
doi = {10.48550/ARXIV.2309.06629},
eprinttype = {arXiv},
eprint = {2309.06629},
timestamp = {Wed, 20 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-06629.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-03240,
author = {Awni Altabaa and
John Lafferty},
title = {Relational Convolutional Networks: {A} framework for learning representations
of hierarchical relations},
journal = {CoRR},
volume = {abs/2310.03240},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.03240},
doi = {10.48550/ARXIV.2310.03240},
eprinttype = {arXiv},
eprint = {2310.03240},
timestamp = {Thu, 19 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-03240.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-13614,
author = {Leon Lufkin and
Ashish Puri and
Ganlin Song and
Xinyi Zhong and
John Lafferty},
title = {Emergent organization of receptive fields in networks of excitatory
and inhibitory neurons},
journal = {CoRR},
volume = {abs/2205.13614},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.13614},
doi = {10.48550/ARXIV.2205.13614},
eprinttype = {arXiv},
eprint = {2205.13614},
timestamp = {Tue, 31 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-13614.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/SongXL21,
author = {Ganlin Song and
Ruitu Xu and
John Lafferty},
editor = {Marc'Aurelio Ranzato and
Alina Beygelzimer and
Yann N. Dauphin and
Percy Liang and
Jennifer Wortman Vaughan},
title = {Convergence and Alignment of Gradient Descent with Random Backpropagation
Weights},
booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference
on Neural Information Processing Systems 2021, NeurIPS 2021, December
6-14, 2021, virtual},
pages = {19888--19898},
year = {2021},
url = {https://proceedings.neurips.cc/paper/2021/hash/a576eafbce762079f7d1f77fca1c5cc2-Abstract.html},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/SongXL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-06044,
author = {Ganlin Song and
Ruitu Xu and
John Lafferty},
title = {Convergence and Alignment of Gradient Descentwith Random Back propagation
Weights},
journal = {CoRR},
volume = {abs/2106.06044},
year = {2021},
url = {https://arxiv.org/abs/2106.06044},
eprinttype = {arXiv},
eprint = {2106.06044},
timestamp = {Wed, 16 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-06044.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-14781,
author = {Tuo Zhao and
Han Liu and
Kathryn Roeder and
John Lafferty and
Larry A. Wasserman},
title = {The huge Package for High-dimensional Undirected Graph Estimation
in {R}},
journal = {CoRR},
volume = {abs/2006.14781},
year = {2020},
url = {https://arxiv.org/abs/2006.14781},
eprinttype = {arXiv},
eprint = {2006.14781},
timestamp = {Thu, 02 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-14781.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/YasunagaL19,
author = {Michihiro Yasunaga and
John D. Lafferty},
title = {TopicEq: {A} Joint Topic and Mathematical Equation Model for Scientific
Texts},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {7394--7401},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33017394},
doi = {10.1609/AAAI.V33I01.33017394},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/YasunagaL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/SongFL19,
author = {Ganlin Song and
Zhou Fan and
John Lafferty},
editor = {Hanna M. Wallach and
Hugo Larochelle and
Alina Beygelzimer and
Florence d'Alch{\'{e}}{-}Buc and
Emily B. Fox and
Roman Garnett},
title = {Surfing: Iterative Optimization Over Incrementally Trained Deep Networks},
booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference
on Neural Information Processing Systems 2019, NeurIPS 2019, December
8-14, 2019, Vancouver, BC, Canada},
pages = {15008--15017},
year = {2019},
url = {https://proceedings.neurips.cc/paper/2019/hash/e345fac6bc5c868f0222430c733fa26e-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/SongFL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-06034,
author = {Michihiro Yasunaga and
John Lafferty},
title = {TopicEq: {A} Joint Topic and Mathematical Equation Model for Scientific
Texts},
journal = {CoRR},
volume = {abs/1902.06034},
year = {2019},
url = {http://arxiv.org/abs/1902.06034},
eprinttype = {arXiv},
eprint = {1902.06034},
timestamp = {Tue, 21 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-06034.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-08646,
author = {Dana Yang and
John Lafferty and
David Pollard},
title = {Fair quantile regression},
journal = {CoRR},
volume = {abs/1907.08646},
year = {2019},
url = {http://arxiv.org/abs/1907.08646},
eprinttype = {arXiv},
eprint = {1907.08646},
timestamp = {Tue, 30 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-08646.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-08653,
author = {Ganlin Song and
Zhou Fan and
John Lafferty},
title = {Surfing: Iterative optimization over incrementally trained deep networks},
journal = {CoRR},
volume = {abs/1907.08653},
year = {2019},
url = {http://arxiv.org/abs/1907.08653},
eprinttype = {arXiv},
eprint = {1907.08653},
timestamp = {Tue, 30 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-08653.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/ChatterjeeL18,
author = {Sabyasachi Chatterjee and
John D. Lafferty},
title = {Denoising Flows on Trees},
journal = {{IEEE} Trans. Inf. Theory},
volume = {64},
number = {3},
pages = {1767--1783},
year = {2018},
url = {https://doi.org/10.1109/TIT.2017.2782369},
doi = {10.1109/TIT.2017.2782369},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tit/ChatterjeeL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/MishraILH18,
author = {Nikita Mishra and
Connor Imes and
John D. Lafferty and
Henry Hoffmann},
editor = {Xipeng Shen and
James Tuck and
Ricardo Bianchini and
Vivek Sarkar},
title = {{CALOREE:} Learning Control for Predictable Latency and Low Energy},
booktitle = {Proceedings of the Twenty-Third International Conference on Architectural
Support for Programming Languages and Operating Systems, {ASPLOS}
2018, Williamsburg, VA, USA, March 24-28, 2018},
pages = {184--198},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3173162.3173184},
doi = {10.1145/3173162.3173184},
timestamp = {Tue, 23 Jan 2024 20:31:22 +0100},
biburl = {https://dblp.org/rec/conf/asplos/MishraILH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/BonakdarpourCBL18,
author = {Matt Bonakdarpour and
Sabyasachi Chatterjee and
Rina Foygel Barber and
John Lafferty},
editor = {Jennifer G. Dy and
Andreas Krause},
title = {Prediction Rule Reshaping},
booktitle = {Proceedings of the 35th International Conference on Machine Learning,
{ICML} 2018, Stockholmsm{\"{a}}ssan, Stockholm, Sweden, July
10-15, 2018},
series = {Proceedings of Machine Learning Research},
volume = {80},
pages = {629--637},
publisher = {{PMLR}},
year = {2018},
url = {http://proceedings.mlr.press/v80/bonakdarpour18a.html},
timestamp = {Wed, 03 Apr 2019 18:17:30 +0200},
biburl = {https://dblp.org/rec/conf/icml/BonakdarpourCBL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ZhuL18,
author = {Yuancheng Zhu and
John Lafferty},
editor = {Jennifer G. Dy and
Andreas Krause},
title = {Distributed Nonparametric Regression under Communication Constraints},
booktitle = {Proceedings of the 35th International Conference on Machine Learning,
{ICML} 2018, Stockholmsm{\"{a}}ssan, Stockholm, Sweden, July
10-15, 2018},
series = {Proceedings of Machine Learning Research},
volume = {80},
pages = {6004--6012},
publisher = {{PMLR}},
year = {2018},
url = {http://proceedings.mlr.press/v80/zhu18a.html},
timestamp = {Wed, 03 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/ZhuL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-01302,
author = {Yuancheng Zhu and
John D. Lafferty},
title = {Distributed Nonparametric Regression under Communication Constraints},
journal = {CoRR},
volume = {abs/1803.01302},
year = {2018},
url = {http://arxiv.org/abs/1803.01302},
eprinttype = {arXiv},
eprint = {1803.01302},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-01302.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-06439,
author = {Matt Bonakdarpour and
Sabyasachi Chatterjee and
Rina Foygel Barber and
John D. Lafferty},
title = {Prediction Rule Reshaping},
journal = {CoRR},
volume = {abs/1805.06439},
year = {2018},
url = {http://arxiv.org/abs/1805.06439},
eprinttype = {arXiv},
eprint = {1805.06439},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-06439.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BergerL17,
author = {Adam L. Berger and
John D. Lafferty},
title = {Information Retrieval as Statistical Translation},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {219--226},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130371},
doi = {10.1145/3130348.3130371},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BergerL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LaffertyZ17,
author = {John D. Lafferty and
Chengxiang Zhai},
title = {Document Language Models, Query Models, and Risk Minimization for
Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {251--259},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130375},
doi = {10.1145/3130348.3130375},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LaffertyZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiL17,
author = {Chengxiang Zhai and
John D. Lafferty},
title = {A Study of Smoothing Methods for Language Models Applied to Ad Hoc
Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {268--276},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130377},
doi = {10.1145/3130348.3130377},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZhaiL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icac/MishraLH17,
author = {Nikita Mishra and
John D. Lafferty and
Henry Hoffmann},
editor = {Xiaorui Wang and
Christopher Stewart and
Hui Lei},
title = {{ESP:} {A} Machine Learning Approach to Predicting Application Interference},
booktitle = {2017 {IEEE} International Conference on Autonomic Computing, {ICAC}
2017, Columbus, OH, USA, July 17-21, 2017},
pages = {125--134},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ICAC.2017.29},
doi = {10.1109/ICAC.2017.29},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icac/MishraLH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GaoL17,
author = {Chao Gao and
John Lafferty},
title = {Testing Network Structure Using Relations Between Small Subgraph Probabilities},
journal = {CoRR},
volume = {abs/1704.06742},
year = {2017},
url = {http://arxiv.org/abs/1704.06742},
eprinttype = {arXiv},
eprint = {1704.06742},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GaoL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-00862,
author = {Chao Gao and
John Lafferty},
title = {Testing for Global Network Structure Using Small Subgraph Statistics},
journal = {CoRR},
volume = {abs/1710.00862},
year = {2017},
url = {http://arxiv.org/abs/1710.00862},
eprinttype = {arXiv},
eprint = {1710.00862},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1710-00862.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/YangB0L16,
author = {Fan Yang and
Rina Foygel Barber and
Prateek Jain and
John D. Lafferty},
editor = {Daniel D. Lee and
Masashi Sugiyama and
Ulrike von Luxburg and
Isabelle Guyon and
Roman Garnett},
title = {Selective inference for group-sparse linear models},
booktitle = {Advances in Neural Information Processing Systems 29: Annual Conference
on Neural Information Processing Systems 2016, December 5-10, 2016,
Barcelona, Spain},
pages = {2469--2477},
year = {2016},
url = {https://proceedings.neurips.cc/paper/2016/hash/7c82fab8c8f89124e2ce92984e04fb40-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/YangB0L16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ChatterjeeDLZ16,
author = {Sabyasachi Chatterjee and
John C. Duchi and
John D. Lafferty and
Yuancheng Zhu},
editor = {Daniel D. Lee and
Masashi Sugiyama and
Ulrike von Luxburg and
Isabelle Guyon and
Roman Garnett},
title = {Local Minimax Complexity of Stochastic Convex Optimization},
booktitle = {Advances in Neural Information Processing Systems 29: Annual Conference
on Neural Information Processing Systems 2016, December 5-10, 2016,
Barcelona, Spain},
pages = {3423--3431},
year = {2016},
url = {https://proceedings.neurips.cc/paper/2016/hash/b9f94c77652c9a76fc8a442748cd54bd-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ChatterjeeDLZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhengL16,
author = {Qinqing Zheng and
John D. Lafferty},
title = {Convergence Analysis for Rectangular Matrix Completion Using Burer-Monteiro
Factorization and Gradient Descent},
journal = {CoRR},
volume = {abs/1605.07051},
year = {2016},
url = {http://arxiv.org/abs/1605.07051},
eprinttype = {arXiv},
eprint = {1605.07051},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ZhengL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiCL15,
author = {ChengXiang Zhai and
William W. Cohen and
John D. Lafferty},
title = {Beyond Independent Relevance: Methods and Evaluation Metrics for Subtopic
Retrieval},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {2--9},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795405},
doi = {10.1145/2795403.2795405},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZhaiCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/MishraZLH15,
author = {Nikita Mishra and
Huazhe Zhang and
John D. Lafferty and
Henry Hoffmann},
editor = {{\"{O}}zcan {\"{O}}zturk and
Kemal Ebcioglu and
Sandhya Dwarkadas},
title = {A Probabilistic Graphical Model-based Approach for Minimizing Energy
Under Performance Constraints},
booktitle = {Proceedings of the Twentieth International Conference on Architectural
Support for Programming Languages and Operating Systems, {ASPLOS}
2015, Istanbul, Turkey, March 14-18, 2015},
pages = {267--281},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2694344.2694373},
doi = {10.1145/2694344.2694373},
timestamp = {Wed, 07 Jul 2021 13:23:08 +0200},
biburl = {https://dblp.org/rec/conf/asplos/MishraZLH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhengL15,
author = {Qinqing Zheng and
John D. Lafferty},
editor = {Corinna Cortes and
Neil D. Lawrence and
Daniel D. Lee and
Masashi Sugiyama and
Roman Garnett},
title = {A Convergent Gradient Descent Algorithm for Rank Minimization and
Semidefinite Programming from Random Linear Measurements},
booktitle = {Advances in Neural Information Processing Systems 28: Annual Conference
on Neural Information Processing Systems 2015, December 7-12, 2015,
Montreal, Quebec, Canada},
pages = {109--117},
year = {2015},
url = {https://proceedings.neurips.cc/paper/2015/hash/32bb90e8976aab5298d5da10fe66f21d-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/ZhengL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhengL15,
author = {Qinqing Zheng and
John D. Lafferty},
title = {A Convergent Gradient Descent Algorithm for Rank Minimization and
Semidefinite Programming from Random Linear Measurements},
journal = {CoRR},
volume = {abs/1506.06081},
year = {2015},
url = {http://arxiv.org/abs/1506.06081},
eprinttype = {arXiv},
eprint = {1506.06081},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ZhengL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiuL14,
author = {Zhe Liu and
John D. Lafferty},
editor = {Zoubin Ghahramani and
Max Welling and
Corinna Cortes and
Neil D. Lawrence and
Kilian Q. Weinberger},
title = {Blossom Tree Graphical Models},
booktitle = {Advances in Neural Information Processing Systems 27: Annual Conference
on Neural Information Processing Systems 2014, December 8-13 2014,
Montreal, Quebec, Canada},
pages = {1458--1465},
year = {2014},
url = {https://proceedings.neurips.cc/paper/2014/hash/da8ce53cf0240070ce6c69c48cd588ee-Abstract.html},
timestamp = {Wed, 05 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/LiuL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhuL14,
author = {Yuancheng Zhu and
John D. Lafferty},
editor = {Zoubin Ghahramani and
Max Welling and
Corinna Cortes and
Neil D. Lawrence and
Kilian Q. Weinberger},
title = {Quantized Estimation of Gaussian Sequence Models in Euclidean Balls},
booktitle = {Advances in Neural Information Processing Systems 27: Annual Conference
on Neural Information Processing Systems 2014, December 8-13 2014,
Montreal, Quebec, Canada},
pages = {3662--3670},
year = {2014},
url = {https://proceedings.neurips.cc/paper/2014/hash/b139e104214a08ae3f2ebcce149cdf6e-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ZhuL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ShenderL13,
author = {Dinah Shender and
John D. Lafferty},
title = {Computation-Risk Tradeoffs for Covariance-Thresholded Regression},
booktitle = {Proceedings of the 30th International Conference on Machine Learning,
{ICML} 2013, Atlanta, GA, USA, 16-21 June 2013},
series = {{JMLR} Workshop and Conference Proceedings},
volume = {28},
pages = {756--764},
publisher = {JMLR.org},
year = {2013},
url = {http://proceedings.mlr.press/v28/shender13.html},
timestamp = {Wed, 29 May 2019 08:41:45 +0200},
biburl = {https://dblp.org/rec/conf/icml/ShenderL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/KalaitzisLLZ13,
author = {Alfredo A. Kalaitzis and
John D. Lafferty and
Neil D. Lawrence and
Shuheng Zhou},
title = {The Bigraphical Lasso},
booktitle = {Proceedings of the 30th International Conference on Machine Learning,
{ICML} 2013, Atlanta, GA, USA, 16-21 June 2013},
series = {{JMLR} Workshop and Conference Proceedings},
volume = {28},
pages = {1229--1237},
publisher = {JMLR.org},
year = {2013},
url = {http://proceedings.mlr.press/v28/kalaitzis13.html},
timestamp = {Wed, 29 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/KalaitzisLLZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/ChenL13,
author = {Minhua Chen and
John D. Lafferty},
title = {Mismatched estimation and relative entropy in vector Gaussian channels},
booktitle = {Proceedings of the 2013 {IEEE} International Symposium on Information
Theory, Istanbul, Turkey, July 7-12, 2013},
pages = {2845--2849},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISIT.2013.6620745},
doi = {10.1109/ISIT.2013.6620745},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/isit/ChenL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1301-0588,
author = {Thomas P. Minka and
John D. Lafferty},
title = {Expectation-Propogation for the Generative Aspect Model},
journal = {CoRR},
volume = {abs/1301.0588},
year = {2013},
url = {http://arxiv.org/abs/1301.0588},
eprinttype = {arXiv},
eprint = {1301.0588},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1301-0588.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1301-2286,
author = {John D. Lafferty and
Larry A. Wasserman},
title = {Iterative Markov Chain Monte Carlo Computation of Reference Priors
and Minimax Risk},
journal = {CoRR},
volume = {abs/1301.2286},
year = {2013},
url = {http://arxiv.org/abs/1301.2286},
eprinttype = {arXiv},
eprint = {1301.2286},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1301-2286.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/ZhaoLRLW12,
author = {Tuo Zhao and
Han Liu and
Kathryn Roeder and
John D. Lafferty and
Larry A. Wasserman},
title = {The huge Package for High-dimensional Undirected Graph Estimation
in {R}},
journal = {J. Mach. Learn. Res.},
volume = {13},
pages = {1059--1062},
year = {2012},
url = {https://dl.acm.org/doi/10.5555/2503308.2343681},
doi = {10.5555/2503308.2343681},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/ZhaoLRLW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/BalakrishnanPL12,
author = {Sivaraman Balakrishnan and
Kriti Puniyani and
John D. Lafferty},
title = {Sparse Additive Functional and Kernel {CCA}},
booktitle = {Proceedings of the 29th International Conference on Machine Learning,
{ICML} 2012, Edinburgh, Scotland, UK, June 26 - July 1, 2012},
publisher = {icml.cc / Omnipress},
year = {2012},
url = {http://icml.cc/2012/papers/478.pdf},
timestamp = {Wed, 03 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/BalakrishnanPL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/GuL12,
author = {Haijie Gu and
John D. Lafferty},
title = {Sequential Nonparametric Regression},
booktitle = {Proceedings of the 29th International Conference on Machine Learning,
{ICML} 2012, Edinburgh, Scotland, UK, June 26 - July 1, 2012},
publisher = {icml.cc / Omnipress},
year = {2012},
url = {http://icml.cc/2012/papers/781.pdf},
timestamp = {Wed, 03 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/GuL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LiuHYLW12,
author = {Han Liu and
Fang Han and
Ming Yuan and
John D. Lafferty and
Larry A. Wasserman},
title = {High Dimensional Semiparametric Gaussian Copula Graphical Models},
booktitle = {Proceedings of the 29th International Conference on Machine Learning,
{ICML} 2012, Edinburgh, Scotland, UK, June 26 - July 1, 2012},
publisher = {icml.cc / Omnipress},
year = {2012},
url = {http://icml.cc/2012/papers/707.pdf},
timestamp = {Fri, 02 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/LiuHYLW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/XuL12,
author = {Min Xu and
John D. Lafferty},
title = {Conditional Sparse Coding and Grouped Multivariate Regression},
booktitle = {Proceedings of the 29th International Conference on Machine Learning,
{ICML} 2012, Edinburgh, Scotland, UK, June 26 - July 1, 2012},
publisher = {icml.cc / Omnipress},
year = {2012},
url = {http://icml.cc/2012/papers/738.pdf},
timestamp = {Thu, 11 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/XuL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/FoygelHDL12,
author = {Rina Foygel and
Michael Horrell and
Mathias Drton and
John D. Lafferty},
editor = {Peter L. Bartlett and
Fernando C. N. Pereira and
Christopher J. C. Burges and
L{\'{e}}on Bottou and
Kilian Q. Weinberger},
title = {Nonparametric Reduced Rank Regression},
booktitle = {Advances in Neural Information Processing Systems 25: 26th Annual
Conference on Neural Information Processing Systems 2012. Proceedings
of a meeting held December 3-6, 2012, Lake Tahoe, Nevada, United States},
pages = {1637--1645},
year = {2012},
url = {https://proceedings.neurips.cc/paper/2012/hash/f2201f5191c4e92cc5af043eebfd0946-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/FoygelHDL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiuLW12,
author = {Han Liu and
John D. Lafferty and
Larry A. Wasserman},
editor = {Peter L. Bartlett and
Fernando C. N. Pereira and
Christopher J. C. Burges and
L{\'{e}}on Bottou and
Kilian Q. Weinberger},
title = {Exponential Concentration for Mutual Information Estimation with Application
to Forests},
booktitle = {Advances in Neural Information Processing Systems 25: 26th Annual
Conference on Neural Information Processing Systems 2012. Proceedings
of a meeting held December 3-6, 2012, Lake Tahoe, Nevada, United States},
pages = {2546--2554},
year = {2012},
url = {https://proceedings.neurips.cc/paper/2012/hash/c8ba76c279269b1c6bc8a07e38e78fa4-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/LiuLW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1201-0794,
author = {John D. Lafferty and
Han Liu and
Larry A. Wasserman},
title = {Sparse Nonparametric Graphical Models},
journal = {CoRR},
volume = {abs/1201.0794},
year = {2012},
url = {http://arxiv.org/abs/1201.0794},
eprinttype = {arXiv},
eprint = {1201.0794},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1201-0794.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1206-4669,
author = {Sivaraman Balakrishnan and
Kriti Puniyani and
John D. Lafferty},
title = {Sparse Additive Functional and Kernel {CCA}},
journal = {CoRR},
volume = {abs/1206.4669},
year = {2012},
url = {http://arxiv.org/abs/1206.4669},
eprinttype = {arXiv},
eprint = {1206.4669},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1206-4669.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GuL12,
author = {Haijie Gu and
John D. Lafferty},
title = {Sequential Nonparametric Regression},
journal = {CoRR},
volume = {abs/1206.6408},
year = {2012},
url = {http://arxiv.org/abs/1206.6408},
eprinttype = {arXiv},
eprint = {1206.6408},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GuL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiuHYLW12,
author = {Han Liu and
Fang Han and
Ming Yuan and
John D. Lafferty and
Larry A. Wasserman},
title = {The Nonparanormal {SKEPTIC}},
journal = {CoRR},
volume = {abs/1206.6488},
year = {2012},
url = {http://arxiv.org/abs/1206.6488},
eprinttype = {arXiv},
eprint = {1206.6488},
timestamp = {Fri, 02 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/LiuHYLW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1207-4172,
author = {Pradeep Ravikumar and
John D. Lafferty},
title = {Variational Chernoff Bounds for Graphical Models},
journal = {CoRR},
volume = {abs/1207.4172},
year = {2012},
url = {http://arxiv.org/abs/1207.4172},
eprinttype = {arXiv},
eprint = {1207.4172},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1207-4172.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/LiuXGGLW11,
author = {Han Liu and
Min Xu and
Haijie Gu and
Anupam Gupta and
John D. Lafferty and
Larry A. Wasserman},
title = {Forest Density Estimation},
journal = {J. Mach. Learn. Res.},
volume = {12},
pages = {907--951},
year = {2011},
url = {https://dl.acm.org/doi/10.5555/1953048.2021032},
doi = {10.5555/1953048.2021032},
timestamp = {Thu, 11 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/LiuXGGLW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/KolarLW11,
author = {Mladen Kolar and
John D. Lafferty and
Larry A. Wasserman},
title = {Union Support Recovery in Multi-task Learning},
journal = {J. Mach. Learn. Res.},
volume = {12},
pages = {2415--2435},
year = {2011},
url = {https://dl.acm.org/doi/10.5555/1953048.2021079},
doi = {10.5555/1953048.2021079},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/KolarLW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YuLL11,
author = {Kai Yu and
Yuanqing Lin and
John D. Lafferty},
title = {Learning image representations from the pixel level via hierarchical
sparse coding},
booktitle = {The 24th {IEEE} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2011, Colorado Springs, CO, USA, 20-25 June 2011},
pages = {1713--1720},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/CVPR.2011.5995732},
doi = {10.1109/CVPR.2011.5995732},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/YuLL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ml/ZhouLW10,
author = {Shuheng Zhou and
John D. Lafferty and
Larry A. Wasserman},
title = {Time varying undirected graphs},
journal = {Mach. Learn.},
volume = {80},
number = {2-3},
pages = {295--319},
year = {2010},
url = {https://doi.org/10.1007/s10994-010-5180-0},
doi = {10.1007/S10994-010-5180-0},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ml/ZhouLW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/GuptaLLWX10,
author = {Anupam Gupta and
John D. Lafferty and
Han Liu and
Larry A. Wasserman and
Min Xu},
editor = {Adam Tauman Kalai and
Mehryar Mohri},
title = {Forest Density Estimation},
booktitle = {{COLT} 2010 - The 23rd Conference on Learning Theory, Haifa, Israel,
June 27-29, 2010},
pages = {394--406},
publisher = {Omnipress},
year = {2010},
url = {http://colt2010.haifa.il.ibm.com/papers/COLT2010proceedings.pdf\#page=402},
timestamp = {Thu, 11 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/colt/GuptaLLWX10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiuCLW10,
author = {Han Liu and
Xi Chen and
John D. Lafferty and
Larry A. Wasserman},
editor = {John D. Lafferty and
Christopher K. I. Williams and
John Shawe{-}Taylor and
Richard S. Zemel and
Aron Culotta},
title = {Graph-Valued Regression},
booktitle = {Advances in Neural Information Processing Systems 23: 24th Annual
Conference on Neural Information Processing Systems 2010. Proceedings
of a meeting held 6-9 December 2010, Vancouver, British Columbia,
Canada},
pages = {1423--1431},
publisher = {Curran Associates, Inc.},
year = {2010},
url = {https://proceedings.neurips.cc/paper/2010/hash/821fa74b50ba3f7cba1e6c53e8fa6845-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/LiuCLW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nips/2010,
editor = {John D. Lafferty and
Christopher K. I. Williams and
John Shawe{-}Taylor and
Richard S. Zemel and
Aron Culotta},
title = {Advances in Neural Information Processing Systems 23: 24th Annual
Conference on Neural Information Processing Systems 2010. Proceedings
of a meeting held 6-9 December 2010, Vancouver, British Columbia,
Canada},
publisher = {Curran Associates, Inc.},
year = {2010},
url = {https://proceedings.neurips.cc/paper/2010},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/LiuLW09,
author = {Han Liu and
John D. Lafferty and
Larry A. Wasserman},
title = {The Nonparanormal: Semiparametric Estimation of High Dimensional Undirected
Graphs},
journal = {J. Mach. Learn. Res.},
volume = {10},
pages = {2295--2328},
year = {2009},
url = {https://dl.acm.org/doi/10.5555/1577069.1755863},
doi = {10.5555/1577069.1755863},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/LiuLW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/ZhouLW09,
author = {Shuheng Zhou and
John D. Lafferty and
Larry A. Wasserman},
title = {Compressed and Privacy-Sensitive Sparse Regression},
journal = {{IEEE} Trans. Inf. Theory},
volume = {55},
number = {2},
pages = {846--866},
year = {2009},
url = {https://doi.org/10.1109/TIT.2008.2009605},
doi = {10.1109/TIT.2008.2009605},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tit/ZhouLW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/YuLZG09,
author = {Kai Yu and
John D. Lafferty and
Shenghuo Zhu and
Yihong Gong},
editor = {Andrea Pohoreckyj Danyluk and
L{\'{e}}on Bottou and
Michael L. Littman},
title = {Large-scale collaborative prediction using a nonparametric random
effects model},
booktitle = {Proceedings of the 26th Annual International Conference on Machine
Learning, {ICML} 2009, Montreal, Quebec, Canada, June 14-18, 2009},
series = {{ACM} International Conference Proceeding Series},
volume = {382},
pages = {1185--1192},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1553374.1553525},
doi = {10.1145/1553374.1553525},
timestamp = {Tue, 06 Nov 2018 16:58:29 +0100},
biburl = {https://dblp.org/rec/conf/icml/YuLZG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YuZLG09,
author = {Kai Yu and
Shenghuo Zhu and
John D. Lafferty and
Yihong Gong},
editor = {James Allan and
Javed A. Aslam and
Mark Sanderson and
ChengXiang Zhai and
Justin Zobel},
title = {Fast nonparametric matrix factorization for large-scale collaborative
filtering},
booktitle = {Proceedings of the 32nd Annual International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval, {SIGIR} 2009,
Boston, MA, USA, July 19-23, 2009},
pages = {211--218},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1571941.1571979},
doi = {10.1145/1571941.1571979},
timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
biburl = {https://dblp.org/rec/conf/sigir/YuZLG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nips/2009,
editor = {Yoshua Bengio and
Dale Schuurmans and
John D. Lafferty and
Christopher K. I. Williams and
Aron Culotta},
title = {Advances in Neural Information Processing Systems 22: 23rd Annual
Conference on Neural Information Processing Systems 2009. Proceedings
of a meeting held 7-10 December 2009, Vancouver, British Columbia,
Canada},
publisher = {Curran Associates, Inc.},
year = {2009},
url = {https://proceedings.neurips.cc/paper/2009},
isbn = {9781615679119},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/2009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/ZhouLW08,
author = {Shuheng Zhou and
John D. Lafferty and
Larry A. Wasserman},
editor = {Rocco A. Servedio and
Tong Zhang},
title = {Time Varying Undirected Graphs},
booktitle = {21st Annual Conference on Learning Theory - {COLT} 2008, Helsinki,
Finland, July 9-12, 2008},
pages = {455--466},
publisher = {Omnipress},
year = {2008},
url = {http://colt2008.cs.helsinki.fi/papers/81-Zhou.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/colt/ZhouLW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiuLW08,
author = {Han Liu and
John D. Lafferty and
Larry A. Wasserman},
editor = {Daphne Koller and
Dale Schuurmans and
Yoshua Bengio and
L{\'{e}}on Bottou},
title = {Nonparametric regression and classification with joint sparsity constraints},
booktitle = {Advances in Neural Information Processing Systems 21, Proceedings
of the Twenty-Second Annual Conference on Neural Information Processing
Systems, Vancouver, British Columbia, Canada, December 8-11, 2008},
pages = {969--976},
publisher = {Curran Associates, Inc.},
year = {2008},
url = {https://proceedings.neurips.cc/paper/2008/hash/6faa8040da20ef399b63a72d0e4ab575-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/LiuLW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/SmithVL07,
author = {Noah A. Smith and
Douglas L. Vail and
John D. Lafferty},
editor = {John Carroll and
Antal van den Bosch and
Annie Zaenen},
title = {Computationally Efficient M-Estimation of Log-Linear Structure Models},
booktitle = {{ACL} 2007, Proceedings of the 45th Annual Meeting of the Association
for Computational Linguistics, June 23-30, 2007, Prague, Czech Republic},
publisher = {The Association for Computational Linguistics},
year = {2007},
url = {https://aclanthology.org/P07-1095/},
timestamp = {Wed, 29 Mar 2023 13:06:50 +0200},
biburl = {https://dblp.org/rec/conf/acl/SmithVL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/VailVL07,
author = {Douglas L. Vail and
Manuela M. Veloso and
John D. Lafferty},
editor = {Edmund H. Durfee and
Makoto Yokoo and
Michael N. Huhns and
Onn Shehory},
title = {Conditional random fields for activity recognition},
booktitle = {6th International Joint Conference on Autonomous Agents and Multiagent
Systems {(AAMAS} 2007), Honolulu, Hawaii, USA, May 14-18, 2007},
pages = {235},
publisher = {{IFAAMAS}},
year = {2007},
url = {https://doi.org/10.1145/1329125.1329409},
doi = {10.1145/1329125.1329409},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/atal/VailVL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TelgarskyL07,
author = {Matus Telgarsky and
John D. Lafferty},
title = {Signal Decomposition using Multiscale Admixture Models},
booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
and Signal Processing, {ICASSP} 2007, Honolulu, Hawaii, USA, April
15-20, 2007},
pages = {449--452},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ICASSP.2007.366269},
doi = {10.1109/ICASSP.2007.366269},
timestamp = {Mon, 22 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/TelgarskyL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/NallapatiCL07,
author = {Ramesh Nallapati and
William W. Cohen and
John D. Lafferty},
title = {Parallelized Variational {EM} for Latent Dirichlet Allocation: An
Experimental Evaluation of Speed and Scalability},
booktitle = {Workshops Proceedings of the 7th {IEEE} International Conference on
Data Mining {(ICDM} 2007), October 28-31, 2007, Omaha, Nebraska, {USA}},
pages = {349--354},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ICDMW.2007.33},
doi = {10.1109/ICDMW.2007.33},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/NallapatiCL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/VailLV07,
author = {Douglas L. Vail and
John D. Lafferty and
Manuela M. Veloso},
title = {Feature selection in conditional random fields for activity recognition},
booktitle = {2007 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 29 - November 2, 2007, Sheraton Hotel and Marina,
San Diego, California, {USA}},
pages = {3379--3384},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IROS.2007.4399441},
doi = {10.1109/IROS.2007.4399441},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/VailLV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/NallapatiDLU07,
author = {Ramesh Nallapati and
Susan Ditmore and
John D. Lafferty and
Kin Ung},
editor = {Pavel Berkhin and
Rich Caruana and
Xindong Wu},
title = {Multiscale topic tomography},
booktitle = {Proceedings of the 13th {ACM} {SIGKDD} International Conference on
Knowledge Discovery and Data Mining, San Jose, California, USA, August
12-15, 2007},
pages = {520--529},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1281192.1281249},
doi = {10.1145/1281192.1281249},
timestamp = {Fri, 10 Mar 2023 14:55:31 +0100},
biburl = {https://dblp.org/rec/conf/kdd/NallapatiDLU07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LaffertyW07,
author = {John D. Lafferty and
Larry A. Wasserman},
editor = {John C. Platt and
Daphne Koller and
Yoram Singer and
Sam T. Roweis},
title = {Statistical Analysis of Semi-Supervised Regression},
booktitle = {Advances in Neural Information Processing Systems 20, Proceedings
of the Twenty-First Annual Conference on Neural Information Processing
Systems, Vancouver, British Columbia, Canada, December 3-6, 2007},
pages = {801--808},
publisher = {Curran Associates, Inc.},
year = {2007},
url = {https://proceedings.neurips.cc/paper/2007/hash/53c3bce66e43be4f209556518c2fcb54-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/LaffertyW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/RavikumarLLW07,
author = {Pradeep Ravikumar and
Han Liu and
John D. Lafferty and
Larry A. Wasserman},
editor = {John C. Platt and
Daphne Koller and
Yoram Singer and
Sam T. Roweis},
title = {SpAM: Sparse Additive Models},
booktitle = {Advances in Neural Information Processing Systems 20, Proceedings
of the Twenty-First Annual Conference on Neural Information Processing
Systems, Vancouver, British Columbia, Canada, December 3-6, 2007},
pages = {1201--1208},
publisher = {Curran Associates, Inc.},
year = {2007},
url = {https://proceedings.neurips.cc/paper/2007/hash/42e7aaa88b48137a16a1acd04ed91125-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/RavikumarLLW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhouLW07,
author = {Shuheng Zhou and
John D. Lafferty and
Larry A. Wasserman},
editor = {John C. Platt and
Daphne Koller and
Yoram Singer and
Sam T. Roweis},
title = {Compressed Regression},
booktitle = {Advances in Neural Information Processing Systems 20, Proceedings
of the Twenty-First Annual Conference on Neural Information Processing
Systems, Vancouver, British Columbia, Canada, December 3-6, 2007},
pages = {1713--1720},
publisher = {Curran Associates, Inc.},
year = {2007},
url = {https://proceedings.neurips.cc/paper/2007/hash/0336dcbab05b9d5ad24f4333c7658a0e-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ZhouLW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/jmlr/LiuLW07,
author = {Han Liu and
John D. Lafferty and
Larry A. Wasserman},
editor = {Marina Meila and
Xiaotong Shen},
title = {Sparse Nonparametric Density Estimation in High Dimensions Using the
Rodeo},
booktitle = {Proceedings of the Eleventh International Conference on Artificial
Intelligence and Statistics, {AISTATS} 2007, San Juan, Puerto Rico,
March 21-24, 2007},
series = {{JMLR} Proceedings},
volume = {2},
pages = {283--290},
publisher = {JMLR.org},
year = {2007},
url = {http://proceedings.mlr.press/v2/liu07a.html},
timestamp = {Wed, 29 May 2019 08:41:44 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/LiuLW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0706-0534,
author = {Shuheng Zhou and
John D. Lafferty and
Larry A. Wasserman},
title = {Compressed Regression},
journal = {CoRR},
volume = {abs/0706.0534},
year = {2007},
url = {http://arxiv.org/abs/0706.0534},
eprinttype = {arXiv},
eprint = {0706.0534},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0706-0534.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/ZhaiL06,
author = {ChengXiang Zhai and
John D. Lafferty},
title = {A risk minimization framework for information retrieval},
journal = {Inf. Process. Manag.},
volume = {42},
number = {1},
pages = {31--55},
year = {2006},
url = {https://doi.org/10.1016/j.ipm.2004.11.003},
doi = {10.1016/J.IPM.2004.11.003},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/ZhaiL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/BleiL06,
author = {David M. Blei and
John D. Lafferty},
editor = {William W. Cohen and
Andrew W. Moore},
title = {Dynamic topic models},
booktitle = {Machine Learning, Proceedings of the Twenty-Third International Conference
{(ICML} 2006), Pittsburgh, Pennsylvania, USA, June 25-29, 2006},
series = {{ACM} International Conference Proceeding Series},
volume = {148},
pages = {113--120},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1143844.1143859},
doi = {10.1145/1143844.1143859},
timestamp = {Tue, 19 Nov 2019 09:25:06 +0100},
biburl = {https://dblp.org/rec/conf/icml/BleiL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/RavikumarL06,
author = {Pradeep Ravikumar and
John D. Lafferty},
editor = {William W. Cohen and
Andrew W. Moore},
title = {Quadratic programming relaxations for metric labeling and Markov random
field {MAP} estimation},
booktitle = {Machine Learning, Proceedings of the Twenty-Third International Conference
{(ICML} 2006), Pittsburgh, Pennsylvania, USA, June 25-29, 2006},
series = {{ACM} International Conference Proceeding Series},
volume = {148},
pages = {737--744},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1143844.1143937},
doi = {10.1145/1143844.1143937},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/RavikumarL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/WainwrightRL06,
author = {Martin J. Wainwright and
Pradeep Ravikumar and
John D. Lafferty},
editor = {Bernhard Sch{\"{o}}lkopf and
John C. Platt and
Thomas Hofmann},
title = {High-Dimensional Graphical Model Selection Using {\(\mathscr{l}\)}\({}_{\mbox{1}}\)-Regularized
Logistic Regression},
booktitle = {Advances in Neural Information Processing Systems 19, Proceedings
of the Twentieth Annual Conference on Neural Information Processing
Systems, Vancouver, British Columbia, Canada, December 4-7, 2006},
pages = {1465--1472},
publisher = {{MIT} Press},
year = {2006},
url = {https://proceedings.neurips.cc/paper/2006/hash/86b20716fbd5b253d27cec43127089bc-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/WainwrightRL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/mit/06/0001KLG06,
author = {Xiaojin Zhu and
Jaz S. Kandola and
John Lafferty and
Zoubin Ghahramani},
editor = {Olivier Chapelle and
Bernhard Sch{\"{o}}lkopf and
Alexander Zien},
title = {Graph Kernels by Spectral Transforms},
booktitle = {Semi-Supervised Learning},
pages = {276--291},
publisher = {The {MIT} Press},
year = {2006},
url = {https://doi.org/10.7551/mitpress/9780262033589.003.0015},
doi = {10.7551/MITPRESS/9780262033589.003.0015},
timestamp = {Mon, 22 Jul 2019 15:58:13 +0200},
biburl = {https://dblp.org/rec/books/mit/06/0001KLG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/LaffertyL05,
author = {John D. Lafferty and
Guy Lebanon},
title = {Diffusion Kernels on Statistical Manifolds},
journal = {J. Mach. Learn. Res.},
volume = {6},
pages = {129--163},
year = {2005},
url = {http://jmlr.org/papers/v6/lafferty05a.html},
timestamp = {Wed, 10 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/LaffertyL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ZhuL05,
author = {Xiaojin Zhu and
John D. Lafferty},
editor = {Luc De Raedt and
Stefan Wrobel},
title = {Harmonic mixtures: combining mixture models and graph-based methods
for inductive and scalable semi-supervised learning},
booktitle = {Machine Learning, Proceedings of the Twenty-Second International Conference
{(ICML} 2005), Bonn, Germany, August 7-11, 2005},
series = {{ACM} International Conference Proceeding Series},
volume = {119},
pages = {1052--1059},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1102351.1102484},
doi = {10.1145/1102351.1102484},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/ZhuL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/BleiL05,
author = {David M. Blei and
John D. Lafferty},
title = {Correlated Topic Models},
booktitle = {Advances in Neural Information Processing Systems 18 [Neural Information
Processing Systems, {NIPS} 2005, December 5-8, 2005, Vancouver, British
Columbia, Canada]},
pages = {147--154},
year = {2005},
url = {https://proceedings.neurips.cc/paper/2005/hash/9e82757e9a1c12cb710ad680db11f6f1-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/BleiL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LaffertyW05,
author = {John D. Lafferty and
Larry A. Wasserman},
title = {Rodeo: Sparse Nonparametric Regression in High Dimensions},
booktitle = {Advances in Neural Information Processing Systems 18 [Neural Information
Processing Systems, {NIPS} 2005, December 5-8, 2005, Vancouver, British
Columbia, Canada]},
pages = {707--714},
year = {2005},
url = {https://proceedings.neurips.cc/paper/2005/hash/d0010a6f34908640a4a6da2389772a78-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/LaffertyW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/RavikumarL05,
author = {Pradeep Ravikumar and
John D. Lafferty},
title = {Preconditioner Approximations for Probabilistic Graphical Models},
booktitle = {Advances in Neural Information Processing Systems 18 [Neural Information
Processing Systems, {NIPS} 2005, December 5-8, 2005, Vancouver, British
Columbia, Canada]},
pages = {1113--1120},
year = {2005},
url = {https://proceedings.neurips.cc/paper/2005/hash/e2f9247929b404b2fe98ba6f32301e3b-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/RavikumarL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tois/ZhaiL04,
author = {ChengXiang Zhai and
John D. Lafferty},
title = {A study of smoothing methods for language models applied to information
retrieval},
journal = {{ACM} Trans. Inf. Syst.},
volume = {22},
number = {2},
pages = {179--214},
year = {2004},
url = {https://doi.org/10.1145/984321.984322},
doi = {10.1145/984321.984322},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tois/ZhaiL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/BlumLRR04,
author = {Avrim Blum and
John D. Lafferty and
Mugizi Robert Rwebangira and
Rajashekar Reddy},
editor = {Carla E. Brodley},
title = {Semi-supervised learning using randomized mincuts},
booktitle = {Machine Learning, Proceedings of the Twenty-first International Conference
{(ICML} 2004), Banff, Alberta, Canada, July 4-8, 2004},
series = {{ACM} International Conference Proceeding Series},
volume = {69},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1015330.1015429},
doi = {10.1145/1015330.1015429},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/BlumLRR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LaffertyZL04,
author = {John D. Lafferty and
Xiaojin Zhu and
Yan Liu},
editor = {Carla E. Brodley},
title = {Kernel conditional random fields: representation and clique selection},
booktitle = {Machine Learning, Proceedings of the Twenty-first International Conference
{(ICML} 2004), Banff, Alberta, Canada, July 4-8, 2004},
series = {{ACM} International Conference Proceeding Series},
volume = {69},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1015330.1015337},
doi = {10.1145/1015330.1015337},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/LaffertyZL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LebanonL04,
author = {Guy Lebanon and
John D. Lafferty},
editor = {Carla E. Brodley},
title = {Hyperplane margin classifiers on the multinomial manifold},
booktitle = {Machine Learning, Proceedings of the Twenty-first International Conference
{(ICML} 2004), Banff, Alberta, Canada, July 4-8, 2004},
series = {{ACM} International Conference Proceeding Series},
volume = {69},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1015330.1015333},
doi = {10.1145/1015330.1015333},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/LebanonL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhuKGL04,
author = {Xiaojin Zhu and
Jaz S. Kandola and
Zoubin Ghahramani and
John D. Lafferty},
title = {Nonparametric Transforms of Graph Kernels for Semi-Supervised Learning},
booktitle = {Advances in Neural Information Processing Systems 17 [Neural Information
Processing Systems, {NIPS} 2004, December 13-18, 2004, Vancouver,
British Columbia, Canada]},
pages = {1641--1648},
year = {2004},
url = {https://proceedings.neurips.cc/paper/2004/hash/2e7ceec8361275c4e31fee5fe422740b-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/ZhuKGL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/RavikumarL04,
author = {Pradeep Ravikumar and
John D. Lafferty},
editor = {David Maxwell Chickering and
Joseph Y. Halpern},
title = {Variational Chernoff Bounds for Graphical Models},
booktitle = {{UAI} '04, Proceedings of the 20th Conference in Uncertainty in Artificial
Intelligence, Banff, Canada, July 7-11, 2004},
pages = {462--469},
publisher = {{AUAI} Press},
year = {2004},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&\#38;smnu=2\&\#38;article\_id=1142\&\#38;proceeding\_id=20},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/RavikumarL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ZhuGL03,
author = {Xiaojin Zhu and
Zoubin Ghahramani and
John D. Lafferty},
editor = {Tom Fawcett and
Nina Mishra},
title = {Semi-Supervised Learning Using Gaussian Fields and Harmonic Functions},
booktitle = {Machine Learning, Proceedings of the Twentieth International Conference
{(ICML} 2003), August 21-24, 2003, Washington, DC, {USA}},
pages = {912--919},
publisher = {{AAAI} Press},
year = {2003},
url = {http://www.aaai.org/Library/ICML/2003/icml03-118.php},
timestamp = {Tue, 12 Jul 2016 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/ZhuGL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ZhaiCL03,
author = {ChengXiang Zhai and
William W. Cohen and
John D. Lafferty},
editor = {Charles L. A. Clarke and
Gordon V. Cormack and
Jamie Callan and
David Hawking and
Alan F. Smeaton},
title = {Beyond independent relevance: methods and evaluation metrics for subtopic
retrieval},
booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
28 - August 1, 2003, Toronto, Canada},
pages = {10--17},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/860435.860440},
doi = {10.1145/860435.860440},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/ZhaiCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/MahamudHL02,
author = {Shyjan Mahamud and
Martial Hebert and
John D. Lafferty},
editor = {Anders Heyden and
Gunnar Sparr and
Mads Nielsen and
Peter Johansen},
title = {Combining Simple Discriminators for Object Discrimination},
booktitle = {Computer Vision - {ECCV} 2002, 7th European Conference on Computer
Vision, Copenhagen, Denmark, May 28-31, 2002, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {2352},
pages = {776--790},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-47977-5\_51},
doi = {10.1007/3-540-47977-5\_51},
timestamp = {Tue, 14 May 2019 10:00:45 +0200},
biburl = {https://dblp.org/rec/conf/eccv/MahamudHL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/KondorL02,
author = {Risi Kondor and
John D. Lafferty},
editor = {Claude Sammut and
Achim G. Hoffmann},
title = {Diffusion Kernels on Graphs and Other Discrete Input Spaces},
booktitle = {Machine Learning, Proceedings of the Nineteenth International Conference
{(ICML} 2002), University of New South Wales, Sydney, Australia, July
8-12, 2002},
pages = {315--322},
publisher = {Morgan Kaufmann},
year = {2002},
timestamp = {Tue, 19 Feb 2013 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/KondorL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LebanonL02,
author = {Guy Lebanon and
John D. Lafferty},
editor = {Claude Sammut and
Achim G. Hoffmann},
title = {Cranking: Combining Rankings Using Conditional Probability Models
on Permutations},
booktitle = {Machine Learning, Proceedings of the Nineteenth International Conference
{(ICML} 2002), University of New South Wales, Sydney, Australia, July
8-12, 2002},
pages = {363--370},
publisher = {Morgan Kaufmann},
year = {2002},
timestamp = {Fri, 22 Nov 2002 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/LebanonL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LaffertyL02,
author = {John D. Lafferty and
Guy Lebanon},
editor = {Suzanna Becker and
Sebastian Thrun and
Klaus Obermayer},
title = {Information Diffusion Kernels},
booktitle = {Advances in Neural Information Processing Systems 15 [Neural Information
Processing Systems, {NIPS} 2002, December 9-14, 2002, Vancouver, British
Columbia, Canada]},
pages = {375--382},
publisher = {{MIT} Press},
year = {2002},
url = {https://proceedings.neurips.cc/paper/2002/hash/5938b4d054136e5d59ada6ec9c295d7a-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/LaffertyL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LebanonL02,
author = {Guy Lebanon and
John D. Lafferty},
editor = {Suzanna Becker and
Sebastian Thrun and
Klaus Obermayer},
title = {Conditional Models on the Ranking Poset},
booktitle = {Advances in Neural Information Processing Systems 15 [Neural Information
Processing Systems, {NIPS} 2002, December 9-14, 2002, Vancouver, British
Columbia, Canada]},
pages = {415--422},
publisher = {{MIT} Press},
year = {2002},
url = {https://proceedings.neurips.cc/paper/2002/hash/936a40b7e8eea0dc537e5f2edee1387a-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/LebanonL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ZhaiL02,
author = {ChengXiang Zhai and
John D. Lafferty},
editor = {Kalervo J{\"{a}}rvelin and
Micheline Beaulieu and
Ricardo A. Baeza{-}Yates and
Sung{-}Hyon Myaeng},
title = {Two-stage language models for information retrieval},
booktitle = {{SIGIR} 2002: Proceedings of the 25th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, August
11-15, 2002, Tampere, Finland},
pages = {49--56},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/564376.564387},
doi = {10.1145/564376.564387},
timestamp = {Wed, 07 Nov 2018 14:52:44 +0100},
biburl = {https://dblp.org/rec/conf/sigir/ZhaiL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/MinkaL02,
author = {Thomas P. Minka and
John D. Lafferty},
editor = {Adnan Darwiche and
Nir Friedman},
title = {Expectation-Propogation for the Generative Aspect Model},
booktitle = {{UAI} '02, Proceedings of the 18th Conference in Uncertainty in Artificial
Intelligence, University of Alberta, Edmonton, Alberta, Canada, August
1-4, 2002},
pages = {352--359},
publisher = {Morgan Kaufmann},
year = {2002},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&\#38;smnu=2\&\#38;article\_id=879\&\#38;proceeding\_id=18},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/MinkaL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CroftCL01,
author = {W. Bruce Croft and
James P. Callan and
John D. Lafferty},
title = {Workshop on language modeling and information retrieval},
journal = {{SIGIR} Forum},
volume = {35},
number = {1},
pages = {4--6},
year = {2001},
url = {https://doi.org/10.1145/948716.948719},
doi = {10.1145/948716.948719},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CroftCL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/ZhaiL01,
author = {ChengXiang Zhai and
John D. Lafferty},
title = {Model-based Feedback in the Language Modeling Approach to Information
Retrieval},
booktitle = {Proceedings of the 2001 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Atlanta, Georgia, USA, November 5-10, 2001},
pages = {403--410},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/502585.502654},
doi = {10.1145/502585.502654},
timestamp = {Wed, 28 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/ZhaiL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LaffertyMP01,
author = {John D. Lafferty and
Andrew McCallum and
Fernando C. N. Pereira},
editor = {Carla E. Brodley and
Andrea Pohoreckyj Danyluk},
title = {Conditional Random Fields: Probabilistic Models for Segmenting and
Labeling Sequence Data},
booktitle = {Proceedings of the Eighteenth International Conference on Machine
Learning {(ICML} 2001), Williams College, Williamstown, MA, USA, June
28 - July 1, 2001},
pages = {282--289},
publisher = {Morgan Kaufmann},
year = {2001},
timestamp = {Wed, 27 Nov 2002 10:53:35 +0100},
biburl = {https://dblp.org/rec/conf/icml/LaffertyMP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LebanonL01,
author = {Guy Lebanon and
John D. Lafferty},
editor = {Thomas G. Dietterich and
Suzanna Becker and
Zoubin Ghahramani},
title = {Boosting and Maximum Likelihood for Exponential Models},
booktitle = {Advances in Neural Information Processing Systems 14 [Neural Information
Processing Systems: Natural and Synthetic, {NIPS} 2001, December 3-8,
2001, Vancouver, British Columbia, Canada]},
pages = {447--454},
publisher = {{MIT} Press},
year = {2001},
url = {https://proceedings.neurips.cc/paper/2001/hash/71e09b16e21f7b6919bbfc43f6a5b2f0-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/LebanonL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/LaffertyZ01,
author = {John D. Lafferty and
ChengXiang Zhai},
editor = {W. Bruce Croft and
David J. Harper and
Donald H. Kraft and
Justin Zobel},
title = {Document Language Models, Query Models, and Risk Minimization for
Information Retrieval},
booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, September
9-13, 2001, New Orleans, Louisiana, {USA}},
pages = {111--119},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/383952.383970},
doi = {10.1145/383952.383970},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/LaffertyZ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ZhaiL01,
author = {ChengXiang Zhai and
John D. Lafferty},
editor = {W. Bruce Croft and
David J. Harper and
Donald H. Kraft and
Justin Zobel},
title = {A Study of Smoothing Methods for Language Models Applied to Ad Hoc
Information Retrieval},
booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, September
9-13, 2001, New Orleans, Louisiana, {USA}},
pages = {334--342},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/383952.384019},
doi = {10.1145/383952.384019},
timestamp = {Mon, 26 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/ZhaiL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/LaffertyW01,
author = {John D. Lafferty and
Larry A. Wasserman},
editor = {Jack S. Breese and
Daphne Koller},
title = {Iterative Markov Chain Monte Carlo Computation of Reference Priors
and Minimax Risk},
booktitle = {{UAI} '01: Proceedings of the 17th Conference in Uncertainty in Artificial
Intelligence, University of Washington, Seattle, Washington, USA,
August 2-5, 2001},
pages = {293--300},
publisher = {Morgan Kaufmann},
year = {2001},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&\#38;smnu=2\&\#38;article\_id=112\&\#38;proceeding\_id=17},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/LaffertyW01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ml/BeefermanBL99,
author = {Doug Beeferman and
Adam L. Berger and
John D. Lafferty},
title = {Statistical Models for Text Segmentation},
journal = {Mach. Learn.},
volume = {34},
number = {1-3},
pages = {177--210},
year = {1999},
url = {https://doi.org/10.1023/A:1007506220214},
doi = {10.1023/A:1007506220214},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ml/BeefermanBL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/LaffertyV99,
author = {John D. Lafferty and
Alexander Vardy},
title = {Ordered Binary Decision Diagrams and Minimal Trellises},
journal = {{IEEE} Trans. Computers},
volume = {48},
number = {9},
pages = {971--987},
year = {1999},
url = {https://doi.org/10.1109/12.795225},
doi = {10.1109/12.795225},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/LaffertyV99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/Lafferty99,
author = {John D. Lafferty},
editor = {Shai Ben{-}David and
Philip M. Long},
title = {Additive Models, Boosting, and Inference for Generalized Divergences},
booktitle = {Proceedings of the Twelfth Annual Conference on Computational Learning
Theory, {COLT} 1999, Santa Cruz, CA, USA, July 7-9, 1999},
pages = {125--133},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/307400.307422},
doi = {10.1145/307400.307422},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/colt/Lafferty99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/BergerL99,
author = {Adam L. Berger and
John D. Lafferty},
editor = {Fredric C. Gey and
Marti A. Hearst and
Richard M. Tong},
title = {Information Retrieval as Statistical Translation},
booktitle = {{SIGIR} '99: Proceedings of the 22nd Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, August
15-19, 1999, Berkeley, CA, {USA}},
pages = {222--229},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/312624.312681},
doi = {10.1145/312624.312681},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/BergerL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/BergerL99,
author = {Adam L. Berger and
John D. Lafferty},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {The Weaver System for Document Retrieval},
booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
Gaithersburg, Maryland, USA, November 17-19, 1999},
series = {{NIST} Special Publication},
volume = {500-246},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {1999},
url = {http://trec.nist.gov/pubs/trec8/papers/weaver.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/BergerL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/BeefermanBL98,
author = {Doug Beeferman and
Adam L. Berger and
John D. Lafferty},
title = {Cyberpunc: a lightweight punctuation annotation system for speech},
booktitle = {Proceedings of the 1998 {IEEE} International Conference on Acoustics,
Speech and Signal Processing, {ICASSP} '98, Seattle, Washington, USA,
May 12-15, 1998},
pages = {689--692},
publisher = {{IEEE}},
year = {1998},
url = {https://doi.org/10.1109/ICASSP.1998.675358},
doi = {10.1109/ICASSP.1998.675358},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/BeefermanBL98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/PietraPL97,
author = {Stephen Della Pietra and
Vincent J. Della Pietra and
John D. Lafferty},
title = {Inducing Features of Random Fields},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {19},
number = {4},
pages = {380--393},
year = {1997},
url = {https://doi.org/10.1109/34.588021},
doi = {10.1109/34.588021},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/PietraPL97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/BeefermanBL97,
author = {Doug Beeferman and
Adam L. Berger and
John D. Lafferty},
editor = {Philip R. Cohen and
Wolfgang Wahlster},
title = {A Model of Lexical Attraction and Repulsion},
booktitle = {35th Annual Meeting of the Association for Computational Linguistics
and 8th Conference of the European Chapter of the Association for
Computational Linguistics, Proceedings of the Conference, 7-12 July
1997, Universidad Nacional de Educaci{\'{o}}n a Distancia (UNED),
Madrid, Spain},
pages = {373--380},
publisher = {Morgan Kaufmann Publishers / {ACL}},
year = {1997},
url = {https://aclanthology.org/P97-1048/},
doi = {10.3115/976909.979665},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/BeefermanBL97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/BeefermanBL97,
author = {Doug Beeferman and
Adam L. Berger and
John D. Lafferty},
editor = {Claire Cardie and
Ralph M. Weischedel},
title = {Text Segmentation Using Exponential Models},
booktitle = {Second Conference on Empirical Methods in Natural Language Processing,
{EMNLP} 1997, Providence, RI, USA, August 1-2, 1997},
publisher = {{ACL}},
year = {1997},
url = {https://aclanthology.org/W97-0304/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/BeefermanBL97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stoc/LaffertyR97,
author = {John D. Lafferty and
Daniel N. Rockmore},
editor = {Frank Thomson Leighton and
Peter W. Shor},
title = {Spectral Techniques for Expander Codes},
booktitle = {Proceedings of the Twenty-Ninth Annual {ACM} Symposium on the Theory
of Computing, El Paso, Texas, USA, May 4-6, 1997},
pages = {160--167},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/258533.258575},
doi = {10.1145/258533.258575},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/stoc/LaffertyR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cmp-lg-9706016,
author = {Doug Beeferman and
Adam L. Berger and
John D. Lafferty},
title = {Text Segmentation Using Exponential Models},
journal = {CoRR},
volume = {cmp-lg/9706016},
year = {1997},
url = {http://arxiv.org/abs/cmp-lg/9706016},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/cmp-lg-9706016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cmp-lg-9706018,
author = {Doug Beeferman and
Adam L. Berger and
John D. Lafferty},
title = {A Model of Lexical Attraction and Repulsion},
journal = {CoRR},
volume = {cmp-lg/9706018},
year = {1997},
url = {http://arxiv.org/abs/cmp-lg/9706018},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/cmp-lg-9706018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/PlacewayL96,
author = {Paul Placeway and
John D. Lafferty},
title = {Cheating with imperfect transcripts},
booktitle = {The 4th International Conference on Spoken Language Processing, Philadelphia,
PA, USA, October 3-6, 1996},
pages = {2115--2118},
publisher = {{ISCA}},
year = {1996},
url = {https://doi.org/10.21437/ICSLP.1996-536},
doi = {10.21437/ICSLP.1996-536},
timestamp = {Thu, 22 Jun 2023 16:42:20 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/PlacewayL96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WangLW96,
author = {Ye{-}Yi Wang and
John D. Lafferty and
Alex Waibel},
title = {Word clustering with parallel spoken language corpora},
booktitle = {The 4th International Conference on Spoken Language Processing, Philadelphia,
PA, USA, October 3-6, 1996},
pages = {2364--2367},
publisher = {{ISCA}},
year = {1996},
url = {https://doi.org/10.21437/ICSLP.1996-562},
doi = {10.21437/ICSLP.1996-562},
timestamp = {Thu, 22 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/WangLW96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwpt/GrinbergLS95,
author = {Dennis Grinberg and
John Lafferty and
Daniel Dominic Sleator},
title = {A Robust Parsing Algorithm for Link Grammars},
booktitle = {Proceedings of the Fourth International Workshop on Parsing Technologies,
{IWPT} 1995, Prague and Karlovy Vary, Czech Republic, September 20-24,
1995},
pages = {111--125},
publisher = {Association for Computational Linguistics},
year = {1995},
url = {https://aclanthology.org/1995.iwpt-1.15/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwpt/GrinbergLS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cmp-lg-9506014,
author = {Stephen Della Pietra and
Vincent J. Della Pietra and
John D. Lafferty},
title = {Inducing Features of Random Fields},
journal = {CoRR},
volume = {abs/cmp-lg/9506014},
year = {1995},
url = {http://arxiv.org/abs/cmp-lg/9506014},
eprinttype = {arXiv},
eprint = {cmp-lg/9506014},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-cmp-lg-9506014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cmp-lg-9508003,
author = {Dennis Grinberg and
John D. Lafferty and
Daniel Dominic Sleator},
title = {A Robust Parsing Algorithm For Link Grammars},
journal = {CoRR},
volume = {abs/cmp-lg/9508003},
year = {1995},
url = {http://arxiv.org/abs/cmp-lg/9508003},
eprinttype = {arXiv},
eprint = {cmp-lg/9508003},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-cmp-lg-9508003.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cmp-lg-9509003,
author = {John D. Lafferty and
Bernhard Suhm},
title = {Cluster Expansions and Iterative Scaling for Maximum Entropy Language
Models},
journal = {CoRR},
volume = {abs/cmp-lg/9509003},
year = {1995},
url = {http://arxiv.org/abs/cmp-lg/9509003},
eprinttype = {arXiv},
eprint = {cmp-lg/9509003},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-cmp-lg-9509003.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icgi/PietraPGLPU94,
author = {Stephen Della Pietra and
Vincent J. Della Pietra and
John R. Gillett and
John D. Lafferty and
Harry Printz and
Lubos Ures},
editor = {Rafael C. Carrasco and
Jos{\'{e}} Oncina},
title = {Inference and Estimation of a Long-Range Trigram Model},
booktitle = {Grammatical Inference and Applications, Second International Colloquium,
ICGI-94, Alicante, Spain, September 21-23, 1994, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {862},
pages = {78--92},
publisher = {Springer},
year = {1994},
url = {https://doi.org/10.1007/3-540-58473-0\_139},
doi = {10.1007/3-540-58473-0\_139},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/icgi/PietraPGLPU94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/BergerBPPGLMPU94,
author = {Adam L. Berger and
Peter F. Brown and
Stephen Della Pietra and
Vincent J. Della Pietra and
John R. Gillett and
John D. Lafferty and
Robert L. Mercer and
Harry Printz and
Lubos Ures},
title = {The Candide System for Machine Translation},
booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro,
New Jerey, USA, March 8-11, 1994},
publisher = {Morgan Kaufmann},
year = {1994},
url = {https://aclanthology.org/H94-1028/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/BergerBPPGLMPU94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/JelinekLMMRR94,
author = {Frederick Jelinek and
John D. Lafferty and
David M. Magerman and
Robert L. Mercer and
Adwait Ratnaparkhi and
Salim Roukos},
title = {Decision Tree Parsing using a Hidden Derivation Model},
booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro,
New Jerey, USA, March 8-11, 1994},
publisher = {Morgan Kaufmann},
year = {1994},
url = {https://aclanthology.org/H94-1052/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/JelinekLMMRR94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BlackJLMMR94,
author = {Ezra Black and
Frederick Jelinek and
John D. Lafferty and
David M. Magerman and
Robert L. Mercer and
Salim Roukos},
title = {Towards History-based Grammars: Using Richer Models for Probabilistic
Parsing},
journal = {CoRR},
volume = {abs/cmp-lg/9405007},
year = {1994},
url = {http://arxiv.org/abs/cmp-lg/9405007},
eprinttype = {arXiv},
eprint = {cmp-lg/9405007},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BlackJLMMR94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/BlackJLMMR93,
author = {Ezra Black and
Frederick Jelinek and
John D. Lafferty and
David M. Magerman and
Robert L. Mercer and
Salim Roukos},
editor = {Lenhart K. Schubert},
title = {Towards History-Based Grammars: Using Richer Models for Probabilistic
Parsing},
booktitle = {31st Annual Meeting of the Association for Computational Linguistics,
22-26 June 1993, Ohio State University, Columbus, Ohio, USA, Proceedings},
pages = {31--37},
publisher = {{ACL}},
year = {1993},
url = {https://aclanthology.org/P93-1005/},
doi = {10.3115/981574.981579},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/BlackJLMMR93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/em/LaffertyR92,
author = {John D. Lafferty and
Daniel N. Rockmore},
title = {Fast Fourier Analysis for SL\({}_{\mbox{2}}\) over a Finite Field
and Related Numerical Experiments},
journal = {Exp. Math.},
volume = {1},
number = {2},
pages = {115--139},
year = {1992},
url = {https://doi.org/10.1080/10586458.1992.10504252},
doi = {10.1080/10586458.1992.10504252},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/em/LaffertyR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/BlackLR92,
author = {Ezra Black and
John D. Lafferty and
Salim Roukos},
editor = {Henry S. Thompson},
title = {Development and Evaluation of a Broad-Coverage Probabilistic Grammar
of English-Language Computer Manuals},
booktitle = {30th Annual Meeting of the Association for Computational Linguistics,
28 June - 2 July 1992, University of Delaware, Newark, Deleware, USA,
Proceedings},
pages = {185--192},
publisher = {{ACL}},
year = {1992},
url = {https://aclanthology.org/P92-1024/},
doi = {10.3115/981967.981991},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/BlackLR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dimacs/LaffertyR92,
author = {John D. Lafferty and
Daniel N. Rockmore},
editor = {Joel Friedman},
title = {Numerical Investigation of the Spectrum for Certain Families of Cayley
Graphs},
booktitle = {Expanding Graphs, Proceedings of a {DIMACS} Workshop, Princeton, New
Jersey, USA, May 11-14, 1992},
series = {{DIMACS} Series in Discrete Mathematics and Theoretical Computer Science},
volume = {10},
pages = {63--73},
publisher = {{DIMACS/AMS}},
year = {1992},
url = {https://doi.org/10.1090/dimacs/010/06},
doi = {10.1090/DIMACS/010/06},
timestamp = {Mon, 22 May 2023 16:07:35 +0200},
biburl = {https://dblp.org/rec/conf/dimacs/LaffertyR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/BlackJLMMR92,
author = {Ezra Black and
Frederick Jelinek and
John D. Lafferty and
David M. Magerman and
Robert L. Mercer and
Salim Roukos},
title = {Towards History-based Grammars: Using Richer Models for Probabilistic
Parsing},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman,
New York, USA, February 23-26, 1992},
publisher = {Morgan Kaufmann},
year = {1992},
url = {https://aclanthology.org/H92-1026/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/BlackJLMMR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/BlackJLMR92,
author = {Ezra Black and
Frederick Jelinek and
John D. Lafferty and
Robert L. Mercer and
Salim Roukos},
title = {Decision Tree Models Applied to the Labeling of Text with Parts-of-Speech},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman,
New York, USA, February 23-26, 1992},
publisher = {Morgan Kaufmann},
year = {1992},
url = {https://aclanthology.org/H92-1023/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/BlackJLMR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/JelinekL91,
author = {Frederick Jelinek and
John D. Lafferty},
title = {Computation of the Probability of Initial Substring Generation by
Stochastic Context-Free Grammars},
journal = {Comput. Linguistics},
volume = {17},
number = {3},
pages = {315--323},
year = {1991},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/coling/JelinekL91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/BrownCPPJLMR90,
author = {Peter F. Brown and
John Cocke and
Stephen Della Pietra and
Vincent J. Della Pietra and
Frederick Jelinek and
John D. Lafferty and
Robert L. Mercer and
Paul S. Roossin},
title = {A Statistical Approach to Machine Translation},
journal = {Comput. Linguistics},
volume = {16},
number = {2},
pages = {79--85},
year = {1990},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/coling/BrownCPPJLMR90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-02-20 20:12 CET by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
