Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: David E. Shaw
@article{DBLP:journals/jcisd/GreismanWYGSNMS23,
author = {Jack B. Greisman and
Lindsay Willmore and
Christine Y. Yeh and
Fabrizio Giordanetto and
Sahar Shahamadtar and
Hunter M. Nisonoff and
Paul Maragakis and
David E. Shaw},
title = {Discovery and Validation of the Binding Poses of Allosteric Fragment
Hits to Protein Tyrosine Phosphatase 1b: From Molecular Dynamics Simulations
to X-ray Crystallography},
journal = {J. Chem. Inf. Model.},
volume = {63},
number = {9},
pages = {2644--2650},
year = {2023},
url = {https://doi.org/10.1021/acs.jcim.3c00236},
doi = {10.1021/ACS.JCIM.3C00236},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/GreismanWYGSNMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/YehIGWMS23,
author = {Christine Y. Yeh and
Jesus A. Izaguirre and
Jack B. Greisman and
Lindsay Willmore and
Paul Maragakis and
David E. Shaw},
title = {A Conserved Local Structural Motif Controls the Kinetics of {PTP1B}
Catalysis},
journal = {J. Chem. Inf. Model.},
volume = {63},
number = {13},
pages = {4115--4124},
year = {2023},
url = {https://doi.org/10.1021/acs.jcim.3c00286},
doi = {10.1021/ACS.JCIM.3C00286},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/YehIGWMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/ShanMLKSS22,
author = {Yibing Shan and
Venkatesh P. Mysore and
Abba E. Leffler and
Eric T. Kim and
Shiori Sagawa and
David E. Shaw},
title = {How does a small molecule bind at a cryptic binding site?},
journal = {PLoS Comput. Biol.},
volume = {18},
number = {3},
year = {2022},
url = {https://doi.org/10.1371/journal.pcbi.1009817},
doi = {10.1371/JOURNAL.PCBI.1009817},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/ShanMLKSS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/ShimGTEGS22,
author = {Keun Sup Shim and
Brian Greskamp and
Brian Towles and
Bruce Edwards and
J. P. Grossman and
David E. Shaw},
title = {The Specialized High-Performance Network on Anton 3},
booktitle = {{IEEE} International Symposium on High-Performance Computer Architecture,
{HPCA} 2022, Seoul, South Korea, April 2-6, 2022},
pages = {1211--1223},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/HPCA53966.2022.00092},
doi = {10.1109/HPCA53966.2022.00092},
timestamp = {Mon, 23 May 2022 16:36:22 +0200},
biburl = {https://dblp.org/rec/conf/hpca/ShimGTEGS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-08357,
author = {Keun Sup Shim and
Brian Greskamp and
Brian Towles and
Bruce Edwards and
J. P. Grossman and
David E. Shaw},
title = {The Specialized High-Performance Network on Anton 3},
journal = {CoRR},
volume = {abs/2201.08357},
year = {2022},
url = {https://arxiv.org/abs/2201.08357},
eprinttype = {arXiv},
eprint = {2201.08357},
timestamp = {Tue, 01 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-08357.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotchips/AdamsBBBBCEFFFG21,
author = {Peter J. Adams and
Brannon Batson and
Alistair Bell and
Jhanvi Bhatt and
J. Adam Butts and
Timothy Correia and
Bruce Edwards and
Peter Feldmann and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Maria Gorlatova and
Brian Greskamp and
J. P. Grossman and
Jeremy Hunt and
Bryan L. Jackson and
Mollie M. Kirk and
Jeffrey Kuskin and
Roy J. Mader and
Richard McGowen and
Adam McLaughlin and
Mark A. Moraes and
Mohamed Nasr and
Lawrence J. Nociolo and
Lief O'Donnell and
Andrew Parker and
Jon L. Peticolas and
Terry Quan and
T. Carl Schwink and
Keun Sup Shim and
Naseer Siddique and
Jochen Spengler and
Michael Theobald and
Brian Towles and
William Vick and
Stanley C. Wang and
Michael E. Wazlowski and
Madeleine J. Weingarten and
John M. Williams and
David E. Shaw},
title = {The {\(\Lambda\)}NTON 3 {ASIC:} a Fire-Breathing Monster for Molecular
Dynamics Simulations},
booktitle = {{IEEE} Hot Chips 33 Symposium, {HCS} 2021, Palo Alto, CA, USA, August
22-24, 2021},
pages = {1--22},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/HCS52781.2021.9567084},
doi = {10.1109/HCS52781.2021.9567084},
timestamp = {Mon, 25 Oct 2021 18:04:14 +0200},
biburl = {https://dblp.org/rec/conf/hotchips/AdamsBBBBCEFFFG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawAABBBBBBCDD21,
author = {David E. Shaw and
Peter J. Adams and
Asaph Azaria and
Joseph A. Bank and
Brannon Batson and
Alistair Bell and
Michael Bergdorf and
Jhanvi Bhatt and
J. Adam Butts and
Timothy Correia and
Robert M. Dirks and
Ron O. Dror and
Michael P. Eastwood and
Bruce Edwards and
Amos Even and
Peter Feldmann and
Michael Fenn and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Maria Gorlatova and
Brian Greskamp and
J. P. Grossman and
Justin Gullingsrud and
Anissa Harper and
William Hasenplaugh and
Mark Heily and
Benjamin Colin Heshmat and
Jeremy Hunt and
Douglas J. Ierardi and
Lev Iserovich and
Bryan L. Jackson and
Nick P. Johnson and
Mollie M. Kirk and
John L. Klepeis and
Jeffrey S. Kuskin and
Kenneth M. Mackenzie and
Roy J. Mader and
Richard McGowen and
Adam McLaughlin and
Mark A. Moraes and
Mohamed H. Nasr and
Lawrence J. Nociolo and
Lief O'Donnell and
Andrew Parker and
Jon L. Peticolas and
Goran Pocina and
Cristian Predescu and
Terry Quan and
John K. Salmon and
Carl Schwink and
Keun Sup Shim and
Naseer Siddique and
Jochen Spengler and
Tamas Szalay and
Raymond Tabladillo and
Reinhard Tartler and
Andrew G. Taube and
Michael Theobald and
Brian Towles and
William Vick and
Stanley C. Wang and
Michael Wazlowski and
Madeleine J. Weingarten and
John M. Williams and
Kevin A. Yuh},
editor = {Bronis R. de Supinski and
Mary W. Hall and
Todd Gamblin},
title = {Anton 3: twenty microseconds of molecular dynamics simulation before
lunch},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, {SC} 2021, St. Louis, Missouri, USA, November
14-19, 2021},
pages = {1},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3458817.3487397},
doi = {10.1145/3458817.3487397},
timestamp = {Tue, 08 Nov 2022 16:03:02 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShawAABBBBBBCDD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/JiangFWCS20,
author = {Siduo Jiang and
Miklos Feher and
Christopher I. Williams and
Brian Cole and
David E. Shaw},
title = {AutoPH4: An Automated Method for Generating Pharmacophore Models from
Protein Binding Pockets},
journal = {J. Chem. Inf. Model.},
volume = {60},
number = {9},
pages = {4326--4338},
year = {2020},
url = {https://doi.org/10.1021/acs.jcim.0c00121},
doi = {10.1021/ACS.JCIM.0C00121},
timestamp = {Wed, 01 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/JiangFWCS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/MaragakisNCS20,
author = {Paul Maragakis and
Hunter M. Nisonoff and
Brian Cole and
David E. Shaw},
title = {A Deep-Learning View of Chemical Space Designed to Facilitate Drug
Discovery},
journal = {J. Chem. Inf. Model.},
volume = {60},
number = {10},
pages = {4487--4496},
year = {2020},
url = {https://doi.org/10.1021/acs.jcim.0c00321},
doi = {10.1021/ACS.JCIM.0C00321},
timestamp = {Wed, 01 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/MaragakisNCS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-02948,
author = {Paul Maragakis and
Hunter M. Nisonoff and
Brian Cole and
David E. Shaw},
title = {A deep-learning view of chemical space designed to facilitate drug
discovery},
journal = {CoRR},
volume = {abs/2002.02948},
year = {2020},
url = {https://arxiv.org/abs/2002.02948},
eprinttype = {arXiv},
eprint = {2002.02948},
timestamp = {Mon, 10 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-02948.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-06431,
author = {John J. Cherian and
Andrew G. Taube and
Robert T. McGibbon and
Panagiotis Angelikopoulos and
Guy Blanc and
Michael Snarski and
Daniel D. Richman and
John L. Klepeis and
David E. Shaw},
title = {Efficient hyperparameter optimization by way of PAC-Bayes bound minimization},
journal = {CoRR},
volume = {abs/2008.06431},
year = {2020},
url = {https://arxiv.org/abs/2008.06431},
eprinttype = {arXiv},
eprint = {2008.06431},
timestamp = {Fri, 21 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-06431.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/SongJJSLMSG18,
author = {Xianqiang Song and
Morten {\O}. Jensen and
Vishwanath Jogini and
Richard A. Stein and
Chia{-}Hsueh Lee and
Hassane S. Mchaourab and
David E. Shaw and
Eric Gouaux},
title = {Mechanism of {NMDA} receptor channel block by {MK-801} and memantine},
journal = {Nat.},
volume = {556},
number = {7702},
pages = {515--519},
year = {2018},
url = {https://doi.org/10.1038/s41586-018-0039-9},
doi = {10.1038/S41586-018-0039-9},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nature/SongJJSLMSG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/GrossmanTGS15,
author = {J. P. Grossman and
Brian Towles and
Brian Greskamp and
David E. Shaw},
title = {Filtering, Reductions and Synchronization in the Anton 2 Network},
booktitle = {2015 {IEEE} International Parallel and Distributed Processing Symposium,
{IPDPS} 2015, Hyderabad, India, May 25-29, 2015},
pages = {860--870},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/IPDPS.2015.42},
doi = {10.1109/IPDPS.2015.42},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/GrossmanTGS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/ArkhipovSKS14,
author = {Anton Arkhipov and
Yibing Shan and
Eric T. Kim and
David E. Shaw},
title = {Membrane Interaction of Bound Ligands Contributes to the Negative
Binding Cooperativity of the {EGF} Receptor},
journal = {PLoS Comput. Biol.},
volume = {10},
number = {7},
year = {2014},
url = {https://doi.org/10.1371/journal.pcbi.1003742},
doi = {10.1371/JOURNAL.PCBI.1003742},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/ArkhipovSKS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/TowlesGGS14,
author = {Brian Towles and
J. P. Grossman and
Brian Greskamp and
David E. Shaw},
title = {Unifying on-chip and inter-node switching within the Anton 2 network},
booktitle = {{ACM/IEEE} 41st International Symposium on Computer Architecture,
{ISCA} 2014, Minneapolis, MN, USA, June 14-18, 2014},
pages = {1--12},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ISCA.2014.6853238},
doi = {10.1109/ISCA.2014.6853238},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/TowlesGGS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14,
author = {David E. Shaw and
J. P. Grossman and
Joseph A. Bank and
Brannon Batson and
J. Adam Butts and
Jack C. Chao and
Martin M. Deneroff and
Ron O. Dror and
Amos Even and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Brian Greskamp and
C. Richard Ho and
Douglas J. Ierardi and
Lev Iserovich and
Jeffrey Kuskin and
Richard H. Larson and
Timothy Layman and
Li{-}Siang Lee and
Adam K. Lerer and
Chester Li and
Daniel Killebrew and
Kenneth M. Mackenzie and
Shark Yeuk{-}Hai Mok and
Mark A. Moraes and
Rolf Mueller and
Lawrence J. Nociolo and
Jon L. Peticolas and
Terry Quan and
Daniel Ramot and
John K. Salmon and
Daniele Paolo Scarpazza and
U. Ben Schafer and
Naseer Siddique and
Christopher W. Snyder and
Jochen Spengler and
Ping Tak Peter Tang and
Michael Theobald and
Horia Toma and
Brian Towles and
Benjamin Vitale and
Stanley C. Wang and
Cliff Young},
editor = {Trish Damkroger and
Jack J. Dongarra},
title = {Anton 2: Raising the Bar for Performance and Programmability in a
Special-Purpose Molecular Dynamics Supercomputer},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, {SC} 2014, New Orleans, LA, USA, November 16-21,
2014},
pages = {41--53},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/SC.2014.9},
doi = {10.1109/SC.2014.9},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/GrossmanKBTDILSTYS13,
author = {J. P. Grossman and
Jeffrey Kuskin and
Joseph A. Bank and
Michael Theobald and
Ron O. Dror and
Douglas J. Ierardi and
Richard H. Larson and
U. Ben Schafer and
Brian Towles and
Cliff Young and
David E. Shaw},
editor = {Vivek Sarkar and
Rastislav Bod{\'{\i}}k},
title = {Hardware support for fine-grained event-driven computation in Anton
2},
booktitle = {Architectural Support for Programming Languages and Operating Systems,
{ASPLOS} 2013, Houston, TX, USA, March 16-20, 2013},
pages = {549--560},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2451116.2451175},
doi = {10.1145/2451116.2451175},
timestamp = {Wed, 07 Jul 2021 13:23:08 +0200},
biburl = {https://dblp.org/rec/conf/asplos/GrossmanKBTDILSTYS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/GrossmanTBS13,
author = {J. P. Grossman and
Brian Towles and
Joseph A. Bank and
David E. Shaw},
title = {The role of cascade, a cycle-based simulation infrastructure, in designing
the anton special-purpose supercomputers},
booktitle = {The 50th Annual Design Automation Conference 2013, {DAC} '13, Austin,
TX, USA, May 29 - June 07, 2013},
pages = {122:1--122:9},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2463209.2488884},
doi = {10.1145/2463209.2488884},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/GrossmanTBS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpdc/Shaw13,
author = {David E. Shaw},
editor = {Manish Parashar and
Jon B. Weissman and
Dick H. J. Epema and
Renato J. O. Figueiredo},
title = {Anton: a special-purpose machine that achieves a hundred-fold speedup
in biomolecular simulations},
booktitle = {The 22nd International Symposium on High-Performance Parallel and
Distributed Computing, HPDC'13, New York, NY, {USA} - June 17 - 21,
2013},
pages = {129--130},
publisher = {{ACM}},
year = {2013},
url = {https://dl.acm.org/citation.cfm?id=2465528},
timestamp = {Mon, 26 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpdc/Shaw13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/ScarpazzaILMPBCDGKMPSS13,
author = {Daniele Paolo Scarpazza and
Douglas J. Ierardi and
Adam K. Lerer and
Kenneth M. Mackenzie and
Albert C. Pan and
Joseph A. Bank and
Edmond Chow and
Ron O. Dror and
J. P. Grossman and
Daniel Killebrew and
Mark A. Moraes and
Cristian Predescu and
John K. Salmon and
David E. Shaw},
title = {Extending the Generality of Molecular Dynamics Simulations on a Special-Purpose
Machine},
booktitle = {27th {IEEE} International Symposium on Parallel and Distributed Processing,
{IPDPS} 2013, Cambridge, MA, USA, May 20-24, 2013},
pages = {933--945},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/IPDPS.2013.93},
doi = {10.1109/IPDPS.2013.93},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/ScarpazzaILMPBCDGKMPSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispass/JiangBMBTSKD13,
author = {Nan Jiang and
Daniel U. Becker and
George Michelogiannakis and
James D. Balfour and
Brian Towles and
David E. Shaw and
John Kim and
William J. Dally},
title = {A detailed and flexible cycle-accurate Network-on-Chip simulator},
booktitle = {2012 {IEEE} International Symposium on Performance Analysis of Systems
{\&} Software, Austin, TX, USA, 21-23 April, 2013},
pages = {86--96},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/ISPASS.2013.6557149},
doi = {10.1109/ISPASS.2013.6557149},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispass/JiangBMBTSKD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/BorhaniS12,
author = {David W. Borhani and
David E. Shaw},
title = {The future of molecular dynamics simulations in drug discovery},
journal = {J. Comput. Aided Mol. Des.},
volume = {26},
number = {1},
pages = {15--26},
year = {2012},
url = {https://doi.org/10.1007/s10822-011-9517-y},
doi = {10.1007/S10822-011-9517-Y},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/BorhaniS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/DrorGMTCSYBBSKLMS11,
author = {Ron O. Dror and
J. P. Grossman and
Kenneth M. Mackenzie and
Brian Towles and
Edmond Chow and
John K. Salmon and
Cliff Young and
Joseph A. Bank and
Brannon Batson and
Martin M. Deneroff and
Jeffrey Kuskin and
Richard H. Larson and
Mark A. Moraes and
David E. Shaw},
title = {Overcoming Communication Latency Barriers in Massively Parallel Scientific
Computation},
journal = {{IEEE} Micro},
volume = {31},
number = {3},
pages = {8--19},
year = {2011},
url = {https://doi.org/10.1109/MM.2011.38},
doi = {10.1109/MM.2011.38},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/DrorGMTCSYBBSKLMS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/ButtsTDS10,
author = {J. Adam Butts and
Ping Tak Peter Tang and
Ron O. Dror and
David E. Shaw},
editor = {Elisardo Antelo and
David Hough and
Paolo Ienne},
title = {Radix-8 Digit-by-Rounding: Achieving High-Performance Reciprocals,
Square Roots, and Reciprocal Square Roots},
booktitle = {20th {IEEE} Symposium on Computer Arithmetic, {ARITH} 2011, T{\"{u}}bingen,
Germany, 25-27 July 2011},
pages = {149--158},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ARITH.2011.28},
doi = {10.1109/ARITH.2011.28},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/arith/ButtsTDS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/TangBDS10,
author = {Ping Tak Peter Tang and
J. Adam Butts and
Ron O. Dror and
David E. Shaw},
editor = {Elisardo Antelo and
David Hough and
Paolo Ienne},
title = {Tight Certification Techniques for Digit-by-Rounding Algorithms with
Application to a New 1/sqrt(x) Design},
booktitle = {20th {IEEE} Symposium on Computer Arithmetic, {ARITH} 2011, T{\"{u}}bingen,
Germany, 25-27 July 2011},
pages = {159--168},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ARITH.2011.29},
doi = {10.1109/ARITH.2011.29},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/arith/TangBDS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/SalmonMDS11,
author = {John K. Salmon and
Mark A. Moraes and
Ron O. Dror and
David E. Shaw},
editor = {Scott A. Lathrop and
Jim Costa and
William Kramer},
title = {Parallel random numbers: as easy as 1, 2, 3},
booktitle = {Conference on High Performance Computing Networking, Storage and Analysis,
{SC} 2011, Seattle, WA, USA, November 12-18, 2011},
pages = {16:1--16:12},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2063384.2063405},
doi = {10.1145/2063384.2063405},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/SalmonMDS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/parallel/DrorYS11,
author = {Ron O. Dror and
Cliff Young and
David E. Shaw},
editor = {David A. Padua},
title = {Anton, {A} Special-Purpose Molecular Simulation Machine},
booktitle = {Encyclopedia of Parallel Computing},
pages = {60--71},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-0-387-09766-4\_199},
doi = {10.1007/978-0-387-09766-4\_199},
timestamp = {Wed, 12 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/parallel/DrorYS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/BowersLDS10,
author = {Kevin J. Bowers and
Ross A. Lippert and
Ron O. Dror and
David E. Shaw},
title = {Improved twiddle access for fast fourier transforms},
journal = {{IEEE} Trans. Signal Process.},
volume = {58},
number = {3},
pages = {1122--1130},
year = {2010},
url = {https://doi.org/10.1109/TSP.2009.2035984},
doi = {10.1109/TSP.2009.2035984},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsp/BowersLDS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fast/TuRMSDS10,
author = {Tiankai Tu and
Charles A. Rendleman and
Patrick J. Miller and
Federico D. Sacerdoti and
Ron O. Dror and
David E. Shaw},
editor = {Randal C. Burns and
Kimberly Keeton},
title = {Accelerating Parallel Analysis of Scientific Simulation Data via Zazen},
booktitle = {8th {USENIX} Conference on File and Storage Technologies, San Jose,
CA, USA, February 23-26, 2010},
pages = {129--142},
publisher = {{USENIX}},
year = {2010},
url = {http://www.usenix.org/events/fast10/tech/full\_papers/tu.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fast/TuRMSDS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/DrorGMTCSYBBDKLMS10,
author = {Ron O. Dror and
J. P. Grossman and
Kenneth M. Mackenzie and
Brian Towles and
Edmond Chow and
John K. Salmon and
Cliff Young and
Joseph A. Bank and
Brannon Batson and
Martin M. Deneroff and
Jeffrey Kuskin and
Richard H. Larson and
Mark A. Moraes and
David E. Shaw},
title = {Exploiting 162-Nanosecond End-to-End Communication Latency on Anton},
booktitle = {Conference on High Performance Computing Networking, Storage and Analysis,
{SC} 2010, New Orleans, LA, USA, November 13-19, 2010},
pages = {1--12},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/SC.2010.23},
doi = {10.1109/SC.2010.23},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/DrorGMTCSYBBDKLMS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/Shaw09,
author = {David E. Shaw},
editor = {Javier D. Bruguera and
Marius Cornea and
Debjit Das Sarma and
John Harrison},
title = {Anton: {A} Specialized Machine for Millisecond-Scale Molecular Dynamics
Simulations of Proteins},
booktitle = {19th {IEEE} Symposium on Computer Arithmetic, {ARITH} 2009, Portland,
Oregon, USA, 9-10 June 2009},
pages = {3},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ARITH.2009.33},
doi = {10.1109/ARITH.2009.33},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/arith/Shaw09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09,
author = {David E. Shaw and
Ron O. Dror and
John K. Salmon and
J. P. Grossman and
Kenneth M. Mackenzie and
Joseph A. Bank and
Cliff Young and
Martin M. Deneroff and
Brannon Batson and
Kevin J. Bowers and
Edmond Chow and
Michael P. Eastwood and
Doug Ierardi and
John L. Klepeis and
Jeffrey Kuskin and
Richard H. Larson and
Kresten Lindorff{-}Larsen and
Paul Maragakis and
Mark A. Moraes and
Stefano Piana and
Yibing Shan and
Brian Towles},
title = {Millisecond-scale molecular dynamics simulations on Anton},
booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
{SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1654059.1654099},
doi = {10.1145/1654059.1654099},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09a,
author = {David E. Shaw and
Ron O. Dror and
John K. Salmon and
J. P. Grossman and
Kenneth M. Mackenzie and
Joseph A. Bank and
Cliff Young and
Martin M. Deneroff and
Brannon Batson and
Kevin J. Bowers and
Edmond Chow and
Michael P. Eastwood and
Doug Ierardi and
John L. Klepeis and
Jeffrey Kuskin and
Richard H. Larson and
Kresten Lindorff{-}Larsen and
Paul Maragakis and
Mark A. Moraes and
Stefano Piana and
Yibing Shan and
Brian Towles},
title = {Millisecond-scale molecular dynamics simulations on Anton},
booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
{SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1654059.1654126},
doi = {10.1145/1654059.1654126},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/YoungBDGSS09,
author = {Cliff Young and
Joseph A. Bank and
Ron O. Dror and
J. P. Grossman and
John K. Salmon and
David E. Shaw},
title = {A 32x32x32, spatially distributed 3D {FFT} in four microseconds on
Anton},
booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
{SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1654059.1654083},
doi = {10.1145/1654059.1654083},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/YoungBDGSS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08,
author = {David E. Shaw and
Martin M. Deneroff and
Ron O. Dror and
Jeffrey Kuskin and
Richard H. Larson and
John K. Salmon and
Cliff Young and
Brannon Batson and
Kevin J. Bowers and
Jack C. Chao and
Michael P. Eastwood and
Joseph Gagliardo and
J. P. Grossman and
C. Richard Ho and
Doug Ierardi and
Istv{\'{a}}n Kolossv{\'{a}}ry and
John L. Klepeis and
Timothy Layman and
Christine McLeavey and
Mark A. Moraes and
Rolf Mueller and
Edward C. Priest and
Yibing Shan and
Jochen Spengler and
Michael Theobald and
Brian Towles and
Stanley C. Wang},
title = {Anton, a special-purpose machine for molecular dynamics simulation},
journal = {Commun. {ACM}},
volume = {51},
number = {7},
pages = {91--97},
year = {2008},
url = {https://doi.org/10.1145/1364782.1364802},
doi = {10.1145/1364782.1364802},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/codes/GrossmanYBMISDS08,
author = {J. P. Grossman and
Cliff Young and
Joseph A. Bank and
Kenneth M. Mackenzie and
Doug Ierardi and
John K. Salmon and
Ron O. Dror and
David E. Shaw},
editor = {Catherine H. Gebotys and
Grant Martin},
title = {Simulation and embedded software development for Anton, a parallel
machine with heterogeneous multicore ASICs},
booktitle = {Proceedings of the 6th International Conference on Hardware/Software
Codesign and System Synthesis, {CODES+ISSS} 2008, Atlanta, GA, USA,
October 19-24, 2008},
pages = {125--130},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1450135.1450165},
doi = {10.1145/1450135.1450165},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/codes/GrossmanYBMISDS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/HoTDDGS08,
author = {C. Richard Ho and
Michael Theobald and
Martin M. Deneroff and
Ron O. Dror and
Joseph Gagliardo and
David E. Shaw},
editor = {Limor Fix},
title = {Early formal verification of conditional coverage points to identify
intrinsically hard-to-verify logic},
booktitle = {Proceedings of the 45th Design Automation Conference, {DAC} 2008,
Anaheim, CA, USA, June 8-13, 2008},
pages = {268--271},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1391469.1391537},
doi = {10.1145/1391469.1391537},
timestamp = {Fri, 29 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dac/HoTDDGS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LarsonSDDYGSKS08,
author = {Richard H. Larson and
John K. Salmon and
Ron O. Dror and
Martin M. Deneroff and
Cliff Young and
J. P. Grossman and
Yibing Shan and
John L. Klepeis and
David E. Shaw},
title = {High-throughput pairwise point interactions in Anton, a specialized
machine for molecular dynamics simulation},
booktitle = {14th International Conference on High-Performance Computer Architecture
{(HPCA-14} 2008), 16-20 February 2008, Salt Lake City, UT, {USA}},
pages = {331--342},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HPCA.2008.4658650},
doi = {10.1109/HPCA.2008.4658650},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpca/LarsonSDDYGSKS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/KuskinYGBDDS08,
author = {Jeffrey Kuskin and
Cliff Young and
J. P. Grossman and
Brannon Batson and
Martin M. Deneroff and
Ron O. Dror and
David E. Shaw},
title = {Incorporating flexibility in Anton, a specialized machine for molecular
dynamics simulation},
booktitle = {14th International Conference on High-Performance Computer Architecture
{(HPCA-14} 2008), 16-20 February 2008, Salt Lake City, UT, {USA}},
pages = {343--354},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HPCA.2008.4658651},
doi = {10.1109/HPCA.2008.4658651},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpca/KuskinYGBDDS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/GrossmanSHITBSWMTYGDDS08,
author = {J. P. Grossman and
John K. Salmon and
C. Richard Ho and
Doug Ierardi and
Brian Towles and
Brannon Batson and
Jochen Spengler and
Stanley C. Wang and
Rolf Mueller and
Michael Theobald and
Cliff Young and
Joseph Gagliardo and
Martin M. Deneroff and
Ron O. Dror and
David E. Shaw},
title = {Hierarchical simulation-based verification of Anton, a special-purpose
parallel machine},
booktitle = {26th International Conference on Computer Design, {ICCD} 2008, 12-15
October 2008, Lake Tahoe, CA, USA, Proceedings},
pages = {340--347},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICCD.2008.4751883},
doi = {10.1109/ICCD.2008.4751883},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/GrossmanSHITBSWMTYGDDS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/Shaw08,
author = {David E. Shaw},
title = {Architectures and algorithms for millisecond-scale molecular dynamics
simulations of proteins},
booktitle = {41st Annual {IEEE/ACM} International Symposium on Microarchitecture
{(MICRO-41} 2008), November 8-12, 2008, Lake Como, Italy},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/MICRO.2008.4771773},
doi = {10.1109/MICRO.2008.4771773},
timestamp = {Tue, 31 May 2022 14:39:58 +0200},
biburl = {https://dblp.org/rec/conf/micro/Shaw08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/TuRBDGJKMMSS08,
author = {Tiankai Tu and
Charles A. Rendleman and
David W. Borhani and
Ron O. Dror and
Justin Gullingsrud and
Morten {\O}. Jensen and
John L. Klepeis and
Paul Maragakis and
Patrick J. Miller and
Kate A. Stafford and
David E. Shaw},
title = {A scalable parallel framework for analyzing terascale molecular dynamics
simulation trajectories},
booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
{SC} 2008, November 15-21, 2008, Austin, Texas, {USA}},
pages = {56},
publisher = {{IEEE/ACM}},
year = {2008},
url = {https://doi.org/10.1109/SC.2008.5214715},
doi = {10.1109/SC.2008.5214715},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/TuRBDGJKMMSS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/BowersDS07,
author = {Kevin J. Bowers and
Ron O. Dror and
David E. Shaw},
title = {Zonal methods for the parallel execution of range-limited N-body simulations},
journal = {J. Comput. Phys.},
volume = {221},
number = {1},
pages = {303--329},
year = {2007},
url = {https://doi.org/10.1016/j.jcp.2006.06.014},
doi = {10.1016/J.JCP.2006.06.014},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcphy/BowersDS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07,
author = {David E. Shaw and
Martin M. Deneroff and
Ron O. Dror and
Jeffrey Kuskin and
Richard H. Larson and
John K. Salmon and
Cliff Young and
Brannon Batson and
Kevin J. Bowers and
Jack C. Chao and
Michael P. Eastwood and
Joseph Gagliardo and
J. P. Grossman and
C. Richard Ho and
Doug Ierardi and
Istv{\'{a}}n Kolossv{\'{a}}ry and
John L. Klepeis and
Timothy Layman and
Christine McLeavey and
Mark A. Moraes and
Rolf Mueller and
Edward C. Priest and
Yibing Shan and
Jochen Spengler and
Michael Theobald and
Brian Towles and
Stanley C. Wang},
editor = {Dean M. Tullsen and
Brad Calder},
title = {Anton, a special-purpose machine for molecular dynamics simulation},
booktitle = {34th International Symposium on Computer Architecture {(ISCA} 2007),
June 9-13, 2007, San Diego, California, {USA}},
pages = {1--12},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1250662.1250664},
doi = {10.1145/1250662.1250664},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/DixonSKRSF06,
author = {Steven L. Dixon and
Alexander M. Smondyrev and
Eric H. Knoll and
Shashidhar N. Rao and
David E. Shaw and
Richard A. Friesner},
title = {{PHASE:} a new engine for pharmacophore perception, 3D {QSAR} model
development, and 3D database screening: 1. Methodology and preliminary
results},
journal = {J. Comput. Aided Mol. Des.},
volume = {20},
number = {10-11},
pages = {647--671},
year = {2006},
url = {https://doi.org/10.1007/s10822-006-9087-6},
doi = {10.1007/S10822-006-9087-6},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/DixonSKRSF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/BowersCXDEGKKMSSSS06,
author = {Kevin J. Bowers and
Edmond Chow and
Huafeng Xu and
Ron O. Dror and
Michael P. Eastwood and
Brent A. Gregersen and
John L. Klepeis and
Istv{\'{a}}n Kolossv{\'{a}}ry and
Mark A. Moraes and
Federico D. Sacerdoti and
John K. Salmon and
Yibing Shan and
David E. Shaw},
title = {Molecular dynamics - Scalable algorithms for molecular dynamics simulations
on commodity clusters},
booktitle = {Proceedings of the {ACM/IEEE} {SC2006} Conference on High Performance
Networking and Computing, November 11-17, 2006, Tampa, FL, {USA}},
pages = {84},
publisher = {{ACM} Press},
year = {2006},
url = {https://doi.org/10.1145/1188455.1188544},
doi = {10.1145/1188455.1188544},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/BowersCXDEGKKMSSSS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/Shaw05,
author = {David E. Shaw},
title = {A fast, scalable method for the parallel evaluation of distance-limited
pairwise particle interactions},
journal = {J. Comput. Chem.},
volume = {26},
number = {13},
pages = {1318--1328},
year = {2005},
url = {https://doi.org/10.1002/jcc.20267},
doi = {10.1002/JCC.20267},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/Shaw05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/Shaw05a,
author = {David E. Shaw},
title = {Erraturm - {A} fast, scalable method for the parallel evaluation of
distance-limited pairwise particle interactions},
journal = {J. Comput. Chem.},
volume = {26},
number = {16},
pages = {1803},
year = {2005},
url = {https://doi.org/10.1002/jcc.20331},
doi = {10.1002/JCC.20331},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/Shaw05a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vldb/Shaw98,
author = {David Elliot Shaw},
editor = {Ashish Gupta and
Oded Shmueli and
Jennifer Widom},
title = {Technology and the Future of Commerce and Finance (Abstract)},
booktitle = {VLDB'98, Proceedings of 24rd International Conference on Very Large
Data Bases, August 24-27, 1998, New York City, New York, {USA}},
pages = {13},
publisher = {Morgan Kaufmann},
year = {1998},
url = {http://www.vldb.org/conf/1998/p013.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vldb/Shaw98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/Shaw87,
author = {David Elliot Shaw},
title = {On the Range of Applicability of an Artificial Intelligence Machine},
journal = {Artif. Intell.},
volume = {32},
number = {2},
pages = {151--172},
year = {1987},
url = {https://doi.org/10.1016/0004-3702(87)90010-5},
doi = {10.1016/0004-3702(87)90010-5},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ai/Shaw87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/IbrahimKS87,
author = {Hussein Ibrahim and
John R. Kender and
David Elliot Shaw},
title = {Low-Level Image Analysis Tasks on Fine-Grained Tree-Structured {SIMD}
Machines},
journal = {J. Parallel Distributed Comput.},
volume = {4},
number = {6},
pages = {546--574},
year = {1987},
url = {https://doi.org/10.1016/0743-7315(87)90030-X},
doi = {10.1016/0743-7315(87)90030-X},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jpdc/IbrahimKS87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cvgip/IbrahimKS86,
author = {Hussein A. H. Ibrahim and
John R. Kender and
David Elliot Shaw},
title = {On the application of massively parallel {SIMD} tree machines to certain
intermediate-level vision tasks},
journal = {Comput. Vis. Graph. Image Process.},
volume = {36},
number = {1},
pages = {53--75},
year = {1986},
url = {https://doi.org/10.1016/S0734-189X(86)80029-9},
doi = {10.1016/S0734-189X(86)80029-9},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cvgip/IbrahimKS86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/HillyerS86,
author = {Bruce Hillyer and
David Elliot Shaw},
title = {Execution of {OPS5} Production Systems on a Massively Parallel Machine},
journal = {J. Parallel Distributed Comput.},
volume = {3},
number = {2},
pages = {236--268},
year = {1986},
url = {https://doi.org/10.1016/0743-7315(86)90006-7},
doi = {10.1016/0743-7315(86)90006-7},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jpdc/HillyerS86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/HillyerSN86,
author = {Bruce Hillyer and
David Elliot Shaw and
Anil Nigam},
title = {NON-VON's Performance on Certain Database Benchmarks},
journal = {{IEEE} Trans. Software Eng.},
volume = {12},
number = {4},
pages = {577--583},
year = {1986},
url = {https://doi.org/10.1109/TSE.1986.6312905},
doi = {10.1109/TSE.1986.6312905},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/HillyerSN86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/IbrahimKS86,
author = {Hussein Ibrahim and
John R. Kender and
David Elliot Shaw},
editor = {Tom Kehler},
title = {{SIMD} Tree Algorithms for Image Correlation},
booktitle = {Proceedings of the 5th National Conference on Artificial Intelligence.
Philadelphia, PA, USA, August 11-15, 1986. Volume 1: Science},
pages = {645--651},
publisher = {Morgan Kaufmann},
year = {1986},
url = {http://www.aaai.org/Library/AAAI/1986/aaai86-109.php},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/IbrahimKS86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/integration/ShawS85,
author = {David Elliot Shaw and
Theodore Sabety},
title = {The multiple-processor {PPS} chip of the {NON-VON} 3 supercomputer},
journal = {Integr.},
volume = {3},
number = {3},
pages = {161--174},
year = {1985},
url = {https://doi.org/10.1016/0167-9260(85)90002-1},
doi = {10.1016/0167-9260(85)90002-1},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/integration/ShawS85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/Shaw85,
author = {David Elliot Shaw},
editor = {Aravind K. Joshi},
title = {NON-VONs Applicability to Three {AI} Task Areas},
booktitle = {Proceedings of the 9th International Joint Conference on Artificial
Intelligence. Los Angeles, CA, USA, August 1985},
pages = {61--72},
publisher = {Morgan Kaufmann},
year = {1985},
url = {http://ijcai.org/Proceedings/85-1/Papers/013.pdf},
timestamp = {Tue, 20 Aug 2019 16:19:04 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/Shaw85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/kimrb85/Shaw85,
author = {David Elliot Shaw},
editor = {Won Kim and
David S. Reiner and
Don S. Batory},
title = {Relational Query Processing on the Non-Von Supercomputer},
booktitle = {Query Processing in Database Systems},
pages = {248--258},
publisher = {Springer},
year = {1985},
timestamp = {Sat, 03 Aug 2019 22:43:26 +0200},
biburl = {https://dblp.org/rec/books/sp/kimrb85/Shaw85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/Shaw84,
author = {David Elliot Shaw},
title = {{SIMD} and {MSIMD} Variants of the {NON-VON} Supercomputer},
booktitle = {COMPCON'84, Digest of Papers, Twenty-Eighth {IEEE} Computer Society
International Conference, San Francisco, California, USA, February
27 - March 1, 1984},
pages = {360--363},
publisher = {{IEEE} Computer Society},
year = {1984},
timestamp = {Tue, 20 Jun 2006 11:18:22 +0200},
biburl = {https://dblp.org/rec/conf/compcon/Shaw84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/SabetySM84,
author = {Theodore Sabety and
David Elliot Shaw and
Brian Mathies},
editor = {Patricia H. Lambert and
Hillel Ofek and
Lawrence A. O'Neill and
Pat O. Pistilli and
Paul Losleben and
J. Daniel Nash and
Dennis W. Shaklee and
Bryan T. Preas and
Harvey N. Lerman},
title = {The semi-automatic generation of processing element control paths
for highly parallel machines},
booktitle = {Proceedings of the 21st Design Automation Conference, {DAC} '84, Albuquerque,
New Mexico, June 25-27, 1984},
pages = {441--446},
publisher = {{ACM/IEEE}},
year = {1984},
url = {http://dl.acm.org/citation.cfm?id=800835},
timestamp = {Thu, 12 Aug 2021 08:58:02 +0200},
biburl = {https://dblp.org/rec/conf/dac/SabetySM84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/StolfoMS83,
author = {Salvatore J. Stolfo and
Daniel P. Miranker and
David Elliot Shaw},
editor = {Alan Bundy},
title = {Architecture and Applications of {DADO:} {A} Large-Scale Parallel
Computer for Artificial Intelligence},
booktitle = {Proceedings of the 8th International Joint Conference on Artificial
Intelligence. Karlsruhe, FRG, August 1983},
pages = {850--854},
publisher = {William Kaufmann},
year = {1983},
url = {http://ijcai.org/Proceedings/83-2/Papers/061.pdf},
timestamp = {Tue, 20 Aug 2019 16:18:54 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/StolfoMS83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/StolfoS82,
author = {Salvatore J. Stolfo and
David Elliot Shaw},
editor = {David L. Waltz},
title = {{DADO:} {A} Tree-Structured Machine Architecture for Production Systems},
booktitle = {Proceedings of the National Conference on Artificial Intelligence,
Pittsburgh, PA, USA, August 18-20, 1982},
pages = {242--246},
publisher = {{AAAI} Press},
year = {1982},
url = {http://www.aaai.org/Library/AAAI/1982/aaai82-058.php},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/StolfoS82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/ShawSIHWA81,
author = {David Elliot Shaw and
Salvatore J. Stolfo and
Hussein Ibrahim and
Bruce Hillyer and
Gio Wiederhold and
J. A. Andrews},
title = {The {NON-VON} Database Machine: {A} Brief Overview},
journal = {{IEEE} Database Eng. Bull.},
volume = {4},
number = {2},
pages = {41--52},
year = {1981},
url = {http://sites.computer.org/debull/81DEC-CD.pdf},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/debu/ShawSIHWA81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/Shaw81,
author = {David Elliot Shaw},
editor = {Patrick J. Hayes},
title = {{NON-VON:} {A} Parallel Machine Architecture for Knowledge-Based Information
Processing},
booktitle = {Proceedings of the 7th International Joint Conference on Artificial
Intelligence, {IJCAI} '81, Vancouver, BC, Canada, August 24-28, 1981},
pages = {961--963},
publisher = {William Kaufmann},
year = {1981},
timestamp = {Tue, 20 Aug 2019 16:16:26 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/Shaw81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/Shaw80a,
author = {David Elliot Shaw},
title = {A Relational Database Machine Architecture},
booktitle = {The Papers of the Fifth Workshop on Computer Architecture for Non-Numeric
Processing, Pacific Grove, CA, USA, March 11-14, 1980},
volume = {10},
number = {4},
pages = {84--95},
publisher = {{ACM}},
year = {1980},
url = {https://doi.org/10.1145/800083.802696},
doi = {10.1145/800083.802696},
timestamp = {Tue, 31 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmod/Shaw80a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ShawWG75,
author = {David E. Shaw and
William R. Swartout and
C. Cordell Green},
title = {Inferring {LISP} Programs From Examples},
booktitle = {Advance Papers of the Fourth International Joint Conference on Artificial
Intelligence, Tbilisi, Georgia, USSR, September 3-8, 1975},
pages = {260--267},
year = {1975},
url = {http://ijcai.org/Proceedings/75/Papers/037.pdf},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/ShawWG75.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-05-08 21:04 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
