Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "toc:db/journals/jssc/jssc47.bht:"
download as .bib file
@article{DBLP:journals/jssc/Abdul-LatifS12,
author = {Mohammed M. Abdul{-}Latif and
Edgar S{\'{a}}nchez{-}Sinencio},
title = {Low Phase Noise Wide Tuning Range N-Push Cyclic-Coupled Ring Oscillators},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1278--1294},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2188564},
doi = {10.1109/JSSC.2012.2188564},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Abdul-LatifS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/AgrawalBDLTF12,
author = {Ankur Agrawal and
John F. Bulzacchelli and
Timothy O. Dickson and
Yong Liu and
Jos{\'{e}} A. Tierno and
Daniel J. Friedman},
title = {A 19-Gb/s Serial Link Receiver With Both 4-Tap {FFE} and 5-Tap {DFE}
Functions in 45-nm {SOI} {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3220--3231},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216412},
doi = {10.1109/JSSC.2012.2216412},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/AgrawalBDLTF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/AlghamdiH12,
author = {Mohammad K. Al{-}Ghamdi and
Anas A. Hamoui},
title = {A Spurious-Free Switching Buck Converter Achieving Enhanced Light-Load
Efficiency by Using a {\(\Delta\)}{\(\Sigma\)}-Modulator Controller
With a Scalable Sampling Frequency},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {841--851},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185179},
doi = {10.1109/JSSC.2012.2185179},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/AlghamdiH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/AlvandpourRY12,
author = {Atila Alvandpour and
Patrick Reynaert and
Trond Ytterdal},
title = {Introduction to the Special Issue on the 37th European Solid-State
Circuits Conference {(ESSCIRC)}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1511--1514},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196319},
doi = {10.1109/JSSC.2012.2196319},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/AlvandpourRY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/AmirkhanyKAFBHMCY12,
author = {Amir Amirkhany and
Kambiz Kaviani and
Ali{-}Azam Abbasfar and
H. Md. Shuaeb Fazeel and
Wendemagegnehu T. Beyene and
Chikara Hoshino and
Chris J. Madden and
Ken Chang and
Chuck Yuan},
title = {A 4.1-pJ/b, 16-Gb/s Coded Differential Bidirectional Parallel Electrical
Link},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3208--3219},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216413},
doi = {10.1109/JSSC.2012.2216413},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/AmirkhanyKAFBHMCY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/AmirkhanyWMSBCCDHGHKLLMMMRSSSSFSWTVVYJCY12,
author = {Amir Amirkhany and
Jason Wei and
Navin K. Mishra and
Jie Shen and
Wendemagegnehu T. Beyene and
Catherine Chen and
T. J. Chin and
Deborah Dressler and
Charlie Huang and
Vijay P. Gadde and
Mohammad Hekmat and
Kambiz Kaviani and
Hai Lan and
Phuong Le and
Mahabaleshwara and
Chris J. Madden and
Sanku Mukherjee and
Leneesh Raghavan and
Keisuke Saito and
Dave Secker and
Arul Sendhil and
Ralf Schmitt and
H. Md. Shuaeb Fazeel and
Gundlapalli Shanmukha Srinivas and
Ting Wu and
Chanh Tran and
Arun Vaidyanath and
Kapil Vyas and
Ling Yang and
Manish Jain and
Kun{-}Yung Ken Chang and
Xingchao Yuan},
title = {A 12.8-Gb/s/link Tri-Modal Single-Ended Memory Interface},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {911--925},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185369},
doi = {10.1109/JSSC.2012.2185369},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/AmirkhanyWMSBCCDHGHKLLMMMRSSSSFSWTVVYJCY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/AndreouKG12,
author = {Charalambos M. Andreou and
Savvas Koudounas and
Julius Georgiou},
title = {A Novel Wide-Temperature-Range, 3.9 ppm/{\textdegree}C {CMOS} Bandgap
Reference Circuit},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {574--581},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2173267},
doi = {10.1109/JSSC.2011.2173267},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/AndreouKG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BaeSLCY12,
author = {Joonsung Bae and
Kiseok Song and
Hyungwoo Lee and
Hyunwoo Cho and
Hoi{-}Jun Yoo},
title = {A 0.24-nJ/b Wireless Body-Area-Network Transceiver With Scalable Double-FSK
Modulation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {310--322},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170632},
doi = {10.1109/JSSC.2011.2170632},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BaeSLCY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BaeSLCY12a,
author = {Joonsung Bae and
Kiseok Song and
Hyungwoo Lee and
Hyunwoo Cho and
Hoi{-}Jun Yoo},
title = {A Low-Energy Crystal-Less Double-FSK Sensor Node Transceiver for Wireless
Body-Area Network},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2678--2692},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211654},
doi = {10.1109/JSSC.2012.2211654},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BaeSLCY12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BandyopadhyayC12,
author = {Saurav Bandyopadhyay and
Anantha P. Chandrakasan},
title = {Platform Architecture for Solar, Thermal, and Vibration Energy Combining
With {MPPT} and Single Inductor},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2199--2215},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197239},
doi = {10.1109/JSSC.2012.2197239},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BandyopadhyayC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BarbieriN12,
author = {Andrea Barbieri and
Germano Nicollini},
title = {100+dB A-Weighted {SNR} Microphone Preamplifier With On-Chip Decoupling
Capacitors},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2737--2750},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216213},
doi = {10.1109/JSSC.2012.2216213},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BarbieriN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BelmasHF12,
author = {Fran{\c{c}}ois Belmas and
Fr{\'{e}}d{\'{e}}ric Hameau and
Jean{-}Michel Fournier},
title = {A Low Power Inductorless {LNA} With Double G\({}_{\mbox{m}}\) Enhancement
in 130 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1094--1103},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185533},
doi = {10.1109/JSSC.2012.2185533},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BelmasHF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BergervoetLJHLS12,
author = {Jos Bergervoet and
Domine Leenaerts and
Gerben W. de Jong and
Edwin van der Heijden and
Jan{-}Willem Lobeek and
Alexander Simin},
title = {A 1.95 GHz Sub-1 dB NF, +40 dBm {OIP3} {WCDMA} {LNA} Module},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1672--1680},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191673},
doi = {10.1109/JSSC.2012.2191673},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BergervoetLJHLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Boeck12,
author = {Georg B{\"{o}}ck},
title = {Overview for the Special Section on the 2011 Radio Frequency Integrated
Circuits {(RFIC)} Symposium},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1073--1074},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2184650},
doi = {10.1109/JSSC.2012.2184650},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Boeck12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BuckwalterZLRK12,
author = {James F. Buckwalter and
Xuezhe Zheng and
Guoliang Li and
Kannan Raj and
Ashok V. Krishnamoorthy},
title = {A Monolithic 25-Gb/s Transceiver With Photonic Ring Modulators and
Ge Detectors in a 130-nm {CMOS} {SOI} Process},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1309--1322},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2189835},
doi = {10.1109/JSSC.2012.2189835},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BuckwalterZLRK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BulzacchelliDRIBKBCCLTF12,
author = {John F. Bulzacchelli and
Zeynep Toprak Deniz and
Todd M. Rasmus and
Joseph A. Iadanza and
William L. Bucossi and
Seongwon Kim and
Rafael Blanco and
Carrie E. Cox and
Mohak Chhabra and
Christopher D. LeBlanc and
Christian L. Trudeau and
Daniel J. Friedman},
title = {Dual-Loop System of Distributed Microregulators With High {DC} Accuracy,
Load Response Time Below 500 ps, and 85-mV Dropout Voltage},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {863--874},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185354},
doi = {10.1109/JSSC.2012.2185354},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BulzacchelliDRIBKBCCLTF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BulzacchelliMBSHHHRFGPMSKAKCRSGCBBKTF12,
author = {John F. Bulzacchelli and
Christian Menolfi and
Troy J. Beukema and
Daniel W. Storaska and
Juergen Hertle and
David Hanson and
Ping{-}Hsuan Hsieh and
Sergey V. Rylov and
Daniel Furrer and
Daniele Gardellini and
Andrea Prati and
Thomas Morf and
Vivek Sharma and
Ram Kelkar and
Herschel A. Ainspan and
W. R. Kelly and
L. R. Chieco and
Glenn Ritter and
J. A. Sorice and
Jon Garlett and
Robert Callan and
Matthias Braendli and
Peter Buchmann and
Marcel A. Kossel and
Thomas Toifl and
Daniel J. Friedman},
title = {A 28-Gb/s 4-Tap FFE/15-Tap {DFE} Serial Link Transceiver in 32-nm
{SOI} {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3232--3248},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216414},
doi = {10.1109/JSSC.2012.2216414},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BulzacchelliMBSHHHRFGPMSKAKCRSGCBBKTF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ByunKKTC12,
author = {Gyungsu Byun and
Yanghyo Kim and
Jongsun Kim and
Sai{-}Wang Tam and
Mau{-}Chung Frank Chang},
title = {An Energy-Efficient and High-Speed Mobile Memory {I/O} Interface Using
Simultaneous Bi-Directional Dual (Base+RF)-Band Signaling},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {117--130},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164709},
doi = {10.1109/JSSC.2011.2164709},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ByunKKTC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Camunas-MesaZLASL12,
author = {Luis A. Camu{\~{n}}as{-}Mesa and
Carlos Zamarre{\~{n}}o{-}Ramos and
Alejandro Linares{-}Barranco and
Antonio Acosta{-}Jimenez and
Teresa Serrano{-}Gotarredona and
Bernab{\'{e}} Linares{-}Barranco},
title = {An Event-Driven Multi-Kernel Convolution Processor Module for Event-Driven
Vision Sensors},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {504--517},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167409},
doi = {10.1109/JSSC.2011.2167409},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Camunas-MesaZLASL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/CaoCSL12,
author = {Ying Cao and
Wouter De Cock and
Michiel Steyaert and
Paul Leroux},
title = {1-1-1 {MASH} {\(\Delta\)} {\(\Sigma\)} Time-to-Digital Converters
With 6 ps Resolution and Third-Order Noise-Shaping},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2093--2106},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2199530},
doi = {10.1109/JSSC.2012.2199530},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/CaoCSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChaiW12,
author = {Yun Chai and
Jieh{-}Tsorng Wu},
title = {A {CMOS} 5.37-mW 10-Bit 200-MS/s Dual-Path Pipelined {ADC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2905--2915},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217872},
doi = {10.1109/JSSC.2012.2217872},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChaiW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChangLZVCD12,
author = {Yuyu Chang and
John C. Leete and
Zhimin Zhou and
Morteza Vadipour and
Yin{-}Ting Chang and
Hooman Darabi},
title = {A Differential Digitally Controlled Crystal Oscillator With a 14-Bit
Tuning Resolution and Sine Wave Outputs for Cellular Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {421--434},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2172673},
doi = {10.1109/JSSC.2011.2172673},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChangLZVCD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenCLCSLWCY12,
author = {Yen{-}Huei Chen and
Shao{-}Yu Chou and
Quincy Li and
Wei{-}Min Chan and
Dar Sun and
Hung{-}Jen Liao and
Ping Wang and
Meng{-}Fan Chang and
Hiroyuki Yamauchi},
title = {Compact Measurement Schemes for Bit-Line Swing, Sense Amplifier Offset
Voltage, and Word-Line Pulse Width to Characterize Sensing Tolerance
Margin in a 40 nm Fully Functional Embedded {SRAM}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {969--980},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185180},
doi = {10.1109/JSSC.2012.2185180},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/ChenCLCSLWCY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenCS12,
author = {Fred Chen and
Anantha P. Chandrakasan and
Vladimir Stojanovic},
title = {Design and Analysis of a Hardware-Efficient Compressed Sensing Architecture
for Data Compression in Wireless Sensors},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {744--756},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2179451},
doi = {10.1109/JSSC.2011.2179451},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenCS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenH12,
author = {Kuo{-}Hsin Chen and
Yen{-}Shun Hsu},
title = {A High-PSRR Reconfigurable Class-AB/D Audio Amplifier Driving a Hands-Free/Receiver
2-in-1 Loudspeaker},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2586--2603},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211657},
doi = {10.1109/JSSC.2012.2211657},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenIIZHORTS12,
author = {Po{-}Hung Chen and
Koichi Ishida and
Katsuyuki Ikeuchi and
Xin Zhang and
Kentaro Honda and
Yasuyuki Okuma and
Yoshikatsu Ryu and
Makoto Takamiya and
Takayasu Sakurai},
title = {Startup Techniques for 95 mV Step-Up Converter by Capacitor Pass-On
Scheme and V\({}_{\mbox{TH}}\)-Tuned Oscillator With Fixed Charge
Programming},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1252--1260},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185589},
doi = {10.1109/JSSC.2012.2185589},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenIIZHORTS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenLCL12,
author = {Chih{-}Lung Chen and
Yu{-}Hsiang Lin and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 2.37-Gb/s 284.8 mW Rate-Compatible (491, 3, 6) {LDPC-CC} Decoder},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {817--831},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185193},
doi = {10.1109/JSSC.2012.2185193},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenLCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenLJ12,
author = {Wu{-}Hsin Chen and
Wing{-}Fai Loke and
Byunghoo Jung},
title = {A 0.5-V, 440-{\(\mathrm{\mu}\)}W Frequency Synthesizer for Implantable
Medical Devices},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1896--1907},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196315},
doi = {10.1109/JSSC.2012.2196315},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenLJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenLWZXZ12,
author = {Yiran Chen and
Hai Li and
Xiaobin Wang and
Wenzhong Zhu and
Wei Xu and
Tong Zhang},
title = {A 130 nm 1.2 {V/3.3} {V} 16 Kb Spin-Transfer Torque Random Access
Memory With Nondestructive Self-Reference Sensing Scheme},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {560--573},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170778},
doi = {10.1109/JSSC.2011.2170778},
timestamp = {Mon, 04 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenLWZXZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenRJYZ12,
author = {Jian Chen and
Liang Rong and
Fredrik Jonsson and
Geng Yang and
Li{-}Rong Zheng},
title = {The Design of All-Digital Polar Transmitter Based on {ADPLL} and Phase
Synchronized {\(\Delta\)}{\(\Sigma\)} Modulator},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1154--1164},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2186720},
doi = {10.1109/JSSC.2012.2186720},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenRJYZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenSLHL12,
author = {Ming{-}Shuan Chen and
Yu{-}Nan Shih and
Chen{-}Lun Lin and
Hao{-}Wei Hung and
Jri Lee},
title = {A Fully-Integrated 40-Gb/s Transceiver in 65-nm {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {627--640},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2176635},
doi = {10.1109/JSSC.2011.2176635},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenSLHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenWHLLS12,
author = {Chun{-}Ying Chen and
Jiangfeng Wu and
Juo{-}Jung Hung and
Tianwei Li and
Wenbo Liu and
Wei{-}Ta Shih},
title = {A 12-Bit 3 GS/s Pipeline {ADC} With 0.4 mm\({}^{\mbox{2}}\) and 500
mW in 40 nm Digital {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {1013--1021},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185192},
doi = {10.1109/JSSC.2012.2185192},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenWHLLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenWYH12,
author = {Zhiming Chen and
Chun{-}Cheng Wang and
Hsin{-}Cheng Yao and
Payam Heydari},
title = {A BiCMOS W-Band 2{\texttimes}2 Focal-Plane Array With On-Chip Antenna},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2355--2371},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2209775},
doi = {10.1109/JSSC.2012.2209775},
timestamp = {Mon, 21 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/ChenWYH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenYY12,
author = {E{-}Hung Chen and
Ramy Yousry and
Chih{-}Kong Ken Yang},
title = {Power Optimized ADC-Based Serial Link Receiver},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {938--951},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185356},
doi = {10.1109/JSSC.2012.2185356},
timestamp = {Fri, 08 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenYY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenZIORTS12,
author = {Po{-}Hung Chen and
Xin Zhang and
Koichi Ishida and
Yasuyuki Okuma and
Yoshikatsu Ryu and
Makoto Takamiya and
Takayasu Sakurai},
title = {An 80 mV Startup Dual-Mode Boost Converter by Charge-Pumped Pulse
Generator and Threshold Voltage Tuned Oscillator With Hot Carrier
Injection},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2554--2562},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2210953},
doi = {10.1109/JSSC.2012.2210953},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenZIORTS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChiuCWCSCT12,
author = {Pi{-}Feng Chiu and
Meng{-}Fan Chang and
Che{-}Wei Wu and
Ching{-}Hao Chuang and
Shyh{-}Shyuan Sheu and
Yu{-}Sheng Chen and
Ming{-}Jinn Tsai},
title = {Low Store Energy, Low VDDmin, 8T2R Nonvolatile Latch and {SRAM} With
Vertical-Stacked Resistive Memory (Memristor) Devices for Low Power
Mobile Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1483--1496},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2192661},
doi = {10.1109/JSSC.2012.2192661},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChiuCWCSCT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChoiTYRKK12,
author = {Youngkil Choi and
Wonho Tak and
Younghyun Yoon and
Jeongjin Roh and
Sunwoo Kwon and
Jinseok Koh},
title = {A 0.018{\%} THD+N, 88-dB {PSRR} {PWM} Class-D Amplifier for Direct
Battery Hookup},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {454--463},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170770},
doi = {10.1109/JSSC.2011.2170770},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChoiTYRKK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChongC12,
author = {Sau Siong Chong and
Pak Kwong Chan},
title = {Cross Feedforward Cascode Compensation for Low-Power Three-Stage Amplifier
With Large Capacitive Load},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2227--2234},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2194090},
doi = {10.1109/JSSC.2012.2194090},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChongC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChongCGC12,
author = {Kwen{-}Siong Chong and
Kok{-}Leong Chang and
Bah{-}Hwee Gwee and
Joseph S. Chang},
title = {Synchronous-Logic and Globally-Asynchronous-Locally-Synchronous {(GALS)}
Acoustic Digital Signal Processors},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {769--780},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2181678},
doi = {10.1109/JSSC.2011.2181678},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/ChongCGC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChouHLYSCHLLWHPH12,
author = {Wen{-}Shen Chou and
Tzu{-}Chi Huang and
Yu{-}Huei Lee and
Yao{-}Yi Yang and
Yi{-}Ping Su and
Ke{-}Horng Chen and
Chen{-}Chih Huang and
Ying{-}Hsi Lin and
Chao{-}Cheng Lee and
Kuei{-}Ann Wen and
Ying{-}Chih Hsu and
Yung{-}Chow Peng and
Fu{-}Lung Hsueh},
title = {An Embedded Dynamic Voltage Scaling {(DVS)} System Through 55 nm Single-Inductor
Dual-Output {(SIDO)} Switching Converter for 12-Bit Video Digital-to-Analog
Converter},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1568--1584},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191331},
doi = {10.1109/JSSC.2012.2191331},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChouHLYSCHLLWHPH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChowdhuryTYAN12,
author = {Debopriyo Chowdhury and
Siva V. Thyagarajan and
Lu Ye and
Elad Alon and
Ali M. Niknejad},
title = {A Fully-Integrated Efficient {CMOS} Inverse Class-D Power Amplifier
for Digital Polar Transmitters},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1113--1122},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185555},
doi = {10.1109/JSSC.2012.2185555},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChowdhuryTYAN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Chun0JK12,
author = {Ki Chul Chun and
Wei Zhang and
Pulkit Jain and
Chris H. Kim},
title = {A 2T1C Embedded {DRAM} Macro With No Boosted Supplies Featuring a
7T {SRAM} Based Repair and a Cell Storage Monitor},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2517--2526},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2206685},
doi = {10.1109/JSSC.2012.2206685},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Chun0JK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChunJKK12,
author = {Ki Chul Chun and
Pulkit Jain and
Tae{-}Ho Kim and
Chris H. Kim},
title = {A 667 MHz Logic-Compatible Embedded {DRAM} Featuring an Asymmetric
2T Gain Cell for High Speed On-Die Caches},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {547--559},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2168729},
doi = {10.1109/JSSC.2011.2168729},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChunJKK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChungIK12,
author = {Hayun Chung and
Hiroki Ishikuro and
Tadahiro Kuroda},
title = {A 10-Bit 80-MS/s Decision-Select Successive Approximation {TDC} in
65-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1232--1241},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2184640},
doi = {10.1109/JSSC.2012.2184640},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChungIK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChungRMIK12,
author = {Hayun Chung and
Andrzej Radecki and
Noriyuki Miura and
Hiroki Ishikuro and
Tadahiro Kuroda},
title = {A 0.025-0.45 {W} 60{\%}-Efficiency Inductive-Coupling Power Transceiver
With 5-Bit Dual-Frequency Feedforward Control for Non-Contact Memory
Cards},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2496--2504},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2206686},
doi = {10.1109/JSSC.2012.2206686},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChungRMIK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/CliquennoisDMBN12,
author = {Sebastien Cliquennois and
Achille Donida and
Piero Malcovati and
Andrea Baschirotto and
Angelo Nagari},
title = {A 65-nm, 1-A Buck Converter With Multi-Function SAR-ADC-Based {CCM/PSK}
Digital Control Loop},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1546--1556},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191214},
doi = {10.1109/JSSC.2012.2191214},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/CliquennoisDMBN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/CrottiRG12,
author = {Matteo Crotti and
Ivan Rech and
Massimo Ghioni},
title = {Four Channel, 40 ps Resolution, Fully Integrated Time-to-Amplitude
Converter for Time-Resolved Photon Counting},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {699--708},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2176161},
doi = {10.1109/JSSC.2011.2176161},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/CrottiRG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/CuiRSVHPKNMZAHZMC12,
author = {Delong Cui and
Bharath Raghavan and
Ullas Singh and
Anand Vasani and
Zhi Chao Huang and
Deyi Pi and
Mehdi Khanpour and
Ali Nazemi and
Hassan Maarefi and
Wei Zhang and
Tamer A. Ali and
Nick Huang and
Bo Zhang and
Afshin Momtaz and
Jun Cao},
title = {A Dual-Channel 23-Gbps {CMOS} Transmitter/Receiver Chipset for 40-Gbps
{RZ-DQPSK} and {CS-RZ-DQPSK} Optical Transmission},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3249--3260},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216451},
doi = {10.1109/JSSC.2012.2216451},
timestamp = {Thu, 01 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/CuiRSVHPKNMZAHZMC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Dai12,
author = {Fa Foster Dai},
title = {Introduction to the Special Section on the 25th Bipolar/BiCMOS Circuits
and Technology Meeting},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {1964--1965},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2201270},
doi = {10.1109/JSSC.2012.2201270},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Dai12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/DarvishiZKN12,
author = {Milad Darvishi and
Ronan A. R. van der Zee and
Eric A. M. Klumperink and
Bram Nauta},
title = {Widely Tunable 4th Order Switched G\({}_{\mbox{m}}\)-C Band-Pass Filter
Based on N-Path Filters},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3105--3119},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2225542},
doi = {10.1109/JSSC.2012.2225542},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/DarvishiZKN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/DicksonLRDTABAGTBPKF12,
author = {Timothy O. Dickson and
Yong Liu and
Sergey V. Rylov and
Bing Dang and
Cornelia K. Tsang and
Paul S. Andry and
John F. Bulzacchelli and
Herschel A. Ainspan and
Xiaoxiong Gu and
Lavanya Turlapati and
Michael P. Beakes and
Benjamin D. Parker and
John U. Knickerbocker and
Daniel J. Friedman},
title = {An 8x 10-Gb/s Source-Synchronous {I/O} System Based on High-Density
Silicon Carrier Interconnects},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {884--896},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185184},
doi = {10.1109/JSSC.2012.2185184},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/DicksonLRDTABAGTBPKF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/DongM12,
author = {Yunzhi Dong and
Kenneth W. Martin},
title = {A High-Speed Fully-Integrated {POF} Receiver With Large-Area Photo
Detectors in 65 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2080--2092},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2200529},
doi = {10.1109/JSSC.2012.2200529},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/DongM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/DooperB12,
author = {L{\^{u}}tsen Dooper and
Marco Berkhout},
title = {A 3.4 {W} Digital-In Class-D Audio Amplifier in 0.14{\(\mathrm{\mu}\)}m
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1524--1534},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191683},
doi = {10.1109/JSSC.2012.2191683},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/DooperB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/DrostTH12,
author = {Brian Drost and
Mrunmay Talegaonkar and
Pavan Kumar Hanumolu},
title = {Analog Filter Design Using Ring Oscillator Integrators},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3120--3129},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2225738},
doi = {10.1109/JSSC.2012.2225738},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/DrostTH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/FanHM12,
author = {Qinwen Fan and
Johan H. Huijsing and
Kofi A. A. Makinwa},
title = {A 21 nV/{\(\surd\)} Hz Chopper-Stabilized Multi-Path Current-Feedback
Instrumentation Amplifier With 2 {\(\mathrm{\mu}\)} {V} Offset},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {464--475},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2175269},
doi = {10.1109/JSSC.2011.2175269},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/FanHM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Farjad-RadGBTNSSN12,
author = {Ramin Farjad{-}Rad and
Friedel Gerfers and
Michael Brown and
Ahmad Tavakoli and
David Nguyen and
Hossein Sedarat and
Ramin Shirani and
Hiok{-}Tiaq Ng},
title = {A 48-Port FCC-Compliant 10GBASE-T Transmitter With Mixed-Mode Adaptive
Echo Canceller},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3261--3272},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216452},
doi = {10.1109/JSSC.2012.2216452},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Farjad-RadGBTNSSN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/FernandezMM12,
author = {Daniel Fern{\'{a}}ndez and
Lu{\'{\i}}s Mart{\'{\i}}nez{-}Alvarado and
Jordi Madrenas},
title = {A Translinear, Log-Domain {FPAA} on Standard {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {490--503},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170597},
doi = {10.1109/JSSC.2011.2170597},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/FernandezMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/FoleyBCWGGN12,
author = {Denis Foley and
Pankaj Bansal and
Don Cherepacha and
Robert Wasmuth and
Aswin Gunasekar and
Srinivasa Rao Gutta and
Ajay Naini},
title = {A Low-Power Integrated x86-64 and Graphics Processor for Mobile Computing
Devices},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {220--231},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167776},
doi = {10.1109/JSSC.2011.2167776},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/FoleyBCWGGN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/FredenburgF12,
author = {Jeffrey Fredenburg and
Michael P. Flynn},
title = {A 90-MS/s 11-MHz-Bandwidth 62-dB {SNDR} Noise-Shaping {SAR} {ADC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2898--2904},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217874},
doi = {10.1109/JSSC.2012.2217874},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/FredenburgF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/FukudaWMKSTKSTSOEINMMFYSNHTKMSYSSDWKMMNHLHMLMNH12,
author = {Koichi Fukuda and
Yoshihisa Watanabe and
Eiichi Makino and
Koichi Kawakami and
Jumpei Sato and
Teruo Takagiwa and
Naoaki Kanagawa and
Hitoshi Shiga and
Naoya Tokiwa and
Yoshihiko Shindo and
Takeshi Ogawa and
Toshiaki Edahiro and
Makoto Iwai and
Osamu Nagao and
Junji Musha and
Takatoshi Minamoto and
Yuka Furuta and
Kosuke Yanagidaira and
Yuya Suzuki and
Dai Nakamura and
Yoshikazu Hosomura and
Rieko Tanaka and
Hiromitsu Komai and
Mai Muramoto and
Go Shikata and
Ayako Yuminaka and
Kiyofumi Sakurai and
Manabu Sakai and
Hong Ding and
Mitsuyuki Watanabe and
Yosuke Kato and
Toru Miwa and
Alex Mak and
Masaru Nakamichi and
Gertjan Hemink and
Dana Lee and
Masaaki Higashitani and
Brian Murphy and
Bo Lei and
Yasuhiko Matsunaga and
Kiyomi Naruke and
Takahiko Hara},
title = {A 151-mm\({}^{\mbox{2}}\) 64-Gb 2 Bit/Cell {NAND} Flash Memory in
24-nm {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {75--84},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164711},
doi = {10.1109/JSSC.2011.2164711},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/FukudaWMKSTKSTSOEINMMFYSNHTKMSYSSDWKMMNHLHMLMNH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GalalZACMCPMB12,
author = {Sherif Galal and
Hui Zheng and
Khaled Abdelfattah and
Vinay Chandrasekhar and
Iuri Mehr and
Alex Jianzhong Chen and
John Platenak and
Nir Matalon and
Todd Brooks},
title = {A 60 mW Class-G Stereo Headphone Driver for Portable Battery-Powered
Devices},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1921--1934},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197155},
doi = {10.1109/JSSC.2012.2197155},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GalalZACMCPMB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GambiniCAR12,
author = {Simone Gambini and
John Crossley and
Elad Alon and
Jan M. Rabaey},
title = {A Fully Integrated, 290 pJ/bit {UWB} Dual-Mode Transceiver for cm-Range
Wireless Interconnects},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {586--598},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2177690},
doi = {10.1109/JSSC.2011.2177690},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GambiniCAR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GangasaniHBRBFKSQXNRGWGSM12,
author = {Gautam R. Gangasani and
Chun{-}Ming Hsu and
John F. Bulzacchelli and
Sergey V. Rylov and
Troy J. Beukema and
David Freitas and
William Kelly and
Michael Shannon and
Jieming Qi and
Hui H. Xu and
Joseph Natonio and
Todd M. Rasmus and
Jong{-}Ru Guo and
Michael Wielgos and
Jon Garlett and
Michael Sorna and
Mounir Meghelli},
title = {A 16-Gb/s Backplane Transceiver With 12-Tap Current Integrating {DFE}
and Dynamic Adaptation of Voltage Offset and Timing Drifts in 45-nm
{SOI} {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1828--1841},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196313},
doi = {10.1109/JSSC.2012.2196313},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GangasaniHBRBFKSQXNRGWGSM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GaoWNMSMM12,
author = {Hua Gao and
Ross M. Walker and
Paul Nuyujukian and
Kofi A. A. Makinwa and
Krishna V. Shenoy and
Boris Murmann and
Teresa H. Meng},
title = {HermesE: {A} 96-Channel Full Data Rate Direct Neural Interface in
0.13 {\(\mathrm{\mu}\)}m {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {1043--1055},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185338},
doi = {10.1109/JSSC.2012.2185338},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GaoWNMSMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GeorgasORS12,
author = {Michael Georgas and
Jason Orcutt and
Rajeev J. Ram and
Vladimir Stojanovic},
title = {A Monolithically-Integrated Optical Receiver in Standard 45-nm {SOI}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1693--1702},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191684},
doi = {10.1109/JSSC.2012.2191684},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GeorgasORS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GersbachMTFSRWHC12,
author = {Marek Gersbach and
Yuki Maruyama and
Rahmadi Trimananda and
Matthew W. Fishburn and
David Stoppa and
Justin A. Richardson and
Richard Walker and
Robert K. Henderson and
Edoardo Charbon},
title = {A Time-Resolved, Low-Noise Single-Photon Image Sensor Fabricated in
Deep-Submicron {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1394--1407},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2188466},
doi = {10.1109/JSSC.2012.2188466},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GersbachMTFSRWHC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GhoshG12,
author = {Diptendu Ghosh and
Ranjit Gharpurey},
title = {A Power-Efficient Receiver Architecture Employing Bias-Current-Shared
{RF} and Baseband With Merged Supply Voltage Domains and 1/f Noise
Reduction},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {381--391},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2175270},
doi = {10.1109/JSSC.2011.2175270},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GhoshG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GodoyCBPD12,
author = {Philip A. Godoy and
SungWon Chung and
Taylor W. Barton and
David J. Perreault and
Joel L. Dawson},
title = {A 2.4-GHz, 27-dBm Asymmetric Multilevel Outphasing Power Amplifier
in 65-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2372--2384},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2202810},
doi = {10.1109/JSSC.2012.2202810},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GodoyCBPD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuC12,
author = {Ming Gu and
Shantanu Chakrabartty},
title = {Subthreshold, Varactor-Driven {CMOS} Floating-Gate Current Memory
Array With Less Than 150-ppm/{\textdegree}K Temperature Sensitivity},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2846--2856},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2214911},
doi = {10.1109/JSSC.2012.2214911},
timestamp = {Fri, 15 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/GuC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuanziroliBCDN12,
author = {Federico Guanziroli and
Rossella Bassoli and
Carlo Crippa and
Daniele Devecchi and
Germano Nicollini},
title = {A 1 {W} 104 dB {SNR} Filter-Less Fully-Digital Open-Loop Class {D}
Audio Amplifier With {EMI} Reduction},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {686--698},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2178930},
doi = {10.1109/JSSC.2011.2178930},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GuanziroliBCDN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuerberVGWM12,
author = {Jon Guerber and
Hariprasath Venkatram and
Manideep Gande and
Allen Waters and
Un{-}Ku Moon},
title = {A 10-b Ternary {SAR} {ADC} With Quantization Time Information Utilization},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2604--2613},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211696},
doi = {10.1109/JSSC.2012.2211696},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GuerberVGWM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuhadosHL12,
author = {Shankar Guhados and
Paul J. Hurst and
Stephen H. Lewis},
title = {A Pipelined {ADC} With Metastability Error Rate {\textless}10\({}^{\mbox{-15}}\)
Errors/Sample},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2119--2128},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2198773},
doi = {10.1109/JSSC.2012.2198773},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GuhadosHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuoS12,
author = {Jian Guo and
Sameer R. Sonkusale},
title = {A 65 nm {CMOS} Digital Phase Imager for Time-Resolved Fluorescence
Imaging},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1731--1742},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191335},
doi = {10.1109/JSSC.2012.2191335},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GuoS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuoYHLYC12,
author = {Jing Guo and
George Jie Yuan and
Jiageng Huang and
Jessica Ka{-}Yan Law and
Chi{-}Kong Yeung and
Mansun Chan},
title = {32.9 nV/rt Hz - 60.6 dB {THD} Dual-Band Micro-Electrode Array Signal
Acquisition {IC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1209--1220},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185590},
doi = {10.1109/JSSC.2012.2185590},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GuoYHLYC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuptaGLRA12,
author = {Subhanshu Gupta and
Daibashish Gangopadhyay and
Hasnain Lakdawala and
Jacques Christophe Rudell and
David J. Allstot},
title = {A 0.8-2 GHz Fully-Integrated QPLL-Timed Direct-RF-Sampling Bandpass
{\(\Sigma\)}{\(\Delta\)} {ADC} in 0.13 {\(\mathrm{\mu}\)}m {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1141--1153},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185530},
doi = {10.1109/JSSC.2012.2185530},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GuptaGLRA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HadiSGZFKCKP12,
author = {Richard Al Hadi and
Hani Sherry and
Janus Grzyb and
Yan Zhao and
Wolfgang Forster and
H. M. Keller and
Andreia Cathelin and
Andreas Kaiser and
Ullrich R. Pfeiffer},
title = {A 1 k-Pixel Video Camera for 0.7-1.1 Terahertz Imaging Applications
in 65-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2999--3012},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217851},
doi = {10.1109/JSSC.2012.2217851},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HadiSGZFKCKP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HarpeBPG12,
author = {Pieter Harpe and
Ben Busze and
Kathleen Philips and
Harmke de Groot},
title = {A 0.47-1.6 mW 5-bit 0.5-1 GS/s Time-Interleaved {SAR} {ADC} for Low-Power
{UWB} Radios},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1594--1602},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191042},
doi = {10.1109/JSSC.2012.2191042},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HarpeBPG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HassanLLA12,
author = {Muhammad Hassan and
Lawrence E. Larson and
Vincent W. Leung and
Peter M. Asbeck},
title = {A Combined Series-Parallel Hybrid Envelope Amplifier for Envelope
Tracking Mobile Terminal {RF} Power Amplifier Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1185--1198},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2184639},
doi = {10.1109/JSSC.2012.2184639},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HassanLLA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HatanakaT12,
author = {Teruyoshi Hatanaka and
Ken Takeuchi},
title = {{NAND} Controller System With Channel Number Detection and Feedback
for Power-Efficient High-Speed 3D-SSD},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1460--1468},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2190187},
doi = {10.1109/JSSC.2012.2190187},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HatanakaT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HedayatiMVMGSE12,
author = {Hajir Hedayati and
Mohamed Mobarak and
Guillaume Varin and
Philippe Meunier and
Patrice Gamand and
Edgar S{\'{a}}nchez{-}Sinencio and
Kamran Entesari},
title = {A 2-GHz Highly Linear Efficient Dual-Mode BiCMOS Power Amplifier Using
a Reconfigurable Matching Network},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2385--2404},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2203460},
doi = {10.1109/JSSC.2012.2203460},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HedayatiMVMGSE12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HehnHMMKFM12,
author = {Thorsten Hehn and
Friedrich Hagedorn and
Dominic Maurath and
Djordje Marinkovic and
Ingo Kuehne and
Alexander Frey and
Yiannos Manoli},
title = {A Fully Autonomous Integrated Interface Circuit for Piezoelectric
Harvesters},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2185--2198},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2200530},
doi = {10.1109/JSSC.2012.2200530},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HehnHMMKFM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HelmyJLLKKSE12,
author = {Ahmed A. Helmy and
Hyung{-}Joon Jeon and
Yung{-}Chung Lo and
Andreas J. Larsson and
Raghavendra Kulkarni and
Jusung Kim and
Jos{\'{e}} Silva{-}Mart{\'{\i}}nez and
Kamran Entesari},
title = {A Self-Sustained {CMOS} Microwave Chemical Sensor Using a Frequency
Synthesizer},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2467--2483},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2203458},
doi = {10.1109/JSSC.2012.2203458},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HelmyJLLKKSE12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HershbergWSTHM12,
author = {Benjamin P. Hershberg and
Skyler Weaver and
Kazuki Sobue and
Seiji Takeuchi and
Koichi Hamashita and
Un{-}Ku Moon},
title = {Ring Amplifiers for Switched Capacitor Circuits},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2928--2942},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217865},
doi = {10.1109/JSSC.2012.2217865},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HershbergWSTHM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Heydari12,
author = {Payam Heydari},
title = {Introduction to the 33rd Annual {IEEE} Compound Semiconductor Integrated
Circuit Symposium},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2280--2281},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204912},
doi = {10.1109/JSSC.2012.2204912},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Heydari12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HoS12,
author = {Yingchieh Ho and
Chauchin Su},
title = {A 0.1-0.3 {V} 40-123 fJ/bit/ch On-Chip Data Link With ISI-Suppressed
Bootstrapped Repeaters},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1242--1251},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2186722},
doi = {10.1109/JSSC.2012.2186722},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HoS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HuBJMRPC12,
author = {Kangmin Hu and
Rui Bai and
Tao Jiang and
Chao Ma and
Ahmed Ragab and
Samuel Palermo and
Patrick Yin Chiang},
title = {0.16-0.25 pJ/bit, 8 Gb/s Near-Threshold Serial Link Receiver With
Super-Harmonic Injection-Locking},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1842--1853},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196312},
doi = {10.1109/JSSC.2012.2196312},
timestamp = {Wed, 08 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HuBJMRPC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HuXZWLJM12,
author = {Sanming Hu and
Yong{-}Zhong Xiong and
Bo Zhang and
Lei Wang and
Teck{-}Guan Lim and
Minkyu Je and
Mohammad Madihian},
title = {A SiGe BiCMOS Transmitter/Receiver Chipset With On-Chip {SIW} Antennas
for Terahertz Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2654--2664},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211658},
doi = {10.1109/JSSC.2012.2211658},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HuXZWLJM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HuangBHDGL12,
author = {Xiongchuan Huang and
Ao Ba and
Pieter Harpe and
Guido Dolmans and
Harmke de Groot and
Jeffrey Richard Long},
title = {A 915 MHz, Ultra-Low Power 2-Tone Transceiver With Enhanced Interference
Resilience},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3197--3207},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216706},
doi = {10.1109/JSSC.2012.2216706},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HuangBHDGL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HuangC12,
author = {Chenling Huang and
Shantanu Chakrabartty},
title = {An Asynchronous Analog Self-Powered {CMOS} Sensor-Data-Logger With
a 13.56 MHz {RF} Programming Interface},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {476--489},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2172159},
doi = {10.1109/JSSC.2011.2172159},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/HuangC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HuangCLL12,
author = {Guan{-}Ying Huang and
Soon{-}Jyh Chang and
Chun{-}Cheng Liu and
Ying{-}Zu Lin},
title = {A 1-{\(\mathrm{\mu}\)}W 10-bit 200-kS/s {SAR} {ADC} With a Bypass
Window for Biomedical Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2783--2795},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217635},
doi = {10.1109/JSSC.2012.2217635},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HuangCLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HuangHYLKCHLL12,
author = {Tzu{-}Chi Huang and
Chun{-}Yu Hsieh and
Yao{-}Yi Yang and
Yu{-}Huei Lee and
Yu{-}Chai Kang and
Ke{-}Horng Chen and
Chen{-}Chih Huang and
Ying{-}Hsi Lin and
Ming{-}Wei Lee},
title = {A Battery-Free 217 nW Static Control Power Buck Converter for Wireless
{RF} Energy Harvesting With {\'{$\alpha$}}-Calibrated Dynamic
On/Off Time and Adaptive Phase Lead Control},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {852--862},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185577},
doi = {10.1109/JSSC.2012.2185577},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HuangHYLKCHLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HwangJKLJH12,
author = {Jong Tae Hwang and
Moon Sang Jung and
Dae Ho Kim and
Jun Hong Lee and
Minho Jung and
Jong{-}Shin Ha},
title = {Off-the-Line Primary Side Regulation {LED} Lamp Driver With Single-Stage
{PFC} and {TRIAC} Dimming Using {LED} Forward Voltage and Duty Variation
Tracking Control},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3081--3094},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2225735},
doi = {10.1109/JSSC.2012.2225735},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HwangJKLJH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HwangSKJK12,
author = {Sewook Hwang and
Minyoung Song and
Young{-}Ho Kwak and
Inhwa Jung and
Chulwoo Kim},
title = {A 3.5 GHz Spread-Spectrum Clock Generator With a Memoryless Newton-Raphson
Modulation Profile},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1199--1208},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2183970},
doi = {10.1109/JSSC.2012.2183970},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HwangSKJK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/IckesGSRGWMDRPHBBCK12,
author = {Nathan Ickes and
Gordon Gammie and
Mahmut E. Sinangil and
Rahul Rithe and
Jie Gu and
Alice Wang and
Hugh Mair and
Satyendra Datla and
Bing Rong and
Sushma Honnavara Prasad and
Lam Ho and
Greg Baldwin and
Dennis Buss and
Anantha P. Chandrakasan and
Uming Ko},
title = {A 28 nm 0.6 {V} Low Power {DSP} for Mobile Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {35--46},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2169689},
doi = {10.1109/JSSC.2011.2169689},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/IckesGSRGWMDRPHBBCK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/IkenagaNSSHSONISNNNHM12,
author = {Yoshifumi Ikenaga and
Masahiro Nomura and
Shuji Suenaga and
Hideo Sonohara and
Yoshitaka Horikoshi and
Toshiyuki Saito and
Yukio Ohdaira and
Yoichiro Nishio and
Tomohiro Iwashita and
Miyuki Satou and
Koji Nishida and
Koichi Nose and
Koichiro Noguchi and
Yoshihiro Hayashi and
Masayuki Mizuno},
title = {A 27{\%} Active-Power-Reduced 40-nm {CMOS} Multimedia SoC With Adaptive
Voltage Scaling Using Distributed Universal Delay Lines},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {832--840},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185340},
doi = {10.1109/JSSC.2012.2185340},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/IkenagaNSSHSONISNNNHM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ImKL12,
author = {Donggu Im and
Hongteuk Kim and
Kwyro Lee},
title = {A Broadband {CMOS} {RF} Front-End for Universal Tuners Supporting
Multi-Standard Terrestrial and Cable Broadcasts},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {392--406},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2168650},
doi = {10.1109/JSSC.2011.2168650},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ImKL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ImWRC12,
author = {Jong{-}Pil Im and
Se{-}Won Wang and
Seung{-}Tak Ryu and
Gyu{-}Hyeong Cho},
title = {A 40 mV Transformer-Reuse Self-Startup Boost Converter With {MPPT}
Control for Thermoelectric Energy Harvesting},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3055--3067},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2225734},
doi = {10.1109/JSSC.2012.2225734},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ImWRC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/InoueMNOSNMIOISKOKY12,
author = {Hiroki Inoue and
Takanori Matsuzaki and
Shuhei Nagatsuka and
Yutaka Okazaki and
Toshinari Sasaki and
Kousei Noda and
Daisuke Matsubayashi and
Takahiko Ishizu and
Tatsuya Onuki and
Atsuo Isobe and
Yutaka Shionoiri and
Kiyoshi Kato and
Takashi Okuda and
Jun Koyama and
Shunpei Yamazaki},
title = {Nonvolatile Memory With Extremely Low-Leakage Indium-Gallium-Zinc-Oxide
Thin-Film Transistor},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2258--2265},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2198969},
doi = {10.1109/JSSC.2012.2198969},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/InoueMNOSNMIOISKOKY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/IshidaHHSNMTSS12,
author = {Koichi Ishida and
Tsung{-}Ching Huang and
Kentaro Honda and
Tsuyoshi Sekitani and
Hiroyoshi Nakajima and
Hiroki Maeda and
Makoto Takamiya and
Takao Someya and
Takayasu Sakurai},
title = {A 100-V {AC} Energy Meter Integrating 20-V Organic {CMOS} Digital
and Analog Circuits With a Floating Gate for Process Variation Compensation
and a 100-V Organic pMOS Rectifier},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {301--309},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170634},
doi = {10.1109/JSSC.2011.2170634},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/IshidaHHSNMTSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/IvanovBG12,
author = {Vadim Ivanov and
Ralf Brederlow and
Johannes Gerber},
title = {An Ultra Low Power Bandgap Operational at Supply From 0.75 {V}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1515--1523},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191192},
doi = {10.1109/JSSC.2012.2191192},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/IvanovBG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/IzadH12,
author = {Mehran M. Izad and
Chun{-}Huat Heng},
title = {A Pulse Shaping Technique for Spur Suppression in Injection-Locked
Synthesizers},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {652--664},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2177178},
doi = {10.1109/JSSC.2011.2177178},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/IzadH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JainVP12,
author = {Ankesh Jain and
Muthusubramaniam Venkatesan and
Shanthi Pavan},
title = {Analysis and Design of a High Speed Continuous-time {\(\Delta\)}{\(\Sigma\)}
Modulator Using the Assisted Opamp Technique},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1615--1625},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191210},
doi = {10.1109/JSSC.2012.2191210},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JainVP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JeeSPS12,
author = {Dong{-}Woo Jee and
Young Hun Seo and
Hong{-}June Park and
Jae{-}Yoon Sim},
title = {A 2 GHz Fractional-N Digital {PLL} with 1b Noise Shaping {\(\Delta\)}{\(\Sigma\)}
{TDC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {875--883},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185190},
doi = {10.1109/JSSC.2012.2185190},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JeeSPS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JeonPHKLLK12,
author = {Hamhee Jeon and
Yunseo Park and
Yan{-}Yu Huang and
Jihwan Kim and
Kun{-}Seok Lee and
Chang{-}Ho Lee and
J. Stevenson Kenney},
title = {A Triple-Mode Balanced Linear {CMOS} Power Amplifier Using a Switched-Quadrature
Coupler},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2019--2032},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2193510},
doi = {10.1109/JSSC.2012.2193510},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JeonPHKLLK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JeonSCBS12,
author = {Dongsuk Jeon and
Mingoo Seok and
Chaitali Chakrabarti and
David T. Blaauw and
Dennis Sylvester},
title = {A Super-Pipelined Energy Efficient Subthreshold 240 MS/s {FFT} Core
in 65 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {23--34},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2169311},
doi = {10.1109/JSSC.2011.2169311},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JeonSCBS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JiangLZZHC12,
author = {Tao Jiang and
Wing Liu and
Freeman Y. Zhong and
Charlie Zhong and
Kangmin Hu and
Patrick Yin Chiang},
title = {A Single-Channel, 1.25-GS/s, 6-bit, 6.08-mW Asynchronous Successive-Approximation
{ADC} With Improved Feedback Delay in 40-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2444--2453},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204543},
doi = {10.1109/JSSC.2012.2204543},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JiangLZZHC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JiangSCCGCCB12,
author = {Xicheng Jiang and
Jungwoo Song and
Jianlong Chen and
Vinay Chandrasekhar and
Sherif Galal and
Felix Y. L. Cheung and
Darwin Cheung and
Todd Brooks},
title = {A Low-Power, High-Fidelity Stereo Audio Codec in 0.13 {\(\mathrm{\mu}\)}m
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1221--1231},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185591},
doi = {10.1109/JSSC.2012.2185591},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JiangSCCGCCB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JiaoKK12,
author = {Dong Jiao and
Bongjin Kim and
Chris H. Kim},
title = {Design, Modeling, and Test of a Programmable Adaptive Phase-Shifting
{PLL} for Enhancing Clock Data Compensation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2505--2516},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211171},
doi = {10.1109/JSSC.2012.2211171},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JiaoKK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JungYLSP12,
author = {Hae{-}Kang Jung and
Il{-}Min Yi and
Soo{-}Min Lee and
Jae{-}Yoon Sim and
Hong{-}June Park},
title = {A Transmitter to Compensate for Crosstalk-Induced Jitter by Subtracting
a Rectangular Crosstalk Waveform From Data Signal During the Data
Transition Time in Coupled Microstrip Lines},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2068--2079},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197233},
doi = {10.1109/JSSC.2012.2197233},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JungYLSP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KaeriyamaUFOMM12,
author = {Shunichi Kaeriyama and
Shinichi Uchida and
Masayuki Furumiya and
Mitsuji Okada and
Tadashi Maeda and
Masayuki Mizuno},
title = {A 2.5 kV Isolation 35 kV/us {CMR} 250 Mbps Digital Isolator in Standard
{CMOS} With a Small Transformer Driving Technique},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {435--443},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170775},
doi = {10.1109/JSSC.2011.2170775},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KaeriyamaUFOMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KaltiokallioSKPR12,
author = {Mikko Kaltiokallio and
Ville Saari and
Sami Kallioinen and
Aarno P{\"{a}}rssinen and
Jussi Ryyn{\"{a}}nen},
title = {Wideband 2 to 6 GHz {RF} Front-End With Blocker Filtering},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1636--1645},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191348},
doi = {10.1109/JSSC.2012.2191348},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/KaltiokallioSKPR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KashmiriSM12,
author = {Mahdi Kashmiri and
Kamran Souri and
Kofi A. A. Makinwa},
title = {A Scaled Thermal-Diffusivity-Based 16 MHz Frequency Reference in 0.16
{\(\mathrm{\mu}\)}m {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1535--1545},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191043},
doi = {10.1109/JSSC.2012.2191043},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KashmiriSM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KavianiWWASCTBCCCDGHHHLMMMRSSSSFSZTVVJCY12,
author = {Kambiz Kaviani and
Ting Wu and
Jason Wei and
Amir Amirkhany and
Jie Shen and
T. J. Chin and
Chintan Thakkar and
Wendemagegnehu T. Beyene and
Norman Chan and
Catherine Chen and
Bing Ren Chuang and
Deborah Dressler and
Vijay P. Gadde and
Mohammad Hekmat and
Eugene Ho and
Charlie Huang and
Phuong Le and
Mahabaleshwara and
Chris J. Madden and
Navin K. Mishra and
Leneesh Raghavan and
Keisuke Saito and
Ralf Schmitt and
Dave Secker and
Xudong Shi and
H. Md. Shuaeb Fazeel and
Gundlapalli Shanmukha Srinivas and
Steve Zhang and
Chanh Tran and
Arun Vaidyanath and
Kapil Vyas and
Manish Jain and
Kun{-}Yung Ken Chang and
Xingchao Yuan},
title = {A Tri-Modal 20-Gbps/Link Differential/DDR3/GDDR5 Memory Interface},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {926--937},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185370},
doi = {10.1109/JSSC.2012.2185370},
timestamp = {Mon, 27 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KavianiWWASCTBCCCDGHHHLMMMRSSSSFSZTVVJCY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KaymaksutR12,
author = {Ercan Kaymaksut and
Patrick Reynaert},
title = {Transformer-Based Uneven Doherty Power Amplifier in 90 nm {CMOS} for
{WLAN} Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1659--1671},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191334},
doi = {10.1109/JSSC.2012.2191334},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KaymaksutR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KhumsatW12,
author = {Phanumas Khumsat and
Apisak Worapishet},
title = {A 0.5-V {R-MOSFET-C} Filter Design Using Subthreshold {R-MOSFET} Resistors
and OTAs With Cross-Forward Common-Mode Cancellation Technique},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2751--2762},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216708},
doi = {10.1109/JSSC.2012.2216708},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KhumsatW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimB12,
author = {Joohwa Kim and
James F. Buckwalter},
title = {A Switchless, Q-Band Bidirectional Transceiver in 0.12-{\(\mathrm{\mu}\)}m
SiGe BiCMOS Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {368--380},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2174283},
doi = {10.1109/JSSC.2011.2174283},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimB12a,
author = {Joohwa Kim and
James F. Buckwalter},
title = {A 40-Gb/s Optical Transceiver Front-End in 45 nm {SOI} {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {615--626},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2178723},
doi = {10.1109/JSSC.2011.2178723},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimB12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimBW12,
author = {Wonyoung Kim and
David M. Brooks and
Gu{-}Yeon Wei},
title = {A Fully-Integrated 3-Level {DC-DC} Converter for Nanosecond-Scale
{DVFS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {206--219},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2169309},
doi = {10.1109/JSSC.2011.2169309},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimBW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimKJHYKLK12,
author = {Jihwan Kim and
Woonyun Kim and
Hamhee Jeon and
Yan{-}Yu Huang and
Youngchang Yoon and
Hyungwook Kim and
Chang{-}Ho Lee and
Kevin T. Kornegay},
title = {A Fully-Integrated High-Power Linear {CMOS} Power Amplifier With a
Parallel-Series Combining Transformer},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {599--614},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2180977},
doi = {10.1109/JSSC.2011.2180977},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimKJHYKLK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimKK12,
author = {Hong{-}Yun Kim and
Young{-}Jun Kim and
Lee{-}Sup Kim},
title = {{MRTP:} Mobile Ray Tracing Processor With Reconfigurable Stream Multi-Processors
for High Datapath Utilization},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {518--535},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2171417},
doi = {10.1109/JSSC.2011.2171417},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimKK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimKKL12,
author = {Seong{-}Jin Kim and
James D. K. Kim and
Byongmin Kang and
KeeChang Lee},
title = {A {CMOS} Image Sensor Based on Unified Pixel Architecture With Time-Division
Multiplexing Scheme for Color and Depth Image Acquisition},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2834--2845},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2214179},
doi = {10.1109/JSSC.2012.2214179},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/KimKKL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimM12,
author = {Justin Kyung{-}Ryun Kim and
Boris Murmann},
title = {A 12-b, 30-MS/s, 2.95-mW Pipelined {ADC} Using Single-Stage Class-AB
Amplifiers and Deterministic Background Calibration},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2141--2151},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2194191},
doi = {10.1109/JSSC.2012.2194191},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimOLLHHNMKPRPKKKBCJHLCJ12,
author = {Jung{-}Sik Kim and
Chi Sung Oh and
Hocheol Lee and
Donghyuk Lee and
Hyong{-}Ryol Hwang and
Sooman Hwang and
Byongwook Na and
Joungwook Moon and
Jin{-}Guk Kim and
Hanna Park and
Jang{-}Woo Ryu and
Kiwon Park and
Sang{-}Kyu Kang and
So{-}Young Kim and
Hoyoung Kim and
Jong{-}Min Bang and
Hyunyoon Cho and
Minsoo Jang and
Cheolmin Han and
Jung{-}Bae Lee and
Joo{-}Sun Choi and
Young{-}Hyun Jun},
title = {A 1.2 {V} 12.8 GB/s 2 Gb Mobile Wide-I/O {DRAM} With 4 {\texttimes}
128 I/Os Using {TSV} Based Stacking},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {107--116},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164731},
doi = {10.1109/JSSC.2011.2164731},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimOLLHHNMKPRPKKKBCJHLCJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimR12,
author = {Sang{-}Young Kim and
Gabriel M. Rebeiz},
title = {A Low-Power BiCMOS 4-Element Phased Array Receiver for 76-84 GHz Radars
and Communication Systems},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {359--367},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170769},
doi = {10.1109/JSSC.2011.2170769},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimRLKLJSJKLLKCYCJPHSKLJ12,
author = {Chulbum Kim and
Jinho Ryu and
Tae{-}Sung Lee and
Hyunggon Kim and
Jaewoo Lim and
Jaeyong Jeong and
Seonghwan Seo and
Hongsoo Jeon and
Bokeun Kim and
Inyoul Lee and
Dooseop Lee and
Pansuk Kwak and
Seongsoon Cho and
Yongsik Yim and
Changhyun Cho and
Woopyo Jeong and
Kwang{-}Il Park and
Jin{-}Man Han and
Duheon Song and
Kyehyun Kyung and
Youngho Lim and
Young{-}Hyun Jun},
title = {A 21 nm High Performance 64 Gb {MLC} {NAND} Flash Memory With 400
MB/s Asynchronous Toggle {DDR} Interface},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {981--989},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185341},
doi = {10.1109/JSSC.2012.2185341},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimRLKLJSJKLLKCYCJPHSKLJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KitsunezukaKOKMF12,
author = {Masaki Kitsunezuka and
Hiroshi Kodama and
Naoki Oshima and
Kazuaki Kunihiro and
Tadashi Maeda and
Muneo Fukaishi},
title = {A 30-MHz-2.4-GHz {CMOS} Receiver With Integrated {RF} Filter and Dynamic-Range-Scalable
Energy Detector for Cognitive Radio Systems},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1084--1093},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185531},
doi = {10.1109/JSSC.2012.2185531},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KitsunezukaKOKMF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Kobayashi12,
author = {Kevin W. Kobayashi},
title = {An 8-W 250-MHz to 3-GHz Decade-Bandwidth Low-Noise GaN {MMIC} Feedback
Amplifier With {\textgreater} +51-dBm {OIP3}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2316--2326},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204929},
doi = {10.1109/JSSC.2012.2204929},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Kobayashi12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KousaiOYKN12,
author = {Shouhei Kousai and
Kohei Onizuka and
Takashi Yamaguchi and
Yasuhiko Kuriyama and
Masami Nagaoka},
title = {A 28.3 mW PA-Closed Loop for Linearity and Efficiency Improvement
Integrated in a + 27.1 dBm {WCDMA} {CMOS} Power Amplifier},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2964--2973},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217833},
doi = {10.1109/JSSC.2012.2217833},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KousaiOYKN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KuXKWC12,
author = {I{-}Ning Ku and
Zhiwei Xu and
Yen{-}Cheng Kuan and
Yen{-}Hsiang Wang and
Mau{-}Chung Frank Chang},
title = {A 40-mW 7-bit 2.2-GS/s Time-Interleaved Subranging {CMOS} {ADC} for
Low-Power Gigabit Wireless Communications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1854--1865},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196731},
doi = {10.1109/JSSC.2012.2196731},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KuXKWC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KurchukWMT12,
author = {Mariya Kurchuk and
Colin Weltin{-}Wu and
Dominique Morche and
Yannis P. Tsividis},
title = {Event-Driven GHz-Range Continuous-Time Digital Signal Processor With
Activity-Dependent Power Dissipation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2164--2173},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2203459},
doi = {10.1109/JSSC.2012.2203459},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KurchukWMT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LaemmleVMWK12,
author = {Benjamin Laemmle and
Gabor Vinci and
Linus Maurer and
Robert Weigel and
Alexander Koelpin},
title = {A 77-GHz SiGe Integrated Six-Port Receiver Front-End for Angle-of-Arrival
Detection},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {1966--1973},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2201271},
doi = {10.1109/JSSC.2012.2201271},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LaemmleVMWK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LakdawalaL12,
author = {Hasnain Lakdawala and
Alvin Leng Sun Loke},
title = {Introduction to the Special Issue on the {IEEE} 2011 Custom Integrated
Circuits Conference},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1798--1799},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2198772},
doi = {10.1109/JSSC.2012.2198772},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LakdawalaL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LavasaniPHAA12,
author = {Hossein Miri Lavasani and
Wanling Pan and
Brandon Harrington and
Reza Abdolvand and
Farrokh Ayazi},
title = {Electronic Temperature Compensation of Lateral Bulk Acoustic Resonator
Reference Oscillators Using Enhanced Series Tuning Technique},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1381--1393},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2192657},
doi = {10.1109/JSSC.2012.2192657},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LavasaniPHAA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeC12,
author = {Junghyup Lee and
SeongHwan Cho},
title = {A 1.4-{\(\mathrm{\mu}\)}W 24.9-ppm/{\textdegree}C Current Reference
With Process-Insensitive Temperature Compensation in 0.18-{\(\mathrm{\mu}\)}m
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2527--2533},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204475},
doi = {10.1109/JSSC.2012.2204475},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeCL12,
author = {Sunghyuk Lee and
Anantha P. Chandrakasan and
Hae{-}Seung Lee},
title = {A 12 b 5-to-50 MS/s 0.5-to-1 {V} Voltage Scalable Zero-Crossing Based
Pipelined {ADC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1603--1614},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191184},
doi = {10.1109/JSSC.2012.2191184},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeCPCLLHT12,
author = {Yu{-}Huei Lee and
Chao{-}Chang Chiu and
Shen{-}Yu Peng and
Ke{-}Horng Chen and
Ying{-}Hsi Lin and
Chao{-}Cheng Lee and
Chen{-}Chih Huang and
Tsung{-}Yen Tsai},
title = {A Near-Optimum Dynamic Voltage Scaling {(DVS)} in 65-nm Energy-Efficient
Power Management With Frequency-Based Control {(FBC)} for SoC System},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2563--2575},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211671},
doi = {10.1109/JSSC.2012.2211671},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeCPCLLHT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeCSKKKKJKPKKCRCKKCC12,
author = {Hyun{-}Woo Lee and
Hoon Choi and
Beom{-}Ju Shin and
Kyung{-}Hoon Kim and
Kyung Whan Kim and
Jaeil Kim and
Kwang Hyun Kim and
Jongho Jung and
Jae{-}Hwan Kim and
Eun Young Park and
Jong{-}Sam Kim and
Jong{-}Hwan Kim and
Jin{-}Hee Cho and
Nam Gyu Rye and
Jun Hyun Chun and
Yunsaing Kim and
Chulwoo Kim and
Young{-}Jung Choi and
Byong{-}Tae Chung},
title = {A 1.0-ns/1.0-V Delay-Locked Loop With Racing Mode and Countered {CAS}
Latency Controller for {DRAM} Interfaces},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1436--1447},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191027},
doi = {10.1109/JSSC.2012.2191027},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeCSKKKKJKPKKCRCKKCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeKCSPKKCC12,
author = {Hyun{-}Woo Lee and
Ki{-}Han Kim and
Young{-}Kyoung Choi and
Ju{-}Hwan Sohn and
Nak{-}Kyu Park and
Kwan{-}Weon Kim and
Chulwoo Kim and
Young{-}Jung Choi and
Byong{-}Tae Chung},
title = {A 1.6 {V} 1.4 Gbp/s/pin Consumer {DRAM} With Self-Dynamic Voltage
Scaling Technique in 44 nm {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {131--140},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164710},
doi = {10.1109/JSSC.2011.2164710},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeKCSPKKCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeTL12,
author = {I{-}Ting Lee and
Yun{-}Ta Tsai and
Shen{-}Iuan Liu},
title = {A Leakage-Current-Recycling Phase-Locked Loop in 65 nm {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2693--2700},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2209810},
doi = {10.1109/JSSC.2012.2209810},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeTL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeYRHY12,
author = {Seulki Lee and
Long Yan and
Taehwan Roh and
Sunjoo Hong and
Hoi{-}Jun Yoo},
title = {A 75 {\(\mathrm{\mu}\)} {W} Real-Time Scalable Body Area Network Controller
and a 25 {\(\mathrm{\mu}\)}W ExG Sensor {IC} for Compact Sleep Monitoring
Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {323--334},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170636},
doi = {10.1109/JSSC.2011.2170636},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeYRHY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiLSWL12,
author = {Yan Li and
Jerry Lopez and
Cliff Schecht and
Ruili Wu and
Donald Y. C. Lie},
title = {Design of High Efficiency Monolithic Power Amplifier With Envelope-Tracking
and Transistor Resizing for Broadband Wireless Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2007--2018},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2201289},
doi = {10.1109/JSSC.2012.2201289},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiLSWL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiLTA12,
author = {Guansheng Li and
Li Liu and
Yiwu Tang and
Ehsan Afshari},
title = {A Low-Phase-Noise Wide-Tuning-Range Oscillator Based on Resonant Mode
Switching},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1295--1308},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2190185},
doi = {10.1109/JSSC.2012.2190185},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiLTA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiaoCWTCCHLJYLLCSHHWLTYLJYCP12,
author = {Shyuan Liao and
Yen{-}Shuo Chang and
Chia{-}Hsin Wu and
Hung{-}Chieh Tsai and
Hsin{-}Hua Chen and
Min Chen and
Ching{-}Wen Hsueh and
Jian{-}Bang Lin and
Den{-}Kai Juang and
Shun{-}An Yang and
Chin{-}Tai Liu and
Tsai{-}Pao Lee and
Jin{-}Ru Chen and
Chih{-}Heng Shih and
Barry Hong and
Heng{-}Ruey Hsu and
Chih{-}Yuan Wang and
Meng{-}Shiang Lin and
Wei{-}Hsiang Tseng and
Che{-}Hsiung Yang and
Lawrence Chen Lee and
Ting{-}Jyun Jheng and
Wen{-}Wei Yang and
Ming{-}Yang Chao and
Jyh{-}Shin Pan},
title = {A 70-Mb/s 100.5-dBm Sensitivity 65-nm {LP} {MIMO} Chipset for WiMAX
Portable Router},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {61--74},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167811},
doi = {10.1109/JSSC.2011.2167811},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiaoCWTCCHLJYLLCSHHWLTYLJYCP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiaoYLPO12,
author = {Yu{-}Te Liao and
Huanfen Yao and
Andrew Lingley and
Babak A. Parviz and
Brian P. Otis},
title = {A 3-{\(\mathrm{\mu}\)}W {CMOS} Glucose Sensor for Wireless Contact-Lens
Tear Glucose Monitoring},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {335--344},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170633},
doi = {10.1109/JSSC.2011.2170633},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiaoYLPO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LinK12,
author = {Wei{-}Te Lin and
Tai{-}Haur Kuo},
title = {A Compact Dynamic-Performance-Improved Current-Steering {DAC} With
Random Rotation-Based Binary-Weighted Selection},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {444--453},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2168651},
doi = {10.1109/JSSC.2011.2168651},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LinK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiuCK12,
author = {Jia{-}Ming Liu and
Shih{-}Hsiung Chien and
Tai{-}Haur Kuo},
title = {A 100 {W} 5.1-Channel Digital Class-D Audio Amplifier With Single-Chip
Design},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1344--1354},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2188465},
doi = {10.1109/JSSC.2012.2188465},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiuCK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiuLR12,
author = {Shen{-}Iuan Liu and
Tsung{-}Hsien Lin and
Woogeun Rhee},
title = {Introduction to the Special Section on the 2011 Asian Solid-State
Circuits Conference {(A-SSCC)}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2551--2553},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2212318},
doi = {10.1109/JSSC.2012.2212318},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiuLR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiuPLADGMZCKAH12,
author = {Frankie Liu and
Dinesh Patil and
Jon K. Lexau and
Philip Amberg and
Michael Dayringer and
Jonathan Gainsley and
Hesam Fathi Moghadam and
Xuezhe Zheng and
John E. Cunningham and
Ashok V. Krishnamoorthy and
Elad Alon and
Ron Ho},
title = {10-Gbps, 5.3-mW Optical Transmitter and Receiver Circuits in 40-nm
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2049--2067},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197234},
doi = {10.1109/JSSC.2012.2197234},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiuPLADGMZCKAH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiuSDMKIGB12,
author = {Paul Peng Liu and
Karl Skucha and
Yida Duan and
Mischa Megens and
Jungkyu Kim and
Igor I. Izyumin and
Simone Gambini and
Bernhard E. Boser},
title = {Magnetic Relaxation Detector for Microbead Labels},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {1056--1064},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185339},
doi = {10.1109/JSSC.2012.2185339},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiuSDMKIGB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiuYGXZM12,
author = {Chang Liu and
Yue{-}Peng Yan and
Wang Ling Goh and
Yong{-}Zhong Xiong and
Li{-}Jun Zhang and
Mohammad Madihian},
title = {A 5-Gb/s Automatic Gain Control Amplifier With Temperature Compensation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1323--1333},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2192660},
doi = {10.1109/JSSC.2012.2192660},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiuYGXZM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LohE12,
author = {Matthew Loh and
Azita Emami{-}Neyestanak},
title = {A 3x9 Gb/s Shared, All-Digital {CDR} for High-Speed, High-Density
{I/O}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {641--651},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2178557},
doi = {10.1109/JSSC.2011.2178557},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LohE12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LokeDMFWWF12,
author = {Alvin Leng Sun Loke and
Bruce Andrew Doyle and
Sanjeev K. Maheshwari and
Dennis Michael Fischette and
Charles Lin Wang and
Tin Tin Wee and
Emerson S. Fang},
title = {An 8.0-Gb/s HyperTransport Transceiver for 32-nm {SOI-CMOS} Server
Processors},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2627--2642},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211697},
doi = {10.1109/JSSC.2012.2211697},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LokeDMFWWF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LotzeM12,
author = {Niklas Lotze and
Yiannos Manoli},
title = {A 62 mV 0.13 {\(\mathrm{\mu}\)} m {CMOS} Standard-Cell-Based Design
Technique Using Schmitt-Trigger Logic},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {47--60},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167777},
doi = {10.1109/JSSC.2011.2167777},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LotzeM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LuLA12,
author = {Ping Lu and
Antonio Liscidini and
Pietro Andreani},
title = {A 3.6 mW, 90 nm {CMOS} Gated-Vernier Time-to-Digital Converter With
an Equivalent Resolution of 3.2 ps},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1626--1635},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191676},
doi = {10.1109/JSSC.2012.2191676},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LuLA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LuWC12,
author = {Jianhua Lu and
Ning{-}Yi Wang and
Mau{-}Chung Frank Chang},
title = {A Compact and Low Power 5-10 GHz Quadrature Local Oscillator for Cognitive
Radio Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1131--1140},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185573},
doi = {10.1109/JSSC.2012.2185573},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LuWC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LuYHCL12,
author = {Chih{-}Wen Lu and
Ping{-}Yeh Yin and
Ching{-}Min Hsiao and
Mau{-}Chung Frank Chang and
Yo{-}Sheng Lin},
title = {A 10-bit Resistor-Floating-Resistor-String {DAC} {(RFR-DAC)} for High
Color-Depth {LCD} Driver ICs},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2454--2466},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2206684},
doi = {10.1109/JSSC.2012.2206684},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LuYHCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MahonYP12,
author = {Simon J. Mahon and
Alan C. Young and
Anthony E. Parker},
title = {Common-Gate Load-Pull With Q-Band Application},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2282--2290},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204913},
doi = {10.1109/JSSC.2012.2204913},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MahonYP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Manstretta12,
author = {Danilo Manstretta},
title = {A Broadband Low-Power Low-Noise Active Balun With Second-Order Distortion
Cancellation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {407--420},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2168649},
doi = {10.1109/JSSC.2011.2168649},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Manstretta12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MarienSVH12,
author = {Hagen Marien and
Michiel Steyaert and
Erik van Veenendaal and
Paul Heremans},
title = {Analog Building Blocks for Organic Smart Sensor Systems in Organic
Thin-Film Transistor Technology on Flexible Plastic Foil},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1712--1720},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191038},
doi = {10.1109/JSSC.2012.2191038},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MarienSVH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MartensBCFWPCR12,
author = {Ewout Martens and
Andr{\'{e}} Bourdoux and
A{\"{\i}}ssa Couvreur and
Robert Fasthuber and
Peter Van Wesemael and
Geert Van der Plas and
Jan Craninckx and
Julien Ryckaert},
title = {RF-to-Baseband Digitization in 40 nm {CMOS} With {RF} Bandpass {\(\Delta\)}{\(\Sigma\)}
Modulator and Polyphase Decimation Filter},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {990--1002},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185149},
doi = {10.1109/JSSC.2012.2185149},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MartensBCFWPCR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MarzinLSL12,
author = {Giovanni Marzin and
Salvatore Levantino and
Carlo Samori and
Andrea L. Lacaita},
title = {A 20 Mb/s Phase Modulator Based on a 3.6 GHz Digital {PLL} With -36
dB {EVM} at 5 mW Power},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2974--2988},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217854},
doi = {10.1109/JSSC.2012.2217854},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MarzinLSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MasonFD12,
author = {Ralph D. Mason and
Justin Fortier and
Christopher A. DeVries},
title = {Complete {SOC} Transceiver in 0.18 {\(\mathrm{\mu}\)}m {CMOS} Using
Q-Enhanced Filtering, Sub-Sampling and Injection Locking},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1800--1809},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197129},
doi = {10.1109/JSSC.2012.2197129},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MasonFD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MasuchD12,
author = {Jens Masuch and
Manuel Delgado{-}Restituto},
title = {A 190-{\(\mathrm{\mu}\)}W zero-IF {GFSK} Demodulator With a 4-b Phase-Domain
{ADC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2796--2806},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216211},
doi = {10.1109/JSSC.2012.2216211},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MasuchD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MathewSAKHSASK12,
author = {Sanu Mathew and
Suresh Srinivasan and
Mark A. Anders and
Himanshu Kaul and
Steven Hsu and
Farhana Sheikh and
Amit Agarwal and
Sudhir Satpathy and
Ram Krishnamurthy},
title = {2.4 Gbps, 7 mW All-Digital PVT-Variation Tolerant True Random Number
Generator for 45 nm {CMOS} High-Performance Microprocessors},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2807--2821},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217631},
doi = {10.1109/JSSC.2012.2217631},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/MathewSAKHSASK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MattauschIKAYK12,
author = {Hans J{\"{u}}rgen Mattausch and
Wataru Imafuku and
Akio Kawabata and
Tania Ansari and
Masahiro Yasuda and
Tetsushi Koide},
title = {Associative Memory for Nearest-Hamming-Distance Search Based on Frequency
Mapping},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1448--1459},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2190191},
doi = {10.1109/JSSC.2012.2190191},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MattauschIKAYK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MaurathBSM12,
author = {Dominic Maurath and
Philipp F. Becker and
Dirk Spreemann and
Yiannos Manoli},
title = {Efficient Energy Harvesting With Electromagnetic Energy Transducers
Using Active Low-Voltage Rectification and Maximum Power Point Tracking},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1369--1380},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2188562},
doi = {10.1109/JSSC.2012.2188562},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MaurathBSM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/McIntyreABFGHMNV12,
author = {Hugh McIntyre and
Srikanth Arekapudi and
Eric Busta and
Timothy C. Fischer and
Michael Golden and
Aaron Horiuchi and
Tom Meneghini and
Samuel Naffziger and
James Vinh},
title = {Design of the Two-Core x86-64 {AMD} "Bulldozer" Module in 32 nm {SOI}
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {164--176},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167823},
doi = {10.1109/JSSC.2011.2167823},
timestamp = {Wed, 24 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/McIntyreABFGHMNV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MichelS12,
author = {Fridolin Michel and
Michiel Steyaert},
title = {A 250 mV 7.5 {\(\mu\)}W 61 dB {SNDR} {SC} {\(\Delta\)}{\(\Sigma\)}
Modulator Using Near-Threshold-Voltage-Biased Inverter Amplifiers
in 130 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {709--721},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2179732},
doi = {10.1109/JSSC.2011.2179732},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MichelS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MikiMOD12,
author = {Takuji Miki and
Takashi Morie and
Toshiaki Ozeki and
Shiro Dosho},
title = {An 11-b 300-MS/s Double-Sampling Pipelined {ADC} With On-Chip Digital
Calibration for Memory Effects},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2773--2782},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216217},
doi = {10.1109/JSSC.2012.2216217},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MikiMOD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MitomoTHHWTTSKKIBTT12,
author = {Toshiya Mitomo and
Yukako Tsutsumi and
Hiroaki Hoshino and
Masahiro Hosoya and
Tong Wang and
Yuta Tsubouchi and
Ryoichi Tachibana and
Akihide Sai and
Yuka Kobayashi and
Daisuke Kurose and
Tomohiko Ito and
Koichiro Ban and
Tomoya Tandai and
Takeshi Tomizawa},
title = {A 2-Gb/s Throughput {CMOS} Transceiver Chipset With In-Package Antenna
for 60-GHz Short-Range Wireless Communication},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3160--3171},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216694},
doi = {10.1109/JSSC.2012.2216694},
timestamp = {Tue, 04 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MitomoTHHWTTSKKIBTT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Moon12,
author = {Un{-}Ku Moon},
title = {New Associate Editors},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1071--1072},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2193330},
doi = {10.1109/JSSC.2012.2193330},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Moon12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Moon12a,
author = {Un{-}Ku Moon},
title = {New Associate Editor},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {1963},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2208789},
doi = {10.1109/JSSC.2012.2208789},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Moon12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Moon12b,
author = {Un{-}Ku Moon},
title = {New Associate Editor},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2279},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2219251},
doi = {10.1109/JSSC.2012.2219251},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Moon12b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MullerGR12,
author = {Rikky Muller and
Simone Gambini and
Jan M. Rabaey},
title = {A 0.013 mm\({}^{\mbox{2}}\), 5 {\(\mathrm{\mu}\)}W , DC-Coupled Neural
Signal Acquisition {IC} With 0.5 {V} Supply},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {232--243},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2163552},
doi = {10.1109/JSSC.2011.2163552},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MullerGR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MullerSFYCNK12,
author = {Jonathan M{\"{u}}ller and
Bruno Stefanelli and
Antoine Frapp{\'{e}} and
Lu Ye and
Andreia Cathelin and
Ali M. Niknejad and
Andreas Kaiser},
title = {A 7-Bit 18th Order 9.6 GS/s {FIR} Up-Sampling Filter for High Data
Rate 60-GHz Wireless Transmitters},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1743--1756},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191677},
doi = {10.1109/JSSC.2012.2191677},
timestamp = {Fri, 24 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/MullerSFYCNK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MurphyDAHMMC12,
author = {David Murphy and
Hooman Darabi and
Asad A. Abidi and
Amr Amin Hafez and
Ahmad Mirzaei and
Mohyee Mikhemar and
Mau{-}Chung Frank Chang},
title = {A Blocker-Tolerant, Noise-Cancelling Receiver Suitable for Wideband
Wireless Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2943--2963},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217832},
doi = {10.1109/JSSC.2012.2217832},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MurphyDAHMMC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MynyVGGDH12,
author = {Kris Myny and
Erik van Veenendaal and
Gerwin H. Gelinck and
Jan Genoe and
Wim Dehaene and
Paul Heremans},
title = {An 8-Bit, 40-Instructions-Per-Second Organic Microprocessor on Plastic
Foil},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {284--291},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170635},
doi = {10.1109/JSSC.2011.2170635},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MynyVGGDH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NagariAABF12,
author = {Angelo Nagari and
Emmanuel Allier and
Francois Amiard and
Vincent Binet and
Christian Fraisse},
title = {An 8 {\(\Omega\)} 2.5 {W} 1{\%}-THD 104 dB(A)-Dynamic-Range Class-D
Audio Amplifier With Ultra-Low {EMI} System and Current Sensing for
Speaker Protection},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3068--3080},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2225762},
doi = {10.1109/JSSC.2012.2225762},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NagariAABF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NagataD12,
author = {Makoto Nagata and
Vivek De},
title = {Introduction to the Special Issue on the 2011 Symposium on {VLSI}
Circuits},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {795--796},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185357},
doi = {10.1109/JSSC.2012.2185357},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NagataD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NakamuraMWK12,
author = {Takahiro Nakamura and
Toru Masuda and
Katsuyoshi Washio and
Hiroshi Kondoh},
title = {A Push-Push {VCO} With 13.9-GHz Wide Tuning Range Using Loop-Ground
Transmission Line for Full-Band 60-GHz Transceiver},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1267--1277},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2187470},
doi = {10.1109/JSSC.2012.2187470},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NakamuraMWK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NakataniRKLA12,
author = {Toshifumi Nakatani and
Jeremy Rode and
Donald F. Kimball and
Lawrence E. Larson and
Peter M. Asbeck},
title = {Digitally-Controlled Polar Transmitter Using a Watt-Class Current-Mode
Class-D {CMOS} Power Amplifier and Guanella Reverse Balun for Handset
Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1104--1112},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185554},
doi = {10.1109/JSSC.2012.2185554},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NakataniRKLA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NazariE12,
author = {Meisam Honarvar Nazari and
Azita Emami{-}Neyestanak},
title = {A 15-Gb/s 0.5-mW/Gbps Two-Tap {DFE} Receiver With Far-End Crosstalk
Cancellation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2420--2432},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2203870},
doi = {10.1109/JSSC.2012.2203870},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NazariE12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NegreRCSJBGG12,
author = {Laurent Negre and
David Roy and
Florian Cacho and
Patrick Scheer and
Sebastien Jan and
Samuel Boret and
Daniel Gloria and
G{\'{e}}rard Ghibaudo},
title = {Reliability Characterization and Modeling Solution to Predict Aging
of 40-nm {MOSFET} {DC} and {RF} Performances Induced by {RF} Stresses},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1075--1083},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185549},
doi = {10.1109/JSSC.2012.2185549},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NegreRCSJBGG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NiitsuSHYK12,
author = {Kiichi Niitsu and
Masato Sakurai and
Naohiro Harigai and
Takahiro J. Yamaguchi and
Haruo Kobayashi},
title = {{CMOS} Circuits to Measure Timing Jitter Using a Self-Referenced Clock
and a Cascaded Time Difference Amplifier With Duty-Cycle Compensation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2701--2710},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211655},
doi = {10.1109/JSSC.2012.2211655},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/NiitsuSHYK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NoorsalSXHBO12,
author = {Emilia Noorsal and
Kriangkrai Sooksood and
Hongcheng Xu and
Ralf Hornig and
Joachim Becker and
Maurits Ortmanns},
title = {A Neural Stimulator Frontend With High-Voltage Compliance and Programmable
Pulse Shape for Epiretinal Implants},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {244--256},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164667},
doi = {10.1109/JSSC.2011.2164667},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NoorsalSXHBO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NorlingLD12,
author = {Karl Norling and
Christian Lindholm and
Dieter Draxelmayr},
title = {An Optimized Driver for SiC JFET-Based Switches Enabling Converter
Operation With More Than 99{\%} Efficiency},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3095--3104},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2225736},
doi = {10.1109/JSSC.2012.2225736},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NorlingLD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NuytsSDRD12,
author = {Pieter A. J. Nuyts and
Peter Singerl and
Franz Dielacher and
Patrick Reynaert and
Wim Dehaene},
title = {A Fully Digital Delay Line Based GHz Range Multimode Transmitter Front-End
in 65-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1681--1692},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191032},
doi = {10.1109/JSSC.2012.2191032},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NuytsSDRD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/OnizukaIHSWO12,
author = {Kohei Onizuka and
Hiroaki Ishihara and
Masahiro Hosoya and
Shigehito Saigusa and
Osamu Watanabe and
Shoji Otaka},
title = {A 1.9 GHz {CMOS} Power Amplifier With Embedded Linearizer to Compensate
{AM-PM} Distortion},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1820--1827},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196629},
doi = {10.1109/JSSC.2012.2196629},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/OnizukaIHSWO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/OsakiHKN12,
author = {Yuji Osaki and
Tetsuya Hirose and
Nobutaka Kuroki and
Masahiro Numa},
title = {A Low-Power Level Shifter With Logic Error Correction for Extremely
Low-Voltage Digital {CMOS} LSIs},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1776--1783},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191320},
doi = {10.1109/JSSC.2012.2191320},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/OsakiHKN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PaganoBR12,
author = {Rosario Pagano and
Michael Baker and
Russell E. Radke},
title = {A 0.18-{\(\mu\)}m Monolithic Li-Ion Battery Charger for Wireless Devices
Based on Partial Current Sensing and Adaptive Reference Voltage},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1355--1368},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191025},
doi = {10.1109/JSSC.2012.2191025},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/PaganoBR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PankratzS12,
author = {Erik Pankratz and
Edgar S{\'{a}}nchez{-}Sinencio},
title = {Multiloop High-Power-Supply-Rejection Quadrature Ring Oscillator},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2033--2048},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2193517},
doi = {10.1109/JSSC.2012.2193517},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/PankratzS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ParkC12,
author = {Dongmin Park and
SeongHwan Cho},
title = {A 14.2 mW 2.55-to-3 GHz Cascaded {PLL} With Reference Injection and
800 MHz Delta-Sigma Modulator in 0.13 {\(\mu\)} m {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2989--2998},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217856},
doi = {10.1109/JSSC.2012.2217856},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ParkC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ParkKN12,
author = {Jung{-}Dong Park and
Shinwon Kang and
Ali M. Niknejad},
title = {A 0.38 THz Fully Integrated Transceiver Utilizing a Quadrature Push-Push
Harmonic Circuitry in SiGe BiCMOS},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2344--2354},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211156},
doi = {10.1109/JSSC.2012.2211156},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ParkKN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ParkKOLKY12,
author = {Junyoung Park and
Joonsoo Kwon and
Jinwook Oh and
Seungjin Lee and
Joo{-}Young Kim and
Hoi{-}Jun Yoo},
title = {A 92-mW Real-Time Traffic Sign Recognition System With Robust Illumination
Adaptation and Support Vector Machine},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2711--2723},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211691},
doi = {10.1109/JSSC.2012.2211691},
timestamp = {Fri, 13 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/ParkKOLKY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ParkPC12,
author = {Pyoungwon Park and
Dongmin Park and
SeongHwan Cho},
title = {A 2.4 GHz Fractional-N Frequency Synthesizer With High-OSR {\(\Delta\)}{\(\Sigma\)}
Modulator and Nested {PLL}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2433--2443},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2209809},
doi = {10.1109/JSSC.2012.2209809},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ParkPC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Pena-PerezBM12,
author = {Aldo Pena{-}Perez and
Edoardo Bonizzoni and
Franco Maloberti},
title = {A 88-dB DR, 84-dB {SNDR} Very Low-Power Single Op-Amp Third-Order
{\(\Sigma\)} {\(\Delta\)} Modulator},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2107--2118},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2199669},
doi = {10.1109/JSSC.2012.2199669},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Pena-PerezBM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Pilawa-PodgurskiP12,
author = {Robert C. N. Pilawa{-}Podgurski and
David J. Perreault},
title = {Merged Two-Stage Power Converter With Soft Charging Switched-Capacitor
Stage in 180 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1557--1567},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191325},
doi = {10.1109/JSSC.2012.2191325},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Pilawa-PodgurskiP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PiloABBGHLRS12,
author = {Harold Pilo and
Igor Arsovski and
Kevin Batson and
Geordie Braceras and
John A. Gabric and
Robert M. Houle and
Steve Lamphier and
Carl Radens and
Adnan Seferagic},
title = {A 64 Mb {SRAM} in 32 nm High-k Metal-Gate {SOI} Technology With 0.7
{V} Operation Enabled by Stability, Write-Ability and Read-Ability
Enhancements},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {97--106},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164730},
doi = {10.1109/JSSC.2011.2164730},
timestamp = {Tue, 29 Mar 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/PiloABBGHLRS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PohlKAR12,
author = {Nils Pohl and
Tobias Klein and
Klaus Aufinger and
Hans{-}Martin Rein},
title = {A Low-Power Wideband Transmitter Front-End Chip for 80 GHz {FMCW}
Radar Systems With Integrated 23 GHz Downconverter {VCO}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {1974--1980},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2201272},
doi = {10.1109/JSSC.2012.2201272},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/PohlKAR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/QaziCBC12,
author = {Masood Qazi and
Michael Clinton and
Steven Bartling and
Anantha P. Chandrakasan},
title = {A Low-Voltage 1 Mb {FRAM} in 0.13 {\(\mathrm{\mu}\)}m {CMOS} Featuring
Time-to-Digital Sensing for Expanded Operating Margin},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {141--150},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164732},
doi = {10.1109/JSSC.2011.2164732},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/QaziCBC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RadeckiMIK12,
author = {Andrzej Radecki and
Noriyuki Miura and
Hiroki Ishikuro and
Tadahiro Kuroda},
title = {Rotary Coding for Power Reduction and {S/N} Improvement in Inductive-Coupling
Data Communication},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2643--2653},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211656},
doi = {10.1109/JSSC.2012.2211656},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RadeckiMIK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RadeckiYMATIK12,
author = {Andrzej Radecki and
Yuxiang Yuan and
Noriyuki Miura and
Iori Aikawa and
Yasuhiro Take and
Hiroki Ishikuro and
Tadahiro Kuroda},
title = {Simultaneous 6-Gb/s Data and 10-mW Power Transmission Using Nested
Clover Coils for Noncontact Memory Card},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2484--2495},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204545},
doi = {10.1109/JSSC.2012.2204545},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RadeckiYMATIK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RadisicLSMYLDL12,
author = {Vesna Radisic and
Kevin M. K. H. Leong and
Stephen Sarkozy and
Xiaobing (Gerry) Mei and
Wayne Yoshida and
Po{-}Hsin Liu and
William R. Deal and
Richard Lai},
title = {220-GHz Solid-State Power Amplifier Modules},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2291--2297},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204923},
doi = {10.1109/JSSC.2012.2204923},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RadisicLSMYLDL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RalstonOVR12,
author = {Parrish Ralston and
Marcus Oliver and
Krishna Vummidi and
Sanjay Raman},
title = {Liquid-Metal Vertical Interconnects for Flip Chip Assembly of GaAs
C-Band Power Amplifiers Onto Micro-Rectangular Coaxial Transmission
Lines},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2327--2334},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204930},
doi = {10.1109/JSSC.2012.2204930},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/RalstonOVR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RaviMXCVPCASZBLP12,
author = {Ashoke Ravi and
Paolo Madoglio and
Hongtao Xu and
Kailash Chandrashekar and
Marian Verhelst and
Stefano Pellerano and
Luis Cuellar and
Mariano Aguirre{-}Hernandez and
Masoud Sajadieh and
J. E. Zarate{-}Roldan and
Ofir Bochobza{-}Degani and
Hasnain Lakdawala and
Yorgos Palaskas},
title = {A 2.4-GHz 20-40-MHz Channel {WLAN} Digital Outphasing Transmitter
Utilizing a Delay-Based Wideband Phase Modulator in 32-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3184--3196},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216671},
doi = {10.1109/JSSC.2012.2216671},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RaviMXCVPCASZBLP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ReddyRIYETH12,
author = {Karthikeyan Reddy and
Sachin Rao and
Rajesh Inti and
Brian Young and
Amr Elshazly and
Mrunmay Talegaonkar and
Pavan Kumar Hanumolu},
title = {A 16-mW 78-dB {SNDR} 10-MHz {BW} {CT} Delta Sigma {ADC} Using Residue-Cancelling
VCO-Based Quantizer},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2916--2927},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2218062},
doi = {10.1109/JSSC.2012.2218062},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ReddyRIYETH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RiedlingerABBCDFFGLMMMNPPRRSS12,
author = {Reid J. Riedlinger and
Ron Arnold and
Larry Biro and
William J. Bowhill and
Jason Crop and
Kevin Duda and
Eric S. Fetzer and
Olivier Franza and
Tom Grutkowski and
Casey Little and
Charles Morganti and
Gary Moyer and
Ashley O. Munch and
Mahalingam Nagarajan and
Cheolmin Park and
Christopher Poirier and
Bill Repasky and
Edi Roytman and
Tejpal Singh and
Matthew W. Stefaniw},
title = {A 32 nm, 3.1 Billion Transistor, 12 Wide Issue Itanium{\textregistered}
Processor for Mission-Critical Servers},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {177--193},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167809},
doi = {10.1109/JSSC.2011.2167809},
timestamp = {Mon, 21 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/RiedlingerABBCDFFGLMMMNPPRRSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RitheCC12,
author = {Rahul Rithe and
Chih{-}Chi Cheng and
Anantha P. Chandrakasan},
title = {Quad Full-HD Transform Engine for Dual-Standard Low-Power Video Coding},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2724--2736},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211694},
doi = {10.1109/JSSC.2012.2211694},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RitheCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RooseleerCD12,
author = {Bram Rooseleer and
Stefan Cosemans and
Wim Dehaene},
title = {A 65 nm, 850 MHz, 256 kbit, 4.3 pJ/access, Ultra Low Leakage Power
Memory Using Dynamic Cell Stability and a Dual Swing Data Link},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1784--1796},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191316},
doi = {10.1109/JSSC.2012.2191316},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RooseleerCD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RumbergG12,
author = {Brandon Rumberg and
David W. Graham},
title = {A Low-Power Magnitude Detector for Analysis of Transient-Rich Signals},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {676--685},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2179452},
doi = {10.1109/JSSC.2011.2179452},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RumbergG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RylyakovSLGADYCJKV12,
author = {Alexander V. Rylyakov and
Clint Schow and
Benjamin G. Lee and
William M. J. Green and
Solomon Assefa and
Fuad E. Doany and
Min Yang and
Joris Van Campenhout and
Christopher V. Jahnes and
Jeffrey A. Kash and
Yurii A. Vlasov},
title = {Silicon Photonic Switches Hybrid-Integrated With {CMOS} Drivers},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {345--354},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170638},
doi = {10.1109/JSSC.2011.2170638},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RylyakovSLGADYCJKV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SahaHSDEC12,
author = {Prabir K. Saha and
Duane C. Howard and
Subramaniam Shankar and
Ryan Diestelhorst and
Troy D. England and
John D. Cressler},
title = {A 6-20 GHz Adaptive SiGe Image Reject Mixer for a Self-Healing Receiver},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {1998--2006},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2201284},
doi = {10.1109/JSSC.2012.2201284},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SahaHSDEC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SandeLDHABAPMRWJLWP12,
author = {Frank Van de Sande and
Nico Lugil and
Filip Demarsin and
Zeger Hendrix and
Alvin Andries and
Peter Brandt and
William Anklam and
Jeffery S. Patterson and
Brian Miller and
Michael Rytting and
Mike Whaley and
Bob Jewett and
Jacky Liu and
Jake Wegman and
Ken Poulton},
title = {A 7.2 GSa/s, 14 Bit or 12 GSa/s, 12 Bit Signal Generator on a Chip
in a 165 GHz f\({}_{\mbox{T}}\) BiCMOS Process},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {1003--1012},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185172},
doi = {10.1109/JSSC.2012.2185172},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SandeLDHABAPMRWJLWP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SchlottmannSNH12,
author = {Craig Schlottmann and
Samuel A. Shapero and
Stephen Nease and
Paul E. Hasler},
title = {A Digitally Enhanced Dynamically Reconfigurable Analog Platform for
Low-Power Signal Processing},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2174--2184},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2194847},
doi = {10.1109/JSSC.2012.2194847},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SchlottmannSNH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SenguptaH12,
author = {Kaushik Sengupta and
Ali Hajimiri},
title = {A 0.28 THz Power-Generation and Beam-Steering Array in {CMOS} Based
on Distributed Active Radiators},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3013--3031},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217831},
doi = {10.1109/JSSC.2012.2217831},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SenguptaH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SeoCPYK12,
author = {Heesong Seo and
In Young Choi and
Changjoon Park and
Jehyung Yoon and
Bumman Kim},
title = {A Wideband Digital {RF} Receiver Front-End Employing a New Discrete-Time
Filter for m-WiMAX},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1165--1174},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185529},
doi = {10.1109/JSSC.2012.2185529},
timestamp = {Tue, 26 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/SeoCPYK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SeoKPS12,
author = {Young Hun Seo and
Jun{-}Seok Kim and
Hong{-}June Park and
Jae{-}Yoon Sim},
title = {A 1.25 ps Resolution 8b Cyclic {TDC} in 0.13 {\(\mathrm{\mu}\)}m {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {736--743},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2176609},
doi = {10.1109/JSSC.2011.2176609},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SeoKPS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SeoSITIWIYK12,
author = {Min{-}Woong Seo and
Sungho Suh and
Tetsuya Iida and
Taishi Takasawa and
Keigo Isobe and
Takashi Watanabe and
Shinya Itoh and
Keita Yasutomi and
Shoji Kawahito},
title = {A Low-Noise High Intrascene Dynamic Range {CMOS} Image Sensor With
a 13 to 19b Variable-Resolution Column-Parallel Folding-Integration/Cyclic
{ADC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {272--283},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164298},
doi = {10.1109/JSSC.2011.2164298},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SeoSITIWIYK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SeokKBS12,
author = {Mingoo Seok and
Gyouho Kim and
David T. Blaauw and
Dennis Sylvester},
title = {A Portable 2-Transistor Picowatt Temperature-Compensated Voltage Reference
Operating at 0.5 {V}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2534--2545},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2206683},
doi = {10.1109/JSSC.2012.2206683},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SeokKBS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ShettigarP12,
author = {Pradeep Shettigar and
Shanthi Pavan},
title = {Design Techniques for Wideband Single-Bit Continuous-Time Delta Sigma
Modulators With {FIR} Feedback DACs},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2865--2879},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217871},
doi = {10.1109/JSSC.2012.2217871},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ShettigarP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ShiSRHK12,
author = {Justin Shi and
Eric G. Soenen and
Alan Roth and
Ying{-}Chih Hsu and
Martin Kinyua},
title = {Practical Considerations for a Digital Inductive-Switching {DC/DC}
Converter With Direct Battery Connect in Deep Sub-Micron {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1946--1959},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196318},
doi = {10.1109/JSSC.2012.2196318},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ShiSRHK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ShibataSYSPCAL12,
author = {Hajime Shibata and
Richard Schreier and
Wenhua Yang and
Ali Shaikh and
Donald Paterson and
Trevor C. Caldwell and
David Alldred and
Ping Wing Lai},
title = {A DC-to-1 GHz Tunable {RF} Delta Sigma {ADC} Achieving {DR} = 74 dB
and {BW} = 150 MHz at f\({}_{\mbox{0}}\) = 450 MHz Using 550 mW},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2888--2897},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217860},
doi = {10.1109/JSSC.2012.2217860},
timestamp = {Wed, 01 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ShibataSYSPCAL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ShikataSKI12,
author = {Akira Shikata and
Ryota Sekimoto and
Tadahiro Kuroda and
Hiroki Ishikuro},
title = {A 0.5 {V} 1.1 MS/sec 6.3 fJ/Conversion-Step {SAR-ADC} With Tri-Level
Comparator in 40 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {1022--1030},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185352},
doi = {10.1109/JSSC.2012.2185352},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ShikataSKI12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ShinS12,
author = {Jaewook Shin and
Hyunchol Shin},
title = {A 1.9-3.8 GHz {\(\Delta\)}{\(\Sigma\)} Fractional-N {PLL} Frequency
Synthesizer With Fast Auto-Calibration of Loop Bandwidth and {VCO}
Frequency},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {665--675},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2179733},
doi = {10.1109/JSSC.2011.2179733},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ShinS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SinghKPVBN12,
author = {Vikas Singh and
Nagendra Krishnapura and
Shanthi Pavan and
Baradwaj Vigraham and
Debasish Behera and
Nimit Nigania},
title = {A 16 MHz {BW} 75 dB {DR} {CT} {\(\Delta\)}{\(\Sigma\)} {ADC} Compensated
for More Than One Cycle Excess Loop Delay},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1884--1895},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196730},
doi = {10.1109/JSSC.2012.2196730},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SinghKPVBN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SinghLGG12,
author = {Ritu Raj Singh and
Lian Leng and
Axel Guenther and
Roman Genov},
title = {A CMOS-Microfluidic Chemiluminescence Contact Imaging Microsystem},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2822--2833},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2214182},
doi = {10.1109/JSSC.2012.2214182},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/SinghLGG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/StauthSK12,
author = {Jason T. Stauth and
Michael D. Seeman and
Kapil Kesarwani},
title = {A Resonant Switched-Capacitor {IC} and Embedded System for Sub-Module
Photovoltaic Power Management},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3043--3054},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2225731},
doi = {10.1109/JSSC.2012.2225731},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/StauthSK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SturckenPWMCPS12,
author = {Noah Sturcken and
Michele Petracca and
Steve B. Warren and
Paolo Mantovani and
Luca P. Carloni and
Angel V. Peterchev and
Kenneth L. Shepard},
title = {A Switched-Inductor Integrated Voltage Regulator With Nonlinear Feedback
and Network-on-Chip Load in 45 nm {SOI}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1935--1945},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196316},
doi = {10.1109/JSSC.2012.2196316},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SturckenPWMCPS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SuHCTCC12,
author = {Yu{-}Chi Su and
Keng{-}Yen Huang and
Tse{-}Wei Chen and
Yi{-}Min Tsai and
Shao{-}Yi Chien and
Liang{-}Gee Chen},
title = {A 52 mW Full {HD} 160-Degree Object Viewpoint Recognition SoC With
Visual Vocabulary Processor for Wearable Vision Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {797--809},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185349},
doi = {10.1109/JSSC.2012.2185349},
timestamp = {Wed, 14 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SuHCTCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SzeC12,
author = {Vivienne Sze and
Anantha P. Chandrakasan},
title = {A Highly Parallel and Scalable {CABAC} Decoder for Next Generation
Video Coding},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {8--22},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2169310},
doi = {10.1109/JSSC.2011.2169310},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SzeC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Taherzadeh-SaniH12,
author = {Mohammad Taherzadeh{-}Sani and
Anas A. Hamoui},
title = {Correction to "A 1-V Process-Insensitive Current-Scalable Two-Stage
Opamp With Enhanced {DC} Gain and Settling Behavior in 65-nm Digital
CMOS" [Mar 11 660-668]},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1497},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2193516},
doi = {10.1109/JSSC.2012.2193516},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Taherzadeh-SaniH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TaiXRLDCP12,
author = {Wei Tai and
Hongtao Xu and
Ashoke Ravi and
Hasnain Lakdawala and
Ofir B. Degani and
L. Richard Carley and
Yorgos Palaskas},
title = {A Transformer-Combined 31.5 dBm Outphasing Power Amplifier in 45 nm
{LP} {CMOS} With Dynamic Power Control for Back-Off Power Efficiency
Enhancement},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1646--1658},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191674},
doi = {10.1109/JSSC.2012.2191674},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TaiXRLDCP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TakashimaNSKSF12,
author = {Daisaburo Takashima and
Mitsuhiro Noguchi and
Noboru Shibata and
Kazushige Kanda and
Hiroshi Sukegawa and
Shuso Fujii},
title = {An Embedded {DRAM} Technology for High-Performance {NAND} Flash Memories},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {2},
pages = {536--546},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170779},
doi = {10.1109/JSSC.2011.2170779},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TakashimaNSKSF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TanSMP12,
author = {Zhichao Tan and
Saleh Heidary Shalmany and
Gerard C. M. Meijer and
Michiel A. P. Pertijs},
title = {An Energy-Efficient 15-Bit Capacitive-Sensor Interface Based on Period
Modulation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1703--1711},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191212},
doi = {10.1109/JSSC.2012.2191212},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TanSMP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TanSZCYTYGTCKWCHSD12,
author = {Sam Chun{-}Geik Tan and
Fei Song and
Renliang Zheng and
Jiqing Cui and
Guoqin Yao and
Litian Tang and
Yuejin Yang and
Dandan Guo and
Alexander Tanzil and
Junmin Cao and
Ming Kong and
KianTiong Wong and
Soong Lin Chew and
Chee{-}Lee Heng and
Osama Shana'a and
Guang{-}Kaai Dehng},
title = {An Ultra-Low-Cost High-Performance Bluetooth SoC in 0.11-{\(\mathrm{\mu}\)}m
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2665--2677},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211672},
doi = {10.1109/JSSC.2012.2211672},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/TanSZCYTYGTCKWCHSD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TanakamaruHT12,
author = {Shuhei Tanakamaru and
Chinglin Hung and
Ken Takeuchi},
title = {Highly Reliable and Low Power {SSD} Using Asymmetric Coding and Stripe
Bitline-Pattern Elimination Programming},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {85--96},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170637},
doi = {10.1109/JSSC.2011.2170637},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TanakamaruHT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TangLC12,
author = {Song{-}Nien Tang and
Chi{-}Hsiang Liao and
Tsin{-}Yuan Chang},
title = {An Area- and Energy-Efficient Multimode {FFT} Processor for {WPAN/WLAN/WMAN}
Systems},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1419--1435},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2187406},
doi = {10.1109/JSSC.2012.2187406},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TangLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ThakkarKJFA12,
author = {Chintan Thakkar and
Lingkai Kong and
Kwangmo Jung and
Antoine Frapp{\'{e}} and
Elad Alon},
title = {A 10 Gb/s 45 mW Adaptive 60 GHz Baseband in 65 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {952--968},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2184651},
doi = {10.1109/JSSC.2012.2184651},
timestamp = {Fri, 24 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/ThakkarKJFA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ThanSCZSMCDD12,
author = {Ha Trong Than and
George W. Sun and
Geovanni S. Cuellar and
Jiyang Zeng and
Nate T. Schultz and
Michael E. Moya and
Younkyu Chung and
Blythe C. Deckman and
Michael P. DeLisio},
title = {Design and Performance of a 600-W\emph{C}-Band Amplifier Using Spatially
Combined GaAs FETs for Satellite Communications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2309--2315},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204928},
doi = {10.1109/JSSC.2012.2204928},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ThanSCZSMCDD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TieboutWKSDRKWASJZ12,
author = {Marc Tiebout and
Hans{-}Dieter Wohlmuth and
Herbert Knapp and
Raffaele Salerno and
Michael Druml and
Mirjana Rest and
Johann Kaeferboeck and
Johann Wuertele and
Sherif Sayed Ahmed and
Andreas Schiessl and
Ralf Juenemann and
Anna Zielska},
title = {Low Power Wideband Receiver and Transmitter Chipset for mm-Wave Imaging
in SiGe Bipolar Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1175--1184},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185570},
doi = {10.1109/JSSC.2012.2185570},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TieboutWKSDRKWASJZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TitusK12,
author = {Ward S. Titus and
John G. Kenney},
title = {A 5.6 GHz to 11.5 GHz {DCO} for Digital Dual Loop CDRs},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {5},
pages = {1123--1130},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185572},
doi = {10.1109/JSSC.2012.2185572},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TitusK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ToiflMRRDBPGKBBFM12,
author = {Thomas Toifl and
Christian Menolfi and
Michael Ruegg and
Robert Reutemann and
Daniel Dreps and
Troy J. Beukema and
Andrea Prati and
Daniele Gardellini and
Marcel A. Kossel and
Peter Buchmann and
Matthias Braendli and
Pier Andrea Francese and
Thomas Morf},
title = {A 2.6 mW/Gbps 12.5 Gbps {RX} With 8-Tap Switched-Capacitor {DFE} in
32 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {897--910},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185342},
doi = {10.1109/JSSC.2012.2185342},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ToiflMRRDBPGKBBFM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TomitaSKI12,
author = {Kazutoshi Tomita and
Ryota Shinoda and
Tadahiro Kuroda and
Hiroki Ishikuro},
title = {1-W 3.3-16.3-V Boosting Wireless Power Transfer Circuits With Vector
Summing Power Controller},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2576--2585},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211698},
doi = {10.1109/JSSC.2012.2211698},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TomitaSKI12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TousiMA12,
author = {Yahya M. Tousi and
Omeed Momeni and
Ehsan Afshari},
title = {A Novel {CMOS} High-Power Terahertz {VCO} Based on Coupled Oscillators:
Theory and Implementation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3032--3042},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217853},
doi = {10.1109/JSSC.2012.2217853},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TousiMA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TsengCSCC12,
author = {Chien{-}Jian Tseng and
Hung{-}Wei Chen and
Wei{-}Ting Shen and
Wei{-}Chih Cheng and
Hsin{-}Shu Chen},
title = {A 10-b 320-MS/s Stage-Gain-Error Self-Calibration Pipeline {ADC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1334--1343},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2192655},
doi = {10.1109/JSSC.2012.2192655},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TsengCSCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TuLTLLWHLSJC12,
author = {Ming{-}Hsien Tu and
Jihi{-}Yu Lin and
Ming{-}Chien Tsai and
Chien{-}Yu Lu and
Yuh{-}Jiun Lin and
Meng{-}Hsueh Wang and
Huan{-}Shun Huang and
Kuen{-}Di Lee and
Wei{-}Chiang Shih and
Shyh{-}Jye Jou and
Ching{-}Te Chuang},
title = {A Single-Ended Disturb-Free 9T Subthreshold {SRAM} With Cross-Point
Data-Aware Write Word-Line Structure, Negative Bit-Line, and Adaptive
Read Operation Timing Tracing},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1469--1482},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2187474},
doi = {10.1109/JSSC.2012.2187474},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TuLTLLWHLSJC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/UemuraHKD12,
author = {Shinichiro Uemura and
Yukio Hiraoka and
Takayuki Kai and
Shiro Dosho},
title = {Isolation Techniques Against Substrate Noise Coupling Utilizing Through
Silicon Via {(TSV)} Process for RF/Mixed-Signal SoCs},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {810--816},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185169},
doi = {10.1109/JSSC.2012.2185169},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/UemuraHKD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/VerbruggenIC12,
author = {Bob Verbruggen and
Masao Iriguchi and
Jan Craninckx},
title = {A 1.7 mW 11b 250 MS/s 2-Times Interleaved Fully Dynamic Pipelined
{SAR} {ADC} in 40 nm Digital {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {2880--2887},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2217873},
doi = {10.1109/JSSC.2012.2217873},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/VerbruggenIC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/VercesiFBLC12,
author = {Luca Vercesi and
Luca Fanori and
Fernando De Bernardinis and
Antonio Liscidini and
Rinaldo Castello},
title = {A Dither-Less All Digital {PLL} for Cellular Transmitters},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1908--1920},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197130},
doi = {10.1109/JSSC.2012.2197130},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/VercesiFBLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WanLALH12,
author = {Gordon Wan and
Xiangli Li and
Gennadiy Agranov and
Marc Levoy and
Mark Horowitz},
title = {{CMOS} Image Sensors With Multi-Bucket Pixels for Computational Photography},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {1031--1042},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185189},
doi = {10.1109/JSSC.2012.2185189},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WanLALH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangLH12,
author = {Lei Wang and
Yong Lian and
Chun{-}Huat Heng},
title = {3-5 GHz 4-Channel {UWB} Beamforming Transmitter With 1{\textdegree}
Scanning Resolution Through Calibrated Vernier Delay Line in 0.13-{\(\mathrm{\mu}\)}m
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3145--3159},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216704},
doi = {10.1109/JSSC.2012.2216704},
timestamp = {Thu, 21 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WangLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangM12,
author = {Albert Wang and
Alyosha C. Molnar},
title = {A Light-Field Image Sensor in 180 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {257--271},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2164669},
doi = {10.1109/JSSC.2011.2164669},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WangM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangM12a,
author = {Yikai Wang and
Dongsheng Ma},
title = {A 450-mV Single-Fuel-Cell Power Management Unit With Switch-Mode Quasi-V\({}^{\mbox{2}}\)
Hysteretic Control and Automatic Startup on 0.35-{\(\mathrm{\mu}\)}m
Standard {CMOS} Process},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2216--2226},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197235},
doi = {10.1109/JSSC.2012.2197235},
timestamp = {Thu, 20 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WangM12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangTKGS12,
author = {Alice Wang and
Ken Takeuchi and
Tanay Karnik and
Maysam Ghovanloo and
Satoshi Shigematsu},
title = {Introduction to the Special Issue on the 2011 {IEEE} International
Solid-State Circuits Conference},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {3--7},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2175293},
doi = {10.1109/JSSC.2011.2175293},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WangTKGS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangWHR12,
author = {Yanjie Wang and
Hua Wang and
Chris Hull and
Shmuel Ravid},
title = {A Transformer-Based Broadband Front-End Combo in Standard {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1810--1819},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196314},
doi = {10.1109/JSSC.2012.2196314},
timestamp = {Fri, 23 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WangWHR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WarnockCCWMGSCDBPRPSMMNRH12,
author = {James D. Warnock and
Yiu{-}Hing Chan and
Sean M. Carey and
Huajun Wen and
Patrick J. Meaney and
Guenter Gerwig and
Howard H. Smith and
Yuen H. Chan and
John Davis and
Paul Bunce and
Antonio Pelella and
Daniel Rodko and
Pradip Patel and
Thomas Strach and
Doug Malone and
Frank Malgioglio and
Jos{\'{e}} Neves and
David L. Rude and
William V. Huott},
title = {Circuit and Physical Design Implementation of the Microprocessor Chip
for the zEnterprise System},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {151--163},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2169308},
doi = {10.1109/JSSC.2011.2169308},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WarnockCCWMGSCDBPRPSMMNRH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WeiCCSUMM12,
author = {He Gong Wei and
Chi{-}Hang Chan and
U. Fat Chio and
Sai{-}Weng Sin and
Seng{-}Pan U. and
Rui Paulo Martins and
Franco Maloberti},
title = {An 8-b 400-MS/s 2-b-Per-Cycle {SAR} {ADC} With Resistive {DAC}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2763--2772},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2214181},
doi = {10.1109/JSSC.2012.2214181},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/WeiCCSUMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WelB12,
author = {Arnoud P. van der Wel and
Gerrit den Besten},
title = {A 1.2-6 Gb/s, 4.2 pJ/Bit Clock {\&} Data Recovery Circuit With
High Jitter Tolerance in 0.14 {\(\mathrm{\mu}\)}m {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1768--1775},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191318},
doi = {10.1109/JSSC.2012.2191318},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WelB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WitG12,
author = {Pieter De Wit and
Georges G. E. Gielen},
title = {Degradation-Resilient Design of a Self-Healing xDSL Line Driver in
90 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1757--1767},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191328},
doi = {10.1109/JSSC.2012.2191328},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WitG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WuCHM12,
author = {Rong Wu and
Youngcheol Chae and
Johan H. Huijsing and
Kofi A. A. Makinwa},
title = {A 20-b {\(\pm\)} 40-mV Range Read-Out {IC} With 50-nV Offset and 0.04{\%}
Gain Error for Bridge Transducers},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2152--2163},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2197929},
doi = {10.1109/JSSC.2012.2197929},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WuCHM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/Xu0Y12,
author = {Ruoyu Xu and
Bing Liu and
George Jie Yuan},
title = {Digitally Calibrated 768-kS/s 10-b Minimum-Size {SAR} {ADC} Array
With Dithering},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2129--2140},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2198350},
doi = {10.1109/JSSC.2012.2198350},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/Xu0Y12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/XuLY12,
author = {Ruoyu Xu and
Bing Liu and
George Jie Yuan},
title = {A 1500 fps Highly Sensitive 256 , {\(^\times\)}, 256 {CMOS} Imaging
Sensor With In-Pixel Calibration},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {6},
pages = {1408--1418},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2192662},
doi = {10.1109/JSSC.2012.2192662},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/XuLY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YamamotoC12,
author = {Kentaro Yamamoto and
Anthony Chan Carusone},
title = {A 1-1-1-1 {MASH} Delta-Sigma Modulator With Dynamic Comparator-Based
OTAs},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {8},
pages = {1866--1883},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2196732},
doi = {10.1109/JSSC.2012.2196732},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YamamotoC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YanHKA12,
author = {Jonmei J. Yan and
Chin Hsia and
Donald F. Kimball and
Peter M. Asbeck},
title = {Design of a 4-W Envelope Tracking Power Amplifier With More Than One
Octave Carrier Bandwidth},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2298--2308},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2204927},
doi = {10.1109/JSSC.2012.2204927},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YanHKA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YangYL12,
author = {Zhenglin Yang and
Libin Yao and
Yong Lian},
title = {A 0.5-V 35-{\(\mathrm{\mu}\)}W 85-dB {DR} Double-Sampled {\(\Delta\)}{\(\Sigma\)}
Modulator for Audio Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {722--735},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2181677},
doi = {10.1109/JSSC.2011.2181677},
timestamp = {Thu, 21 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YangYL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YangYM12,
author = {Chia{-}Hsiang Yang and
Tsung{-}Han Yu and
Dejan Markovic},
title = {Power and Area Minimization of Reconfigurable {FFT} Processors: {A}
3GPP-LTE Example},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {3},
pages = {757--768},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2176163},
doi = {10.1109/JSSC.2011.2176163},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YangYM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YenHCCJL12,
author = {Shao{-}Wei Yen and
Shiang{-}Yu Hung and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Shyh{-}Jye Jou and
Chen{-}Yi Lee},
title = {A 5.79-Gb/s Energy-Efficient Multirate {LDPC} Codec Chip for {IEEE}
802.15.3c Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2246--2257},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2194176},
doi = {10.1109/JSSC.2012.2194176},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YenHCCJL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YoonJCKHKHL12,
author = {Dae{-}Young Yoon and
Chang{-}Jin Jeong and
Justin Cartwright and
Ho{-}Yong Kang and
Seok{-}Kyun Han and
Nae{-}Soo Kim and
Dong Sam Ha and
Sang{-}Gug Lee},
title = {A New Approach to Low-Power and Low-Latency Wake-Up Receiver System
for Wireless Sensor Nodes},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2405--2419},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2209778},
doi = {10.1109/JSSC.2012.2209778},
timestamp = {Wed, 02 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/YoonJCKHKHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YoussefZN12,
author = {Shadi Youssef and
Ronan A. R. van der Zee and
Bram Nauta},
title = {Active Feedback Technique for {RF} Channel Selection in Front-End
Receivers},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3130--3144},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216651},
doi = {10.1109/JSSC.2012.2216651},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YoussefZN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YuWKYCSO12,
author = {Chikuang Yu and
Chieh{-}Lin Wu and
Sandeep Kshattry and
Yang{-}Hun Yun and
Choong{-}Yul Cha and
Hisashi Shichijo and
Kenneth K. O},
title = {Compact, High Impedance and Wide Bandwidth Detectors for Characterization
of Millimeter Wave Performance},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {10},
pages = {2335--2343},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2219155},
doi = {10.1109/JSSC.2012.2219155},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YuWKYCSO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YuYCM12,
author = {Tsung{-}Han Yu and
Chia{-}Hsiang Yang and
Danijela Cabric and
Dejan Markovic},
title = {A 7.4-mW 200-MS/s Wideband Spectrum Sensing Digital Baseband Processor
for Cognitive Radios},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2235--2245},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2195933},
doi = {10.1109/JSSC.2012.2195933},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YuYCM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YucetasPKSAH12,
author = {Mikail Y{\"{u}}cetas and
Mika Pulkkinen and
Antti Kalanti and
Jarno Salomaa and
Lasse Aaltonen and
Kari Halonen},
title = {A High-Resolution Accelerometer With Electrostatic Damping and Improved
Supply Sensitivity},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1721--1730},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191675},
doi = {10.1109/JSSC.2012.2191675},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YucetasPKSAH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YuffeMKSKAFLZ12,
author = {Marcelo Yuffe and
Moty Mehalel and
Ernest Knoll and
Joseph Shor and
Tsvika Kurts and
Eran Altshuler and
Eyal Fayneh and
Kosta Luria and
Michael Zelikson},
title = {A Fully Integrated Multi-CPU, Processor Graphics, and Memory Controller
32-nm Processor},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {194--205},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167814},
doi = {10.1109/JSSC.2011.2167814},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YuffeMKSKAFLZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ZakiAZBLRKB12,
author = {Tarek Zaki and
Frederik Ante and
Ute Zschieschang and
Joerg Butschke and
Florian Letzkus and
Harald Richter and
Hagen Klauk and
Joachim N. Burghartz},
title = {A 3.3 {V} 6-Bit 100 kS/s Current-Steering Digital-to-Analog Converter
Using Organic P-Type Thin-Film Transistors on Glass},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {292--300},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2170639},
doi = {10.1109/JSSC.2011.2170639},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ZakiAZBLRKB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ZhangBA12,
author = {Dai Zhang and
Ameya Bhide and
Atila Alvandpour},
title = {A 53-nW 9.1-ENOB 1-kS/s {SAR} {ADC} in 0.13-{\(\mathrm{\mu}\)}m {CMOS}
for Medical Implant Devices},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {7},
pages = {1585--1593},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2191209},
doi = {10.1109/JSSC.2012.2191209},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ZhangBA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ZhaoKR12,
author = {Dixian Zhao and
Shailesh Kulkarni and
Patrick Reynaert},
title = {A 60-GHz Outphasing Transmitter in 40-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3172--3183},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216692},
doi = {10.1109/JSSC.2012.2216692},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ZhaoKR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ZhaoL12,
author = {Yi Zhao and
John R. Long},
title = {A Wideband, Dual-Path, Millimeter-Wave Power Amplifier With 20 dBm
Output Power and {PAE} Above 15{\%} in 130 nm SiGe-BiCMOS},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {1981--1997},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2201275},
doi = {10.1109/JSSC.2012.2201275},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ZhaoL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ZhuCSUMM12,
author = {Yan Zhu and
Chi{-}Hang Chan and
Sai{-}Weng Sin and
Seng{-}Pan U. and
Rui Paulo Martins and
Franco Maloberti},
title = {A 50-fJ 10-b 160-MS/s Pipelined-SAR {ADC} Decoupled Flip-Around {MDAC}
and Self-Embedded Offset Cancellation},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {11},
pages = {2614--2626},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2211695},
doi = {10.1109/JSSC.2012.2211695},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/ZhuCSUMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-05-11 11:32 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
