default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Abraham Jo"
more than 1000 matches, exporting first 1000 hits only!
download as .bib file
@article{DBLP:journals/bspc/HexyJTYVJS25,
author = {Mary Hexy and
Subha Hency Jose and
Abraham Thomas and
R. Yedhukrishna and
Anvin Shaji Varghese and
Noel Francis K. J. and
Eby Sheesh},
title = {Hardware synthesis of closed loop {PID} controlled {L-DOPA} model
for automated drug delivery},
journal = {Biomed. Signal Process. Control.},
volume = {100},
pages = {106840},
year = {2025},
url = {https://doi.org/10.1016/j.bspc.2024.106840},
doi = {10.1016/J.BSPC.2024.106840},
timestamp = {Wed, 02 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bspc/HexyJTYVJS25.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LawoFACPIMO24,
author = {Daniel C. Lawo and
R. Frantz and
Abraham Cano Aguilera and
X. Arnal I Clemente and
M. P. Podles and
Jos{\'{e}} Luis Ima{\~{n}}a and
Idelfonso Tafur Monroy and
J. J. Vegas Olmos},
title = {Falcon/Kyber and Dilithium/Kyber Network Stack on Nvidia's Data Processing
Unit Platform},
journal = {{IEEE} Access},
volume = {12},
pages = {38048--38056},
year = {2024},
url = {https://doi.org/10.1109/ACCESS.2024.3374629},
doi = {10.1109/ACCESS.2024.3374629},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LawoFACPIMO24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SelvamFDNBDK24,
author = {Prabu Selvam and
Muhammad Faheem and
Vidyabharathi Dakshinamurthi and
Akshaj Nevgi and
R. Bhuvaneswari and
K. Deepak and
Joseph Abraham Sundar Koilraj},
title = {Batch Normalization Free Rigorous Feature Flow Neural Network for
Grocery Product Recognition},
journal = {{IEEE} Access},
volume = {12},
pages = {68364--68381},
year = {2024},
url = {https://doi.org/10.1109/ACCESS.2024.3400844},
doi = {10.1109/ACCESS.2024.3400844},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SelvamFDNBDK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/WoubieSA24,
author = {Abraham Woubie and
Enoch Solomon and
Joseph Attieh},
title = {Maintaining Privacy in Face Recognition Using Federated Learning Method},
journal = {{IEEE} Access},
volume = {12},
pages = {39603--39613},
year = {2024},
url = {https://doi.org/10.1109/ACCESS.2024.3373691},
doi = {10.1109/ACCESS.2024.3373691},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/WoubieSA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aci/AbrahamKFKWDP24,
author = {Joanna Abraham and
Madhumitha Kandasamy and
Bradley A. Fritz and
Lisa Konzen and
Jason White and
Anne Drewry and
Christopher Palmer},
title = {Expanding Critical Care Delivery beyond the Intensive Care Unit: Determining
the Design and Implementation Needs for a Tele-Critical Care Consultation
Service},
journal = {Appl. Clin. Inform.},
volume = {15},
number = {1},
pages = {178--191},
year = {2024},
url = {https://doi.org/10.1055/s-0044-1780508},
doi = {10.1055/S-0044-1780508},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aci/AbrahamKFKWDP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/XuSCLFQHWFHNWJBKACTX24,
author = {Chunhui Xu and
Trey Shaw and
Sai Akhil Choppararu and
Yiwei Lu and
Shaik Naveed Farooq and
Yongfang Qin and
Matt Hudson and
Brock Weekley and
Michael Fisher and
Fei He and
Jose Roberto Da Silva Nascimento and
Nicholas Wergeles and
Trupti Joshi and
Philip D. Bates and
Abraham J. Koo and
Doug K. Allen and
Edgar B. Cahoon and
Jay J. Thelen and
Dong Xu},
title = {FatPlants: a comprehensive information system for lipid-related genes
and metabolic pathways in plants},
journal = {Database J. Biol. Databases Curation},
volume = {2024},
year = {2024},
url = {https://doi.org/10.1093/database/baae074},
doi = {10.1093/DATABASE/BAAE074},
timestamp = {Sun, 08 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodb/XuSCLFQHWFHNWJBKACTX24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/AlonsoFernandezBFDPR24,
author = {Fernando Alonso{-}Fernandez and
Josef Big{\"{u}}n and
Julian Fi{\'{e}}rrez and
Naser Damer and
Hugo Proen{\c{c}}a and
Arun Ross},
title = {Periocular Biometrics: {A} Modality for Unconstrained Scenarios},
journal = {Computer},
volume = {57},
number = {6},
pages = {40--49},
year = {2024},
url = {https://doi.org/10.1109/MC.2023.3298095},
doi = {10.1109/MC.2023.3298095},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/AlonsoFernandezBFDPR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/ParkDBGF24,
author = {Jong Hoon Park and
Gauri Pramod Dalwankar and
Alison Bartsch and
Abraham George and
Amir Barati Farimani},
title = {Fluid viscosity prediction leveraging computer vision and robot interaction},
journal = {Eng. Appl. Artif. Intell.},
volume = {135},
pages = {108603},
year = {2024},
url = {https://doi.org/10.1016/j.engappai.2024.108603},
doi = {10.1016/J.ENGAPPAI.2024.108603},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eaai/ParkDBGF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ec/Martin-Santamaria24,
author = {Ra{\'{u}}l Mart{\'{\i}}n{-}Santamar{\'{\i}}a and
Sergio Cavero and
Alberto Herr{\'{a}}n and
Abraham Duarte and
J. Manuel Colmenar},
title = {A Practical Methodology for Reproducible Experimentation: An Application
to the Double-Row Facility Layout Problem},
journal = {Evol. Comput.},
volume = {32},
number = {1},
pages = {69--104},
year = {2024},
url = {https://doi.org/10.1162/evco\_a\_00317},
doi = {10.1162/EVCO\_A\_00317},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ec/Martin-Santamaria24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/LeeRS24,
author = {Jong Youl Lee and
Balaraman Rajan and
Abraham Seidmann},
title = {Optimal location of remote dental units},
journal = {Eur. J. Oper. Res.},
volume = {312},
number = {3},
pages = {969--977},
year = {2024},
url = {https://doi.org/10.1016/j.ejor.2023.07.025},
doi = {10.1016/J.EJOR.2023.07.025},
timestamp = {Fri, 08 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/LeeRS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/BogaleDAWMATHB24,
author = {Tariku Nigatu Bogale and
Lemma Derseh and
Loko Abraham and
Herman Jozef Willems and
Jonathan Metzger and
Biruhtesfa Abere and
Mesfin Tilaye and
Tewodros Hailegeberel and
Tadesse Alemu Bekele},
title = {Effect of electronic records on mortality among patients in hospital
and primary healthcare settings: a systematic review and meta-analyses},
journal = {Frontiers Digit. Health},
volume = {6},
year = {2024},
url = {https://doi.org/10.3389/fdgth.2024.1377826},
doi = {10.3389/FDGTH.2024.1377826},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/BogaleDAWMATHB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fi/LawoBACIMO24,
author = {Daniel C. Lawo and
Rana Abu Bakar and
Abraham Cano Aguilera and
Filippo Cugini and
Jos{\'{e}} Luis Ima{\~{n}}a and
Idelfonso Tafur Monroy and
Juan Jose Vegas Olmos},
title = {Wireless and Fiber-Based Post-Quantum-Cryptography-Secured IPsec Tunnel},
journal = {Future Internet},
volume = {16},
number = {8},
pages = {300},
year = {2024},
url = {https://doi.org/10.3390/fi16080300},
doi = {10.3390/FI16080300},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fi/LawoBACIMO24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fmsd/JungesAHJKQV24,
author = {Sebastian Junges and
Erika {\'{A}}brah{\'{a}}m and
Christian Hensel and
Nils Jansen and
Joost{-}Pieter Katoen and
Tim Quatmann and
Matthias Volk},
title = {Parameter synthesis for Markov models: covering the parameter space},
journal = {Formal Methods Syst. Des.},
volume = {62},
number = {1},
pages = {181--259},
year = {2024},
url = {https://doi.org/10.1007/s10703-023-00442-x},
doi = {10.1007/S10703-023-00442-X},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fmsd/JungesAHJKQV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijimai/BobadillaDOG24,
author = {Jes{\'{u}}s Bobadilla and
Jorge Due{\~{n}}as{-}Ler{\'{\i}}n and
Fernando Ortega and
Abraham Guti{\'{e}}rrez},
title = {Comprehensive Evaluation of Matrix Factorization Models for Collaborative
Filtering Recommender Systems},
journal = {Int. J. Interact. Multim. Artif. Intell.},
volume = {8},
number = {6},
pages = {15},
year = {2024},
url = {https://doi.org/10.9781/ijimai.2023.04.008},
doi = {10.9781/IJIMAI.2023.04.008},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijimai/BobadillaDOG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/WhiteheadSCBMB24,
author = {Thomas M. Whitehead and
Joel Strickland and
Gareth John Conduit and
Alexandre Borrel and
Daniel Mucs and
Irene Baskerville{-}Abraham},
title = {Quantifying the Benefits of Imputation over {QSAR} Methods in Toxicology
Data Modeling},
journal = {J. Chem. Inf. Model.},
volume = {64},
number = {7},
pages = {2624--2636},
year = {2024},
url = {https://doi.org/10.1021/acs.jcim.3c01695},
doi = {10.1021/ACS.JCIM.3C01695},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/WhiteheadSCBMB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgt/FrancisIJR24,
author = {P. Francis and
Abraham M. Illickan and
Lijo M. Jose and
Deepak Rajendraprasad},
title = {Disjoint total dominating sets in near-triangulations},
journal = {J. Graph Theory},
volume = {105},
number = {1},
pages = {68--77},
year = {2024},
url = {https://doi.org/10.1002/jgt.23014},
doi = {10.1002/JGT.23014},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jgt/FrancisIJR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/LavanyaSS24,
author = {M. Lavanya and
K. Joseph Abraham Sundar and
S. Saravanan},
title = {Simplified Image Encryption Algorithm {(SIEA)} to enhance image security
in cloud storage},
journal = {Multim. Tools Appl.},
volume = {83},
number = {22},
pages = {61313--61345},
year = {2024},
url = {https://doi.org/10.1007/s11042-023-17969-0},
doi = {10.1007/S11042-023-17969-0},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/LavanyaSS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/saem/PengSABM24,
author = {Guicang Peng and
Jon T{\o}mmer{\aa}s Selvik and
Eirik Bjorheim Abrahamsen and
Knut Erik Bang and
Tore Markeset},
title = {Integrating structure time series forecasting and multicriteria decision
analysis for adaptive operational risk assessment: an empirical study
using real-time data},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {15},
number = {7},
pages = {3162--3181},
year = {2024},
url = {https://doi.org/10.1007/s13198-024-02322-x},
doi = {10.1007/S13198-024-02322-X},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/saem/PengSABM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/CanoPerezGPPPTVGMESR24,
author = {Jos{\'{e}} Luis Cano{-}Perez and
Jaime Guti{\'{e}}rrez{-}Guti{\'{e}}rrez and
Christian Perezcampos{-}Mayoral and
Eduardo L. P{\'{e}}rez{-}Campos and
Mar{\'{\i}}a del Socorro Pina{-}Canseco and
Lorenzo Tepech{-}Carrillo and
Marciano Vargas{-}Trevi{\~{n}}o and
Erick Israel Guerra{-}Hernandez and
Abraham Mart{\'{\i}}nez{-}Helmes and
Juli{\'{a}}n Mois{\'{e}}s Estudillo{-}Ayala and
Juan Manuel Sierra{-}Hern{\'{a}}ndez and
Roberto Rojas{-}Laguna},
title = {Experimental Study of White Light Interferometry in Mach-Zehnder Interferometers
Based on Standard Single Mode Fiber},
journal = {Sensors},
volume = {24},
number = {10},
pages = {3026},
year = {2024},
url = {https://doi.org/10.3390/s24103026},
doi = {10.3390/S24103026},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/CanoPerezGPPPTVGMESR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/NguyenDucKLGWZMMGKHESCRKAMGA24,
author = {Anh Nguyen{-}Duc and
Dron Khanna and
Giang Huong Le and
Des Greer and
Xiaofeng Wang and
Luciana Martinez Zaina and
Gerardo Matturro and
Jorge Melegati and
Eduardo Martins Guerra and
Petri Kettunen and
Sami Hyrynsalmi and
Henry Edison and
Afonso Sales and
Rafael Chanin and
Didzis Rutitis and
Kai{-}Kristian Kemell and
Abdullah Aldaeej and
Tommi Mikkonen and
Juan Garbajosa and
Pekka Abrahamsson},
title = {Work-from-home impacts on software project: {A} global study on software
development practices and stakeholder perceptions},
journal = {Softw. Pract. Exp.},
volume = {54},
number = {5},
pages = {896--926},
year = {2024},
url = {https://doi.org/10.1002/spe.3306},
doi = {10.1002/SPE.3306},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spe/NguyenDucKLGWZMMGKHESCRKAMGA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/WuASLPLPKMC24,
author = {Jiajia Wu and
Abraham Akinin and
Jonathan Somayajulu and
Min Suk Lee and
Akshay Paul and
Hongyu Lu and
Yongjae Park and
Seong{-}Jin Kim and
Patrick P. Mercier and
Gert Cauwenberghs},
title = {A Low-Noise Low-Power 0.001Hz-1kHz Neural Recording System-on-Chip
With Sample-Level Duty-Cycling},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {18},
number = {2},
pages = {263--273},
year = {2024},
url = {https://doi.org/10.1109/TBCAS.2024.3368068},
doi = {10.1109/TBCAS.2024.3368068},
timestamp = {Thu, 08 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/WuASLPLPKMC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AguirreVAPKLF24,
author = {Matias Aguirre and
Sergio Vazquez and
Abraham Marquez Alcaide and
Ram{\'{o}}n C. Portillo and
Samir Kouro and
Jos{\'{e}} I. Leon and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Period Control Approach Finite Control Set Model Predictive Control
Switching Phase Control for Interleaved {DC/DC} Converters},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {8},
pages = {8304--8312},
year = {2024},
url = {https://doi.org/10.1109/TIE.2023.3325548},
doi = {10.1109/TIE.2023.3325548},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/AguirreVAPKLF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AlcaideMRBLLF24,
author = {Abraham Marquez Alcaide and
Vito Giuseppe Monopoli and
Giuseppe Rendine and
Lara Bruno and
Jos{\'{e}} I. Leon and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Extremely Low Frequency {PS-PWM} Based Technique for Cascaded H-Bridge
Converters With Grid Voltage Compensation Capability},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {4},
pages = {3242--3252},
year = {2024},
url = {https://doi.org/10.1109/TIE.2023.3274870},
doi = {10.1109/TIE.2023.3274870},
timestamp = {Thu, 09 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/AlcaideMRBLLF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AlcaidePVALKF24,
author = {Abraham Marquez Alcaide and
Pablo Poblete and
Sergio Vazquez and
Ricardo P. Aguilera and
Jos{\'{e}} I. Leon and
Samir Kouro and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Generalized Feed-Forward Sampling Method for Multilevel Cascaded H-Bridge
Converters},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {8},
pages = {8259--8267},
year = {2024},
url = {https://doi.org/10.1109/TIE.2023.3319737},
doi = {10.1109/TIE.2023.3319737},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/AlcaidePVALKF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MonopoliABRLLF24,
author = {Vito Giuseppe Monopoli and
Abraham Marquez Alcaide and
Lara Bruno and
Giuseppe Rendine and
Jos{\'{e}} I. Leon and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {A Hybrid Modulation Technique for Operating Medium-Voltage High-Power
{CHB} Converters Under Grid Voltage Disturbances},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {1},
pages = {462--472},
year = {2024},
url = {https://doi.org/10.1109/TIE.2023.3241246},
doi = {10.1109/TIE.2023.3241246},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/MonopoliABRLLF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/PobleteGCAPLA24,
author = {Pablo Poblete and
Jos{\'{e}} Gajardo and
Rodrigo H. Cuzmar and
Ricardo P. Aguilera and
Javier Pereda and
Dylan Dah{-}Chuan Lu and
Abraham Marquez Alcaide},
title = {Predictive Optimal Variable-Angle {PS-PWM} Strategy for Cascaded H-Bridge
Converters},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {11},
pages = {13556--13566},
year = {2024},
url = {https://doi.org/10.1109/TIE.2024.3370998},
doi = {10.1109/TIE.2024.3370998},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/PobleteGCAPLA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ZafraGLVALF24,
author = {Eduardo Zafra and
Joaqu{\'{\i}}n Granado and
Vicente Baena Lecuyer and
Sergio Vazquez and
Abraham Marquez Alcaide and
Jos{\'{e}} I. Leon and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Computationally Efficient Sphere Decoding Algorithm Based on Artificial
Neural Networks for Long-Horizon {FCS-MPC}},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {1},
pages = {39--48},
year = {2024},
url = {https://doi.org/10.1109/TIE.2023.3243301},
doi = {10.1109/TIE.2023.3243301},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/ZafraGLVALF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ZafraVALF24,
author = {Eduardo Zafra and
Sergio Vazquez and
Abraham Marquez Alcaide and
Jos{\'{e}} I. Leon and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Alternate Search Pattern for Parallel Sphere Decoder in Long Prediction
Horizon {FCS-MPC}},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {7},
pages = {8185--8189},
year = {2024},
url = {https://doi.org/10.1109/TIE.2023.3312421},
doi = {10.1109/TIE.2023.3312421},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/ZafraVALF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/LinSYLVALWF24,
author = {Hao Lin and
Xiaoning Shen and
Yunfei Yin and
Jianxing Liu and
Sergio Vazquez and
Abraham Marquez Alcaide and
Jos{\'{e}} I. Leon and
Ligang Wu and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Sliding Mode Control for {NPC} Converters via a Dual Layer Nested
Adaptive Tuning Technique},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {20},
number = {9},
pages = {11418--11428},
year = {2024},
url = {https://doi.org/10.1109/TII.2024.3399910},
doi = {10.1109/TII.2024.3399910},
timestamp = {Thu, 03 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tii/LinSYLVALWF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arc/AdhikaryBBBDMMPRSSVZ24,
author = {Asmita Adhikary and
Abraham Basurto and
Lejla Batina and
Ileana Buhan and
Joan Daemen and
Silvia Mella and
Nele Mentens and
Stjepan Picek and
Durga Lakshmi Ramachandran and
Abolfazl Sajadi and
Todor Stefanov and
Dennis Vermoen and
Nusa Zidaric},
editor = {Iouliia Skliarova and
Piedad Brox Jim{\'{e}}nez and
M{\'{a}}rio P. V{\'{e}}stias and
Pedro C. Diniz},
title = {{PROACT} - Physical Attack Resistance of Cryptographic Algorithms
and Circuits with Reduced Time to Market},
booktitle = {Applied Reconfigurable Computing. Architectures, Tools, and Applications
- 20th International Symposium, {ARC} 2024, Aveiro, Portugal, March
20-22, 2024, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {14553},
pages = {255--266},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-55673-9\_18},
doi = {10.1007/978-3-031-55673-9\_18},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/arc/AdhikaryBBBDMMPRSSVZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bioma/MartinSantamariaHDC24,
author = {Ra{\'{u}}l Mart{\'{\i}}n{-}Santamar{\'{\i}}a and
Alberto Herr{\'{a}}n and
Abraham Duarte and
J. Manuel Colmenar},
editor = {Marc Sevaux and
Alexandru{-}Liviu Olteanu and
Eduardo G. Pardo and
Angelo Sifaleras and
Salma Makboul},
title = {An Efficient Algorithm for the T-Row Facility Layout Problem},
booktitle = {Metaheuristics - 15th International Conference, {MIC} 2024, Lorient,
France, June 4-7, 2024, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14753},
pages = {309--315},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-62912-9\_29},
doi = {10.1007/978-3-031-62912-9\_29},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bioma/MartinSantamariaHDC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bioma/SalazarDC24,
author = {S{\'{e}}rgio Salazar and
Abraham Duarte and
J. Manuel Colmenar},
editor = {Marc Sevaux and
Alexandru{-}Liviu Olteanu and
Eduardo G. Pardo and
Angelo Sifaleras and
Salma Makboul},
title = {A Basic Variable Neighborhood Search for the Planar Obnoxious Facility
Location Problem},
booktitle = {Metaheuristics - 15th International Conference, {MIC} 2024, Lorient,
France, June 4-7, 2024, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14753},
pages = {359--364},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-62912-9\_33},
doi = {10.1007/978-3-031-62912-9\_33},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bioma/SalazarDC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/KyiMSRB24,
author = {Lin Kyi and
Abraham Mhaidli and
Cristiana Teixeira Santos and
Franziska Roesner and
Asia J. Biega},
editor = {Florian 'Floyd' Mueller and
Penny Kyburz and
Julie R. Williamson and
Corina Sas and
Max L. Wilson and
Phoebe O. Toups Dugas and
Irina Shklovski},
title = {"It doesn't tell me anything about how my data is used": User Perceptions
of Data Collection Purposes},
booktitle = {Proceedings of the {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2024, Honolulu, HI, USA, May 11-16, 2024},
pages = {984:1--984:12},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3613904.3642260},
doi = {10.1145/3613904.3642260},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/KyiMSRB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/RamVGBKV24,
author = {Sriram Ram and
Shashaank Vinoth and
Rahul Natesh Gopalakrishnan and
Aastick Amirteswar Balakumar and
Lekshmi Kalinathan and
Thomas Abraham Joseph Velankanni},
editor = {Guglielmo Faggioli and
Nicola Ferro and
Petra Galusc{\'{a}}kov{\'{a}} and
Alba Garc{\'{\i}}a Seco de Herrera},
title = {Leveraging Diverse {CNN} Architectures for Medical Image Captioning:
DenseNet-121, MobileNetV2, and ResNet-50 in ImageCLEF 2024},
booktitle = {Working Notes of the Conference and Labs of the Evaluation Forum {(CLEF}
2024), Grenoble, France, 9-12 September, 2024},
series = {{CEUR} Workshop Proceedings},
volume = {3740},
pages = {1720--1728},
publisher = {CEUR-WS.org},
year = {2024},
url = {https://ceur-ws.org/Vol-3740/paper-160.pdf},
timestamp = {Wed, 21 Aug 2024 22:46:00 +0200},
biburl = {https://dblp.org/rec/conf/clef/RamVGBKV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/educon/GuillenGCGPFG24,
author = {Gloria Alicia Chapa Guillen and
David G{\"{u}}emes{-}Castorena and
Azael Capetillo and
Jose Alfredo Galvan Galvan and
Abraham Tijerina Priego and
Lilia Gomez Flores and
Daniel Guajardo{-}Flores},
title = {Implementing the Lean Launchpad Methodology in Higher Education: Challenges,
Insights, and the Role of Mentorship},
booktitle = {{IEEE} Global Engineering Education Conference, {EDUCON} 2024, Kos
Island, Greece, May 8-11, 2024},
pages = {1--10},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/EDUCON60312.2024.10578785},
doi = {10.1109/EDUCON60312.2024.10578785},
timestamp = {Thu, 18 Jul 2024 16:56:13 +0200},
biburl = {https://dblp.org/rec/conf/educon/GuillenGCGPFG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esa/AbrahamsenB0K024,
author = {Mikkel Abrahamsen and
Ioana O. Bercea and
Lorenzo Beretta and
Jonas Klausen and
L{\'{a}}szl{\'{o}} Kozma},
editor = {Timothy Chan and
Johannes Fischer and
John Iacono and
Grzegorz Herman},
title = {Online Sorting and Online {TSP:} Randomized, Stochastic, and High-Dimensional},
booktitle = {32nd Annual European Symposium on Algorithms, {ESA} 2024, September
2-4, 2024, Royal Holloway, London, United Kingdom},
series = {LIPIcs},
volume = {308},
pages = {5:1--5:15},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2024},
url = {https://doi.org/10.4230/LIPIcs.ESA.2024.5},
doi = {10.4230/LIPICS.ESA.2024.5},
timestamp = {Tue, 24 Sep 2024 17:19:50 +0200},
biburl = {https://dblp.org/rec/conf/esa/AbrahamsenB0K024.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icann/BermanAY24,
author = {Josef Berman and
Yehudit Aperstein and
Abraham Yosipof},
editor = {Michael Wand and
Krist{\'{\i}}na Malinovsk{\'{a}} and
J{\"{u}}rgen Schmidhuber and
Igor V. Tetko},
title = {Elucidation of Molecular Substructures from Nuclear Magnetic Resonance
Spectra Using Gradient Boosting},
booktitle = {Artificial Neural Networks and Machine Learning - {ICANN} 2024 - 33rd
International Conference on Artificial Neural Networks, Lugano, Switzerland,
September 17-20, 2024, Proceedings, Part {X}},
series = {Lecture Notes in Computer Science},
volume = {15025},
pages = {31--42},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-72359-9\_3},
doi = {10.1007/978-3-031-72359-9\_3},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icann/BermanAY24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/BaraiFK24,
author = {Joyeeta Rani Barai and
Abraham O. Fapojuwo and
Diwakar Krishnamurthy},
title = {Optimization of {B5G} Network Slicing for Smart Cities Applications
Using the {MGBFS} Algorithm},
booktitle = {{IEEE} International Conference on Communications, {ICC} 2024, Denver,
CO, USA, June 9-13, 2024},
pages = {2330--2335},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICC51166.2024.10622774},
doi = {10.1109/ICC51166.2024.10622774},
timestamp = {Mon, 02 Sep 2024 15:04:36 +0200},
biburl = {https://dblp.org/rec/conf/icc/BaraiFK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ScottiT0KCNSXNN24,
author = {Paul S. Scotti and
Mihir Tripathy and
Cesar Torrico and
Reese Kneeland and
Tong Chen and
Ashutosh Narang and
Charan Santhirasegaran and
Jonathan Xu and
Thomas Naselaris and
Kenneth A. Norman and
Tanishq Mathew Abraham},
title = {MindEye2: Shared-Subject Models Enable fMRI-To-Image With 1 Hour of
Data},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=65XKBGH5PO},
timestamp = {Mon, 02 Sep 2024 16:45:29 +0200},
biburl = {https://dblp.org/rec/conf/icml/ScottiT0KCNSXNN24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ONeillRMGPLPGMJ24,
author = {Abby O'Neill and
Abdul Rehman and
Abhiram Maddukuri and
Abhishek Gupta and
Abhishek Padalkar and
Abraham Lee and
Acorn Pooley and
Agrim Gupta and
Ajay Mandlekar and
Ajinkya Jain and
Albert Tung and
Alex Bewley and
Alexander Herzog and
Alex Irpan and
Alexander Khazatsky and
Anant Rai and
Anchit Gupta and
Andrew Wang and
Anikait Singh and
Animesh Garg and
Aniruddha Kembhavi and
Annie Xie and
Anthony Brohan and
Antonin Raffin and
Archit Sharma and
Arefeh Yavary and
Arhan Jain and
Ashwin Balakrishna and
Ayzaan Wahid and
Ben Burgess{-}Limerick and
Beomjoon Kim and
Bernhard Sch{\"{o}}lkopf and
Blake Wulfe and
Brian Ichter and
Cewu Lu and
Charles Xu and
Charlotte Le and
Chelsea Finn and
Chen Wang and
Chenfeng Xu and
Cheng Chi and
Chenguang Huang and
Christine Chan and
Christopher Agia and
Chuer Pan and
Chuyuan Fu and
Coline Devin and
Danfei Xu and
Daniel Morton and
Danny Driess and
Daphne Chen and
Deepak Pathak and
Dhruv Shah and
Dieter B{\"{u}}chler and
Dinesh Jayaraman and
Dmitry Kalashnikov and
Dorsa Sadigh and
Edward Johns and
Ethan Paul Foster and
Fangchen Liu and
Federico Ceola and
Fei Xia and
Feiyu Zhao and
Freek Stulp and
Gaoyue Zhou and
Gaurav S. Sukhatme and
Gautam Salhotra and
Ge Yan and
Gilbert Feng and
Giulio Schiavi and
Glen Berseth and
Gregory Kahn and
Guanzhi Wang and
Hao Su and
Haoshu Fang and
Haochen Shi and
Henghui Bao and
Heni Ben Amor and
Henrik I. Christensen and
Hiroki Furuta and
Homer Walke and
Hongjie Fang and
Huy Ha and
Igor Mordatch and
Ilija Radosavovic and
Isabel Leal and
Jacky Liang and
Jad Abou{-}Chakra and
Jaehyung Kim and
Jaimyn Drake and
Jan Peters and
Jan Schneider and
Jasmine Hsu and
Jeannette Bohg and
Jeffrey Bingham and
Jeffrey Wu and
Jensen Gao and
Jiaheng Hu and
Jiajun Wu and
Jialin Wu and
Jiankai Sun and
Jianlan Luo and
Jiayuan Gu and
Jie Tan and
Jihoon Oh and
Jimmy Wu and
Jingpei Lu and
Jingyun Yang and
Jitendra Malik and
Jo{\~{a}}o Silv{\'{e}}rio and
Joey Hejna and
Jonathan Booher and
Jonathan Tompson and
Jonathan Yang and
Jordi Salvador and
Joseph J. Lim and
Junhyek Han and
Kaiyuan Wang and
Kanishka Rao and
Karl Pertsch and
Karol Hausman and
Keegan Go and
Keerthana Gopalakrishnan and
Ken Goldberg and
Kendra Byrne and
Kenneth Oslund and
Kento Kawaharazuka and
Kevin Black and
Kevin Lin and
Kevin Zhang and
Kiana Ehsani and
Kiran Lekkala and
Kirsty Ellis and
Krishan Rana and
Krishnan Srinivasan and
Kuan Fang and
Kunal Pratap Singh and
Kuo{-}Hao Zeng and
Kyle Hatch and
Kyle Hsu and
Laurent Itti and
Lawrence Yunliang Chen and
Lerrel Pinto and
Li Fei{-}Fei and
Liam Tan and
Linxi Jim Fan and
Lionel Ott and
Lisa Lee and
Luca Weihs and
Magnum Chen and
Marion Lepert and
Marius Memmel and
Masayoshi Tomizuka and
Masha Itkina and
Mateo Guaman Castro and
Max Spero and
Maximilian Du and
Michael Ahn and
Michael C. Yip and
Mingtong Zhang and
Mingyu Ding and
Minho Heo and
Mohan Kumar Srirama and
Mohit Sharma and
Moo Jin Kim and
Naoaki Kanazawa and
Nicklas Hansen and
Nicolas Heess and
Nikhil J. Joshi and
Niko S{\"{u}}nderhauf and
Ning Liu and
Norman Di Palo and
Nur Muhammad (Mahi) Shafiullah and
Oier Mees and
Oliver Kroemer and
Osbert Bastani and
Pannag R. Sanketi and
Patrick Tree Miller and
Patrick Yin and
Paul Wohlhart and
Peng Xu and
Peter David Fagan and
Peter Mitrano and
Pierre Sermanet and
Pieter Abbeel and
Priya Sundaresan and
Qiuyu Chen and
Quan Vuong and
Rafael Rafailov and
Ran Tian and
Ria Doshi and
Roberto Mart{\'{\i}}n{-}Mart{\'{\i}}n and
Rohan Baijal and
Rosario Scalise and
Rose Hendrix and
Roy Lin and
Runjia Qian and
Ruohan Zhang and
Russell Mendonca and
Rutav Shah and
Ryan Hoque and
Ryan Julian and
Samuel Bustamante and
Sean Kirmani and
Sergey Levine and
Shan Lin and
Sherry Moore and
Shikhar Bahl and
Shivin Dass and
Shubham D. Sonawani and
Shuran Song and
Sichun Xu and
Siddhant Haldar and
Siddharth Karamcheti and
Simeon Adebola and
Simon Guist and
Soroush Nasiriany and
Stefan Schaal and
Stefan Welker and
Stephen Tian and
Subramanian Ramamoorthy and
Sudeep Dasari and
Suneel Belkhale and
Sungjae Park and
Suraj Nair and
Suvir Mirchandani and
Takayuki Osa and
Tanmay Gupta and
Tatsuya Harada and
Tatsuya Matsushima and
Ted Xiao and
Thomas Kollar and
Tianhe Yu and
Tianli Ding and
Todor Davchev and
Tony Z. Zhao and
Travis Armstrong and
Trevor Darrell and
Trinity Chung and
Vidhi Jain and
Vincent Vanhoucke and
Wei Zhan and
Wenxuan Zhou and
Wolfram Burgard and
Xi Chen and
Xiaolong Wang and
Xinghao Zhu and
Xinyang Geng and
Xiyuan Liu and
Liangwei Xu and
Xuanlin Li and
Yao Lu and
Yecheng Jason Ma and
Yejin Kim and
Yevgen Chebotar and
Yifan Zhou and
Yifeng Zhu and
Yilin Wu and
Ying Xu and
Yixuan Wang and
Yonatan Bisk and
Yoonyoung Cho and
Youngwoon Lee and
Yuchen Cui and
Yue Cao and
Yueh{-}Hua Wu and
Yujin Tang and
Yuke Zhu and
Yunchu Zhang and
Yunfan Jiang and
Yunshuang Li and
Yunzhu Li and
Yusuke Iwasawa and
Yutaka Matsuo and
Zehan Ma and
Zhuo Xu and
Zichen Jeff Cui and
Zichen Zhang and
Zipeng Lin},
title = {Open X-Embodiment: Robotic Learning Datasets and {RT-X} Models : Open
X-Embodiment Collaboration},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2024, Yokohama, Japan, May 13-17, 2024},
pages = {6892--6903},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICRA57147.2024.10611477},
doi = {10.1109/ICRA57147.2024.10611477},
timestamp = {Tue, 20 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/ONeillRMGPLPGMJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/VallejoAldanaRCYCCRT24,
author = {Daniel Vallejo{-}Aldana and
Alonso Ramirez{-}Manzanares and
Erick Jorge Canales{-}Rodr{\'{\i}}guez and
Thomas Yu and
Abraham Cisneros{-}Mejorado and
Luis Concha and
Jonathan Rafael{-}Patino and
Jean{-}Philippe Thiran},
title = {In-Silico Trained {AI} for Enhanced {T2} Spectrum Imaging and Myelin
Water Fraction Mapping in Preclinical 7T {MRI}},
booktitle = {{IEEE} International Symposium on Biomedical Imaging, {ISBI} 2024,
Athens, Greece, May 27-30, 2024},
pages = {1--5},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISBI56570.2024.10635246},
doi = {10.1109/ISBI56570.2024.10635246},
timestamp = {Fri, 06 Sep 2024 21:02:06 +0200},
biburl = {https://dblp.org/rec/conf/isbi/VallejoAldanaRCYCCRT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/WhangboLZAGGKKNSA24,
author = {Joonho Whangbo and
Edwin Lim and
Chengyi Lux Zhang and
Kevin Anderson and
Abraham Gonzalez and
Raghav Gupta and
Nivedha Krishnakumar and
Sagar Karandikar and
Borivoje Nikolic and
Yakun Sophia Shao and
Krste Asanovic},
title = {FireAxe: Partitioned FPGA-Accelerated Simulation of Large-Scale {RTL}
Designs},
booktitle = {51st {ACM/IEEE} Annual International Symposium on Computer Architecture,
{ISCA} 2024, Buenos Aires, Argentina, June 29 - July 3, 2024},
pages = {501--515},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISCA59077.2024.00044},
doi = {10.1109/ISCA59077.2024.00044},
timestamp = {Fri, 16 Aug 2024 20:48:15 +0200},
biburl = {https://dblp.org/rec/conf/isca/WhangboLZAGGKKNSA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/Li0ZL0F24,
author = {Shuhao Li and
Wensheng Luo and
Ruifang Zhang and
Jos{\'{e}} I. Leon and
Abraham Marquez and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Improved Sliding Mode Control Strategy Based on Photovoltaic-Energy
Storage Virtual Synchronous Generator System},
booktitle = {33rd {IEEE} International Symposium on Industrial Electronics, {ISIE}
2024, Ulsan, Republic of Korea, June 18-21, 2024},
pages = {1--6},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISIE54533.2024.10595808},
doi = {10.1109/ISIE54533.2024.10595808},
timestamp = {Tue, 24 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isie/Li0ZL0F24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/Shi0ZL0F24,
author = {Tingyu Shi and
Wensheng Luo and
Ruifang Zhang and
Jos{\'{e}} I. Leon and
Abraham Marquez and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Microgrid Secondary Control Design Based on Second-Order Sliding Mode
Algorithm},
booktitle = {33rd {IEEE} International Symposium on Industrial Electronics, {ISIE}
2024, Ulsan, Republic of Korea, June 18-21, 2024},
pages = {1--6},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISIE54533.2024.10595711},
doi = {10.1109/ISIE54533.2024.10595711},
timestamp = {Tue, 24 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isie/Shi0ZL0F24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mipro/SillbergGSNJRA24,
author = {Pekka Sillberg and
Jere Gr{\"{o}}nman and
Mika Saari and
Mikko Nurminen and
T. J{\"{o}}nkk{\"{a}}ri and
Petri Rantanen and
Pekka Abrahamsson},
editor = {Snjezana Babic and
Zeljka Car and
Marina Cicin{-}Sain and
Dragan Cisic and
Pavel Ergovic and
Tihana Galinac Grbac and
Vera Gradisnik and
Stjepan Gros and
Andrej Jokic and
Alan Jovic and
Darko Jurekovic and
Tihomir Katulic and
Marko Koricic and
Vedran Mornar and
Juraj Petrovic and
Karolj Skala and
Dejan Skvorc and
Vlado Sruk and
Marko Svaco and
Edvard Tijan and
Neven Vrcek and
Boris Vrdoljak},
title = {Digital Twin Coffee Room Application - Kahvibotti},
booktitle = {47th {MIPRO} {ICT} and Electronics Convention, {MIPRO} 2024, Opatija,
Croatia, May 20-24, 2024},
pages = {887--891},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/MIPRO60963.2024.10569396},
doi = {10.1109/MIPRO60963.2024.10569396},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mipro/SillbergGSNJRA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/AguileraBAGIMCO24,
author = {Abraham Cano Aguilera and
Rana Abu Bakar and
Faris Alhamed and
Carlos Rubio Garcia and
Jos{\'{e}} Luis Ima{\~{n}}a and
Idelfonso Tafur Monroy and
Filippo Cugini and
J. J. Vegas Olmos},
title = {First Line-rate End-to-End Post-Quantum Encrypted Optical Fiber Link
Using Data Processing Units (DPUs)},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2024,
San Diego, CA, USA, March 24-28, 2024},
pages = {1--3},
publisher = {{IEEE}},
year = {2024},
url = {https://ieeexplore.ieee.org/document/10526974},
timestamp = {Thu, 06 Jun 2024 22:22:55 +0200},
biburl = {https://dblp.org/rec/conf/ofc/AguileraBAGIMCO24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/GarciaCORM24,
author = {Carlos Rubio Garcia and
Abraham Cano Aguilera and
J. J. Vegas Olmos and
Simon Rommel and
Idelfonso Tafur Monroy},
title = {Integrating Quantum Key Distribution into {TLS} 1.3: {A} Transport
Layer Approach to Quantum-Resistant Communications in Optical Networks},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2024,
San Diego, CA, USA, March 24-28, 2024},
pages = {1--3},
publisher = {{IEEE}},
year = {2024},
url = {https://ieeexplore.ieee.org/document/10527171},
timestamp = {Mon, 10 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/GarciaCORM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/JohstNMPRF24,
author = {Abraham Johst and
Markus N{\"{o}}lle and
Lutz Molle and
Nicolas Perlot and
Michael Rohde and
Ronald Freund},
title = {Experimental demonstration of robust spatial-diversity combining for
coherent free-space optical transmission},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2024,
San Diego, CA, USA, March 24-28, 2024},
pages = {1--3},
publisher = {{IEEE}},
year = {2024},
url = {https://ieeexplore.ieee.org/document/10526932},
timestamp = {Thu, 06 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/JohstNMPRF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stoc/AbrahamsenBNZ24,
author = {Mikkel Abrahamsen and
Joakim Blikstad and
Andr{\'{e}} Nusser and
Hanwen Zhang},
editor = {Bojan Mohar and
Igor Shinkar and
Ryan O'Donnell},
title = {Minimum Star Partitions of Simple Polygons in Polynomial Time},
booktitle = {Proceedings of the 56th Annual {ACM} Symposium on Theory of Computing,
{STOC} 2024, Vancouver, BC, Canada, June 24-28, 2024},
pages = {904--910},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3618260.3649756},
doi = {10.1145/3618260.3649756},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/stoc/AbrahamsenBNZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tsp/LouwW24,
author = {Johannes Abraham Louw and
Zenghui Wang},
title = {Applying Phonological Feature Embeddings for Cross-Lingual Transfer
in Text-to-Speech},
booktitle = {47th International Conference on Telecommunications and Signal Processing,
{TSP} 2024, Prague, Czech Republic, July 10-12, 2024},
pages = {168--172},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/TSP63128.2024.10605769},
doi = {10.1109/TSP63128.2024.10605769},
timestamp = {Thu, 29 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tsp/LouwW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/ifip/DavisonDBRWBBWPJTFWRMK24,
author = {Robert M. Davison and
Antonio D{\'{\i}}az{-}Andrade and
Arlene Bailey and
Ephias Ruhode and
Geoff Walsham and
Jean{-}Paul Van Belle and
Judy van Biljon and
Kutoma Wakunuma and
Kyung Ryul Park and
Luiz Antonio Joia and
Manoj A. Thomas and
Neki Frasheri and
P. J. Wall and
Renata L{\`{e}}bre La Rovere and
Silvia Masiero and
Stan Karanasios},
editor = {Christopher Leslie and
David Kreps},
title = {Past Practices, Current Debates and Disputes: Future Engagements and
Opportunities Regarding Digital Transformation for Sustainable Development
- Working Group 9.4: Implications of Information and Digital Technologies
for Development},
booktitle = {Current Directions in {ICT} and Society - {IFIP} {TC9} 50th Anniversary
Anthology},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {700},
pages = {43--58},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-50758-8\_4},
doi = {10.1007/978-3-031-50758-8\_4},
timestamp = {Tue, 20 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/ifip/DavisonDBRWBBWPJTFWRMK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-02469,
author = {Sukhpal Singh Gill and
Huaming Wu and
Panos Patros and
Carlo Ottaviani and
Priyansh Arora and
Victor Casamayor{-}Pujol and
David Haunschild and
Ajith Kumar Parlikad and
Oktay Cetinkaya and
Hanan Lutfiyya and
Vlado Stankovski and
Ruidong Li and
Yuemin Ding and
Junaid Qadir and
Ajith Abraham and
Soumya K. Ghosh and
Houbing Herbert Song and
Rizos Sakellariou and
Omer F. Rana and
Joel J. P. C. Rodrigues and
Salil S. Kanhere and
Schahram Dustdar and
Steve Uhlig and
Kotagiri Ramamohanarao and
Rajkumar Buyya},
title = {Modern Computing: Vision and Challenges},
journal = {CoRR},
volume = {abs/2401.02469},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.02469},
doi = {10.48550/ARXIV.2401.02469},
eprinttype = {arXiv},
eprint = {2401.02469},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-02469.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-12208,
author = {Zhihong Chen and
Maya Varma and
Jean{-}Benoit Delbrouck and
Magdalini Paschali and
Louis Blankemeier and
Dave Van Veen and
Jeya Maria Jose Valanarasu and
Alaa Youssef and
Joseph Paul Cohen and
Eduardo Pontes Reis and
Emily Bao Tsai and
Andrew Johnston and
Cameron Olsen and
Tanishq Mathew Abraham and
Sergios Gatidis and
Akshay S. Chaudhari and
Curtis P. Langlotz},
title = {CheXagent: Towards a Foundation Model for Chest X-Ray Interpretation},
journal = {CoRR},
volume = {abs/2401.12208},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.12208},
doi = {10.48550/ARXIV.2401.12208},
eprinttype = {arXiv},
eprint = {2401.12208},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-12208.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-17493,
author = {Bing Xue and
Charles Alba and
Joanna Abraham and
Thomas George Kannampallil and
Chenyang Lu},
title = {Prescribing Large Language Models for Perioperative Care: What's The
Right Dose for Pre-trained Models?},
journal = {CoRR},
volume = {abs/2402.17493},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.17493},
doi = {10.48550/ARXIV.2402.17493},
eprinttype = {arXiv},
eprint = {2402.17493},
timestamp = {Mon, 25 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-17493.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-02808,
author = {P. Francis and
Abraham M. Illickan and
Lijo M. Jose and
Deepak Rajendraprasad},
title = {Face-hitting Dominating Sets in Planar Graphs},
journal = {CoRR},
volume = {abs/2403.02808},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.02808},
doi = {10.48550/ARXIV.2403.02808},
eprinttype = {arXiv},
eprint = {2403.02808},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-02808.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-08802,
author = {Johannes Schneider and
Rene Abraham and
Christian Meske},
title = {Governance of Generative Artificial Intelligence for Companies},
journal = {CoRR},
volume = {abs/2403.08802},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.08802},
doi = {10.48550/ARXIV.2403.08802},
eprinttype = {arXiv},
eprint = {2403.08802},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-08802.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-11207,
author = {Paul S. Scotti and
Mihir Tripathy and
Cesar Kadir Torrico Villanueva and
Reese Kneeland and
Tong Chen and
Ashutosh Narang and
Charan Santhirasegaran and
Jonathan Xu and
Thomas Naselaris and
Kenneth A. Norman and
Tanishq Mathew Abraham},
title = {MindEye2: Shared-Subject Models Enable fMRI-To-Image With 1 Hour of
Data},
journal = {CoRR},
volume = {abs/2403.11207},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.11207},
doi = {10.48550/ARXIV.2403.11207},
eprinttype = {arXiv},
eprint = {2403.11207},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-11207.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-12945,
author = {Alexander Khazatsky and
Karl Pertsch and
Suraj Nair and
Ashwin Balakrishna and
Sudeep Dasari and
Siddharth Karamcheti and
Soroush Nasiriany and
Mohan Kumar Srirama and
Lawrence Yunliang Chen and
Kirsty Ellis and
Peter David Fagan and
Joey Hejna and
Masha Itkina and
Marion Lepert and
Yecheng Jason Ma and
Patrick Tree Miller and
Jimmy Wu and
Suneel Belkhale and
Shivin Dass and
Huy Ha and
Arhan Jain and
Abraham Lee and
Youngwoon Lee and
Marius Memmel and
Sungjae Park and
Ilija Radosavovic and
Kaiyuan Wang and
Albert Zhan and
Kevin Black and
Cheng Chi and
Kyle Beltran Hatch and
Shan Lin and
Jingpei Lu and
Jean Mercat and
Abdul Rehman and
Pannag R. Sanketi and
Archit Sharma and
Cody Simpson and
Quan Vuong and
Homer Rich Walke and
Blake Wulfe and
Ted Xiao and
Jonathan Heewon Yang and
Arefeh Yavary and
Tony Z. Zhao and
Christopher Agia and
Rohan Baijal and
Mateo Guaman Castro and
Daphne Chen and
Qiuyu Chen and
Trinity Chung and
Jaimyn Drake and
Ethan Paul Foster and
et al.},
title = {{DROID:} {A} Large-Scale In-The-Wild Robot Manipulation Dataset},
journal = {CoRR},
volume = {abs/2403.12945},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.12945},
doi = {10.48550/ARXIV.2403.12945},
eprinttype = {arXiv},
eprint = {2403.12945},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-12945.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-14687,
author = {Raehyuk Jung and
Hyojun Go and
Jaehyuk Yi and
Jiho Jang and
Daniel Kim and
Jay Suh and
Aiden Seung Joon Lee and
Cooper Han and
Jae Lee and
Jeff Kim and
Jin{-}Young Kim and
Junwan Kim and
Kyle Park and
Lucas Lee and
Mars Ha and
Minjoon Seo and
Abraham Jo and
Ed Park and
Hassan Kianinejad and
Sj Kim and
Tony Moon and
Wade Jeong and
Andrei Popescu and
Esther Kim and
EK Yoon and
Genie Heo and
Henry Choi and
Jenna Kang and
Kevin Han and
Noah Seo and
Sunny Nguyen and
Ryan Won and
Yeonhoo Park and
Anthony Giuliani and
Dave Chung and
Hans Yoon and
James Le and
Jenny Ahn and
June Lee and
Maninder Saini and
Meredith Sanders and
Soyoung Lee and
Sue Kim and
Travis Couture},
title = {Pegasus-v1 Technical Report},
journal = {CoRR},
volume = {abs/2404.14687},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.14687},
doi = {10.48550/ARXIV.2404.14687},
eprinttype = {arXiv},
eprint = {2404.14687},
timestamp = {Sat, 25 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-14687.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-18934,
author = {Michelle R. Greene and
Benjamin J. Balas and
Mark D. Lescroart and
Paul R. MacNeilage and
Jennifer A. Hart and
Kamran Binaee and
Peter A. Hausamann and
Ronald Mezile and
Bharath Shankar and
Christian B. Sinnott and
Kaylie Jacleen Capurro and
Savannah Halow and
Hunter Howe and
Mariam Josyula and
Annie Li and
Abraham Mieses and
Amina Mohamed and
Ilya Nudnou and
Ezra Parkhill and
Peter Riley and
Brett Schmidt and
Matthew W. Shinkle and
Wentao Si and
Brian Szekely and
Joaquin M. Torres and
Eliana Weissmann},
title = {The Visual Experience Dataset: Over 200 Recorded Hours of Integrated
Eye Movement, Odometry, and Egocentric Video},
journal = {CoRR},
volume = {abs/2404.18934},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.18934},
doi = {10.48550/ARXIV.2404.18934},
eprinttype = {arXiv},
eprint = {2404.18934},
timestamp = {Mon, 27 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-18934.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-14311,
author = {Jahez Abraham Johny and
Vinod P. and
K. A. Asmitha and
Radhamani G and
Rafidha Rehiman K. A. and
Mauro Conti},
title = {Deep Learning Fusion For Effective Malware Detection: Leveraging Visual
Features},
journal = {CoRR},
volume = {abs/2405.14311},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.14311},
doi = {10.48550/ARXIV.2405.14311},
eprinttype = {arXiv},
eprint = {2405.14311},
timestamp = {Wed, 19 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-14311.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-19257,
author = {Mikkel Abrahamsen and
Ioana O. Bercea and
Lorenzo Beretta and
Jonas Klausen and
L{\'{a}}szl{\'{o}} Kozma},
title = {Online sorting and online {TSP:} randomized, stochastic, and high-dimensional},
journal = {CoRR},
volume = {abs/2406.19257},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.19257},
doi = {10.48550/ARXIV.2406.19257},
eprinttype = {arXiv},
eprint = {2406.19257},
timestamp = {Tue, 30 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-19257.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-04506,
author = {Ja{-}Ho Koo and
Edo Abraham and
Andreja Jonoski and
Dimitri P. Solomatine},
title = {Balancing Operator's Risk Averseness in Model Predictive Control of
a Reservoir System},
journal = {CoRR},
volume = {abs/2407.04506},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.04506},
doi = {10.48550/ARXIV.2407.04506},
eprinttype = {arXiv},
eprint = {2407.04506},
timestamp = {Mon, 12 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-04506.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-04200,
author = {Lu Shi and
Masih Haseli and
Giorgos Mamakoukas and
Daniel Bruder and
Ian Abraham and
Todd D. Murphey and
Jorge Cort{\'{e}}s and
Konstantinos Karydis},
title = {Koopman Operators in Robot Learning},
journal = {CoRR},
volume = {abs/2408.04200},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.04200},
doi = {10.48550/ARXIV.2408.04200},
eprinttype = {arXiv},
eprint = {2408.04200},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-04200.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-06356,
author = {Sophia J. Abraham and
Jin Huang and
Brandon RichardWebster and
Michael Milford and
Jonathan D. Hauenstein and
Walter J. Scheirer},
title = {Enhancing Ecological Monitoring with Multi-Objective Optimization:
{A} Novel Dataset and Methodology for Segmentation Algorithms},
journal = {CoRR},
volume = {abs/2408.06356},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.06356},
doi = {10.48550/ARXIV.2408.06356},
eprinttype = {arXiv},
eprint = {2408.06356},
timestamp = {Mon, 23 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-06356.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/DeviEJKAV23,
author = {M. Anousouya Devi and
R. Ezhilarasie and
K. Suresh Joseph and
Ketan Kotecha and
Ajith Abraham and
Subramaniyaswamy Vairavasundaram},
title = {An Improved Boykov's Graph Cut-Based Segmentation Technique for the
Efficient Detection of Cervical Cancer},
journal = {{IEEE} Access},
volume = {11},
pages = {77636--77647},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3295833},
doi = {10.1109/ACCESS.2023.3295833},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/DeviEJKAV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HooshyarGMKAMZGRCWGAKN23,
author = {Hosna Hooshyar and
Eduardo M. Guerra and
Jorge Melegati and
Dron Khanna and
Abdullah Aldaeej and
Gerardo Matturro and
Luciana A. M. Zaina and
Des Greer and
Usman Rafiq and
Rafael Chanin and
Xiaofeng Wang and
Juan Garbajosa and
Pekka Abrahamsson and
Foutse Khomh and
Anh Nguyen{-}Duc},
title = {Impact in Software Engineering Activities After One Year of {COVID-19}
Restrictions for Startups and Established Companies},
journal = {{IEEE} Access},
volume = {11},
pages = {55178--55203},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3279917},
doi = {10.1109/ACCESS.2023.3279917},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/HooshyarGMKAMZGRCWGAKN23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/JoshiSYHSGAWK23,
author = {Gargi Joshi and
Ananya Srivastava and
Bhargav Yagnik and
Mohammed Hasan and
Zainuddin Saiyed and
Lubna Abdel Kareim Gabralla and
Ajith Abraham and
Rahee Walambe and
Ketan Kotecha},
title = {Explainable Misinformation Detection Across Multiple Social Media
Platforms},
journal = {{IEEE} Access},
volume = {11},
pages = {23634--23646},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3251892},
doi = {10.1109/ACCESS.2023.3251892},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/JoshiSYHSGAWK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/AbrahamLBRC23,
author = {Abin Abraham and
Abigail L. Labella and
Mary Lauren Benton and
Antonis Rokas and
John A. Capra},
title = {{GSEL:} a fast, flexible python package for detecting signatures of
diverse evolutionary forces on genomic regions},
journal = {Bioinform.},
volume = {39},
number = {1},
year = {2023},
url = {https://doi.org/10.1093/bioinformatics/btad037},
doi = {10.1093/BIOINFORMATICS/BTAD037},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/AbrahamLBRC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/MackDJBTBBDGPP23,
author = {Kelly Mack and
Maitraye Das and
Dhruv Jain and
Danielle Bragg and
John Tang and
Andrew Begel and
Erin Beneteau and
Josh Urban Davis and
Abraham Glasser and
Joon Sung Park and
Venkatesh Potluri},
title = {Mixed Abilities and Varied Experiences: {A} Group Autoethnography
of a Virtual Summer Internship},
journal = {Commun. {ACM}},
volume = {66},
number = {8},
pages = {105--113},
year = {2023},
url = {https://doi.org/10.1145/3604622},
doi = {10.1145/3604622},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/MackDJBTBBDGPP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/IyerABTCSWGRYDJ23,
author = {Aditi Iyer and
Aditya P. Apte and
Ethan Bendau and
Maria Thor and
Ishita Chen and
Jacob Shin and
Abraham J. Wu and
Daniel Gomez and
Andreas Rimner and
Ellen Yorke and
Joseph O. Deasy and
Andrew Jackson},
title = {{ROE} (Radiotherapy Outcomes Estimator): An open-source tool for optimizing
radiotherapy prescriptions},
journal = {Comput. Methods Programs Biomed.},
volume = {242},
pages = {107833},
year = {2023},
url = {https://doi.org/10.1016/j.cmpb.2023.107833},
doi = {10.1016/J.CMPB.2023.107833},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/IyerABTCSWGRYDJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/complexity/ChadhaSAKMSKDSJAAKKD23,
author = {Utkarsh Chadha and
Senthil Kumaran Selvaraj and
Abel Saji Abraham and
Mayank Khanna and
Anirudh Mishra and
Isha Sachdeva and
Swati Kashyap and
S. Jithin Dev and
R. Srii Swatish and
Ayushma Joshi and
Simar Kaur Anand and
Addisalem Adefris and
R. Lokesh Kumar and
Jayakumar Kaliappan and
S. Dhanalakshmi},
title = {Powder Bed Fusion via Machine Learning-Enabled Approaches},
journal = {Complex.},
volume = {2023},
pages = {9481790:1--9481790:25},
year = {2023},
url = {https://doi.org/10.1155/2023/9481790},
doi = {10.1155/2023/9481790},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/complexity/ChadhaSAKMSKDSJAAKKD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dc/AbrahamJMMST23,
author = {Ittai Abraham and
Philipp Jovanovic and
Mary Maller and
Sarah Meiklejohn and
Gilad Stern and
Alin Tomescu},
title = {Reaching consensus for asynchronous distributed key generation},
journal = {Distributed Comput.},
volume = {36},
number = {3},
pages = {219--252},
year = {2023},
url = {https://doi.org/10.1007/s00446-022-00436-8},
doi = {10.1007/S00446-022-00436-8},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dc/AbrahamJMMST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eait/GalvanMBP23,
author = {Juan Jos{\'{e}} Marrero Galv{\'{a}}n and
Miguel {\'{A}}ngel Negr{\'{\i}}n Medina and
Abraham Bern{\'{a}}rdez{-}G{\'{o}}mez and
Antonio Portela Prua{\~{n}}o},
title = {The impact of the first millennial teachers on education: views held
by different generations of teachers},
journal = {Educ. Inf. Technol.},
volume = {28},
number = {11},
pages = {14805--14826},
year = {2023},
url = {https://doi.org/10.1007/s10639-023-11768-8},
doi = {10.1007/S10639-023-11768-8},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eait/GalvanMBP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/electronicmarkets/Abraham0B23,
author = {Rene Abraham and
Johannes Schneider and
Jan vom Brocke},
title = {A taxonomy of data governance decision domains in data marketplaces},
journal = {Electron. Mark.},
volume = {33},
number = {1},
pages = {22},
year = {2023},
url = {https://doi.org/10.1007/s12525-023-00631-w},
doi = {10.1007/S12525-023-00631-W},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/electronicmarkets/Abraham0B23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/ChengWCF23,
author = {Chi{-}Tsun Cheng and
J{\"{o}}rg F. Wollert and
Xi Chen and
Abraham O. Fapojuwo},
title = {Guest Editorial Circuits and Systems for Industry {X.0} Applications},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {13},
number = {2},
pages = {457--460},
year = {2023},
url = {https://doi.org/10.1109/JETCAS.2023.3278843},
doi = {10.1109/JETCAS.2023.3278843},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esticas/ChengWCF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fr/MeyerPPATSPDTSCM23,
author = {Joel Meyer and
Ahalya Prabhakar and
Allison Pinosky and
Ian Abraham and
Annalisa T. Taylor and
Millicent Schlafly and
Katarina Popovic and
Giovani Diniz and
Brendan Teich and
Borislava I. Simidchieva and
Shane Clark and
Todd D. Murphey},
title = {Scale-Invariant Specifications for Human-Swarm Systems},
journal = {Field Robotics},
volume = {3},
number = {1},
pages = {368--391},
year = {2023},
url = {https://doi.org/10.55417/fr.2023011},
doi = {10.55417/FR.2023011},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fr/MeyerPPATSPDTSCM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/DommerCKRWAROMB23,
author = {Abigail C. Dommer and
Lorenzo Casalino and
Fiona L. Kearns and
Mia Rosenfeld and
Nicholas Wauer and
Surl{-}Hee Ahn and
John Russo and
A. Sofia F. Oliveira and
Clare Morris and
Anthony T. Bogetti and
Anda Trifan and
Alexander Brace and
Terra Sztain and
Austin Clyde and
Heng Ma and
S. Chakra Chennubhotla and
Hyungro Lee and
Matteo Turilli and
Syma Khalid and
Teresa Tamayo{-}Mendoza and
Matthew Welborn and
Anders S. Christensen and
Daniel G. A. Smith and
Zhuoran Qiao and
Sai K. Sirumalla and
Michael O'Connor and
Frederick R. Manby and
Anima Anandkumar and
David J. Hardy and
James C. Phillips and
Abraham C. Stern and
Josh Romero and
David Clark and
Mitchell Dorrell and
Tom Maiden and
Lei Huang and
John D. McCalpin and
Christopher J. Woods and
Alan Gray and
Matt Williams and
Bryan Barker and
Harinda Rajapaksha and
Richard Pitts and
Tom Gibbs and
John E. Stone and
Daniel M. Zuckerman and
Adrian J. Mulholland and
Thomas F. Miller III and
Shantenu Jha and
Arvind Ramanathan and
Lillian T. Chong and
Rommie E. Amaro},
title = {{\#}COVIDisAirborne: AI-enabled multiscale computational microscopy
of delta SARS-CoV-2 in a respiratory aerosol},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {37},
number = {1},
pages = {28--44},
year = {2023},
url = {https://doi.org/10.1177/10943420221128233},
doi = {10.1177/10943420221128233},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/DommerCKRWAROMB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijinfoman/SandhuVTO23,
author = {Ramandeep Kaur Sandhu and
Jo{\~{a}}o Vasconcelos{-}Gomes and
Manoj A. Thomas and
Tiago Oliveira},
title = {Unfolding the popularity of video conferencing apps - {A} privacy
calculus perspective},
journal = {Int. J. Inf. Manag.},
volume = {68},
pages = {102569},
year = {2023},
url = {https://doi.org/10.1016/j.ijinfomgt.2022.102569},
doi = {10.1016/J.IJINFOMGT.2022.102569},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijinfoman/SandhuVTO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/AbrahamDKFG23,
author = {Joanna Abraham and
Caoimhe Duffy and
Madhumitha Kandasamy and
Daniel J. France and
Philip E. Greilich},
title = {An evidence synthesis on perioperative Handoffs: {A} call for balanced
sociotechnical solutions},
journal = {Int. J. Medical Informatics},
volume = {174},
pages = {105038},
year = {2023},
url = {https://doi.org/10.1016/j.ijmedinf.2023.105038},
doi = {10.1016/J.IJMEDINF.2023.105038},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmi/AbrahamDKFG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmssc/PramithaA23,
author = {P. Ambily Pramitha and
John T. Abraham},
title = {Hybrid classifier for sentiment analysis in Malayalam with modified
{TF-IDF} features},
journal = {Int. J. Model. Simul. Sci. Comput.},
volume = {14},
number = {5},
pages = {2350038:1--2350038:24},
year = {2023},
url = {https://doi.org/10.1142/S1793962323500381},
doi = {10.1142/S1793962323500381},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmssc/PramithaA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ism/SchneiderAMB23,
author = {Johannes Schneider and
Rene Abraham and
Christian Meske and
Jan vom Brocke},
title = {Artificial Intelligence Governance For Businesses},
journal = {Inf. Syst. Manag.},
volume = {40},
number = {3},
pages = {229--249},
year = {2023},
url = {https://doi.org/10.1080/10580530.2022.2085825},
doi = {10.1080/10580530.2022.2085825},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ism/SchneiderAMB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/AbrahamBMKXLA23,
author = {Joanna Abraham and
Brian Bartek and
Alicia Meng and
Christopher Ryan King and
Bing Xue and
Chenyang Lu and
Michael S. Avidan},
title = {Integrating machine learning predictions for perioperative risk management:
Towards an empirical design of a flexible-standardized risk assessment
tool},
journal = {J. Biomed. Informatics},
volume = {137},
pages = {104270},
year = {2023},
url = {https://doi.org/10.1016/j.jbi.2022.104270},
doi = {10.1016/J.JBI.2022.104270},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jbi/AbrahamBMKXLA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jimaging/AbrahamJAJJKAPST23,
author = {Adriel Abraham and
Rejath Jose and
Jawad Ahmad and
Jai Joshi and
Thomas Jacob and
Aziz{-}ur{-}rahman Khalid and
Hassam Ali and
Pratik Patel and
Jaspreet Singh and
Milan Toma},
title = {Comparative Analysis of Machine Learning Models for Image Detection
of Colonic Polyps vs. Resected Polyps},
journal = {J. Imaging},
volume = {9},
number = {10},
pages = {215},
year = {2023},
url = {https://doi.org/10.3390/jimaging9100215},
doi = {10.3390/JIMAGING9100215},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jimaging/AbrahamJAJJKAPST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/NettiPOPPEACP23,
author = {Alessio Netti and
Yang Peng and
Patrik Omland and
Michael Paulitsch and
Jorge Parra and
Gustavo Espinosa and
Udit Kumar Agarwal and
Abraham Chan and
Karthik Pattabiraman},
title = {Mixed precision support in {HPC} applications: What about reliability?},
journal = {J. Parallel Distributed Comput.},
volume = {181},
pages = {104746},
year = {2023},
url = {https://doi.org/10.1016/j.jpdc.2023.104746},
doi = {10.1016/J.JPDC.2023.104746},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/NettiPOPPEACP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/BogaleWBEMYMWMDMB23,
author = {Tariku Nigatu Bogale and
Herman Jozef Willems and
Loko Abraham Bongassie and
Yemariam Eyob and
Chaluma Kumela Mengesha and
Bantalem Yeshanew Yihun and
Mesud Mohammed and
Naod Wendrad and
Gemechis Melkamu and
Dawit Wolde Daka and
Selamawit Meressa and
Tadesse Alemu Bekele},
title = {Acceptability and use of the electronic community health information
system and its determinants among health extension workers in Ethiopia:
a retrospective cross-sectional observational study},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {23},
number = {1},
pages = {290},
year = {2023},
url = {https://doi.org/10.1186/s12911-023-02385-z},
doi = {10.1186/S12911-023-02385-Z},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/midm/BogaleWBEMYMWMDMB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/GrafTGHSSA23,
author = {Lisa Graf and
Falko Tesch and
Felix Gr{\"{a}}{\ss}er and
Lorenz Harst and
Doreen Siegels and
Jochen Schmitt and
Susanne Abraham},
title = {Acceptance of a digital therapy recommender system for psoriasis},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {23},
number = {1},
pages = {150},
year = {2023},
url = {https://doi.org/10.1186/s12911-023-02246-9},
doi = {10.1186/S12911-023-02246-9},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/GrafTGHSSA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/TerlouwBNACELMRRSMTZAAAAAAABBBBBBCC23,
author = {Barbara R. Terlouw and
Kai Blin and
Jorge C. Navarro{-}Mu{\~{n}}oz and
Nicole E. Avalon and
Marc G. Chevrette and
Susan Egbert and
Sanghoon Lee and
David Meijer and
Michael J. Recchia and
Zachary L. Reitz and
Jeffrey A. van Santen and
Nelly Selem Mojica and
Thomas T{\o}rring and
Liana Zaroubi and
Mohammad Alanjary and
Gajender Aleti and
C{\'{e}}sar Aguilar and
Suhad A. Al{-}Salihi and
Hannah E. Augustijn and
J. Abraham Avelar{-}Rivas and
Luis A. Avitia{-}Dom{\'{\i}}nguez and
Francisco Barona{-}G{\'{o}}mez and
Jordan Bernaldo{-}Ag{\"{u}}ero and
Vincent A. Bielinski and
Friederike Biermann and
Thomas J. Booth and
J. Carrion Bravo and
Raquel Castelo{-}Branco and
Fernanda O. Chagas and
Pablo Cruz{-}Morales and
Chao Du and
Katherine R. Duncan and
Athina Gavriilidou and
Damien Gayrard and
Karina Guti{\'{e}}rrez{-}Garc{\'{\i}}a and
Kristina Haslinger and
Eric J. N. Helfrich and
Justin J. J. van der Hooft and
Afif P. Jati and
Edward Kalkreuter and
Nikolaos Kalyvas and
Kyo Bin Kang and
Satria A. Kautsar and
Wonyong Kim and
Aditya M. Kunjapur and
Yong{-}Xin Li and
Geng{-}Min Lin and
Catarina Loureiro and
Joris J. R. Louwen and
Nico l L. Louwen and
George Lund and
Jonathan Parra and
Benjamin Philmus and
Bita Pourmohsenin and
Lotte U. Pronk and
Adriana Rego and
Devasahayam Arokia Balaya Rex and
Serina L. Robinson and
L. Rodrigo Rosas{-}Becerra and
Eve T. Roxborough and
Michelle A. Schorn and
Darren J. Scobie and
Kumar Saurabh Singh and
Nika Sokolova and
Xiaoyu Tang and
Daniel W. Udwary and
Aruna Vigneshwari and
Kristiina Vind and
Sophie P. J. M. Vromans and
Valentin Waschulin and
Sam E. Williams and
Jaclyn M. Winter and
Thomas E. Witte and
Huali Xie and
Dong Yang and
Jingwei Yu and
Mitja Zdouc and
Zheng Zhong and
J{\'{e}}r{\^{o}}me Collemare and
Roger G. Linington and
Tilmann Weber and
Marnix H. Medema},
title = {MIBiG 3.0: a community-driven effort to annotate experimentally validated
biosynthetic gene clusters},
journal = {Nucleic Acids Res.},
volume = {51},
number = {{D1}},
pages = {603--610},
year = {2023},
url = {https://doi.org/10.1093/nar/gkac1049},
doi = {10.1093/NAR/GKAC1049},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/TerlouwBNACELMRRSMTZAAAAAAABBBBBBCC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/SalunkheSABJAR23,
author = {Vishal A. Salunkhe and
Neha Sinha and
Emma Ahlqvist and
Rashmi Prasad B and
Svetlana Johansson and
Birgitta Abrahamsson and
Anders H. Rosengren},
title = {Digital lifestyle treatment improves long-term metabolic control in
type 2 diabetes with different effects in pathophysiological and genetic
subgroups},
journal = {npj Digit. Medicine},
volume = {6},
year = {2023},
url = {https://doi.org/10.1038/s41746-023-00946-0},
doi = {10.1038/S41746-023-00946-0},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/SalunkheSABJAR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ol/HerranCMD23,
author = {Alberto Herr{\'{a}}n and
J. Manuel Colmenar and
Nenad Mladenovic and
Abraham Duarte},
title = {A general variable neighborhood search approach for the minimum load
coloring problem},
journal = {Optim. Lett.},
volume = {17},
number = {9},
pages = {2065--2086},
year = {2023},
url = {https://doi.org/10.1007/s11590-022-01861-1},
doi = {10.1007/S11590-022-01861-1},
timestamp = {Sun, 17 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ol/HerranCMD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/KanabarVAMNPZ23,
author = {Hrutvik Kanabar and
Samuel Vivien and
Oskar Abrahamsson and
Magnus O. Myreen and
Michael Norrish and
Johannes {\AA}man Pohjola and
Riccardo Zanetti},
title = {PureCake: {A} Verified Compiler for a Lazy Functional Language},
journal = {Proc. {ACM} Program. Lang.},
volume = {7},
number = {{PLDI}},
pages = {952--976},
year = {2023},
url = {https://doi.org/10.1145/3591259},
doi = {10.1145/3591259},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmpl/KanabarVAMNPZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scirobotics/KimYZLGPWEDWPLNKBPXZGRB23,
author = {Yongdeok Kim and
Yiyuan Yang and
Xiaotian Zhang and
Zhengwei Li and
Abraham V{\'{a}}zquez Guardado and
Insu Park and
Jiaojiao Wang and
Andrew I. Efimov and
Zhi Dou and
Yue Wang and
Junehu Park and
Haiwen Luan and
Xinchen Ni and
Yun Seong Kim and
Janice Baek and
Joshua Jaehyung Park and
Zhaoqian Xie and
Hangbo Zhao and
Mattia Gazzola and
John A. Rogers and
Rashid Bashir},
title = {Remote control of muscle-driven miniature robots with battery-free
wireless optoelectronics},
journal = {Sci. Robotics},
volume = {8},
number = {74},
year = {2023},
url = {https://doi.org/10.1126/scirobotics.add1053},
doi = {10.1126/SCIROBOTICS.ADD1053},
timestamp = {Sat, 11 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/scirobotics/KimYZLGPWEDWPLNKBPXZGRB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ForchukRCLHBFMS23,
author = {Cheryl Forchuk and
Abraham Rudnick and
Deborah Corring and
Daniel J. Lizotte and
Jeffrey S. Hoch and
Richard Booth and
Barbara Frampton and
Rupinder Mann and
Jonathan Serrato},
title = {A Smart Technology Intervention in the Homes of People with Mental
Illness and Physical Comorbidities},
journal = {Sensors},
volume = {23},
number = {1},
pages = {406},
year = {2023},
url = {https://doi.org/10.3390/s23010406},
doi = {10.3390/S23010406},
timestamp = {Tue, 31 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/ForchukRCLHBFMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/RodriguezRodriguezPRMVG23,
author = {Wenceslao Eduardo Rodr{\'{\i}}guez{-}Rodr{\'{\i}}guez and
Jes{\'{u}}s Abraham Puente{-}Sujo and
Adolfo Josu{\'{e}} Rodr{\'{\i}}guez{-}Rodr{\'{\i}}guez and
Ignacio R. Mat{\'{\i}}as and
David Tom{\'{a}}s Vargas{-}Requena and
Luis Antonio Garc{\'{\i}}a{-}Garza},
title = {Low-Cost Online Monitoring System for the Etching Process in Fiber
Optic Sensors by Computer Vision},
journal = {Sensors},
volume = {23},
number = {13},
pages = {5951},
year = {2023},
url = {https://doi.org/10.3390/s23135951},
doi = {10.3390/S23135951},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/RodriguezRodriguezPRMVG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/VicenteMartinezMGH23,
author = {Jorge Armando Vicente{-}Mart{\'{\i}}nez and
Mois{\'{e}}s{-}Vicente M{\'{a}}rquez{-}Olivera and
Abraham Garc{\'{\i}}a{-}Aliaga and
Viridiana Hern{\'{a}}ndez{-}Herrera},
title = {Adaptation of YOLOv7 and YOLOv7{\_}tiny for Soccer-Ball Multi-Detection
with DeepSORT for Tracking by Semi-Supervised System},
journal = {Sensors},
volume = {23},
number = {21},
pages = {8693},
year = {2023},
url = {https://doi.org/10.3390/s23218693},
doi = {10.3390/S23218693},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/VicenteMartinezMGH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/AratynGLZ23,
author = {Henrik Aratyn and
Jos{\'{e}} Francisco Gomes and
Gabriel Vieira Lobo and
Abraham Hirsz Zimerman},
title = {On Rational Solutions of Dressing Chains of Even Periodicity},
journal = {Symmetry},
volume = {15},
number = {1},
pages = {249},
year = {2023},
url = {https://doi.org/10.3390/sym15010249},
doi = {10.3390/SYM15010249},
timestamp = {Fri, 10 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/symmetry/AratynGLZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/MinerviniPURQMRFRGMVHCKBPMOKKDVC23,
author = {Francesco Minervini and
Oscar Palomar and
Osman S. Unsal and
Enrico Reggiani and
Josue V. Quiroga and
Joan Marimon and
Carlos Rojas and
Roger Figueras and
Abraham Ruiz and
Alberto Gonz{\'{a}}lez and
Jonnatan Mendoza and
Iv{\'{a}}n Vargas and
C{\'{e}}sar Hern{\'{a}}ndez and
Joan Cabre and
Lina Khoirunisya and
Mustapha Bouhali and
Julian Pavon and
Francesc Moll and
Mauro Olivieri and
Mario Kovac and
Mate Kovac and
Leon Dragic and
Mateo Valero and
Adri{\'{a}}n Cristal},
title = {Vitruvius+: An Area-Efficient {RISC-V} Decoupled Vector Coprocessor
for High Performance Computing Applications},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {20},
number = {2},
pages = {28:1--28:25},
year = {2023},
url = {https://doi.org/10.1145/3575861},
doi = {10.1145/3575861},
timestamp = {Fri, 21 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taco/MinerviniPURQMRFRGMVHCKBPMOKKDVC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/KarCASWME23,
author = {Sudeshna Sil Kar and
Hasan Cetin and
Joseph Abraham and
Sunil K. Srivastava and
Jon Whitney and
Anant Madabhushi and
Justis P. Ehlers},
title = {Novel Fractal-Based Sub-RPE Compartment {OCT} Radiomics Biomarkers
Are Associated With Subfoveal Geographic Atrophy in Dry {AMD}},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {70},
number = {10},
pages = {2914--2921},
year = {2023},
url = {https://doi.org/10.1109/TBME.2023.3270201},
doi = {10.1109/TBME.2023.3270201},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/KarCASWME23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AlcaideGLBKF23,
author = {Abraham Marquez Alcaide and
Sandro Guenter and
Jos{\'{e}} I. Leon and
Giampaolo Buticchi and
Samir Kouro and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Common DC-Link Capacitor Lifetime Extension in Modular {DC/DC} Converters
for Electric Vehicle Fast Chargers via Variable-Angle Interleaved
Operation},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {70},
number = {11},
pages = {10765--10774},
year = {2023},
url = {https://doi.org/10.1109/TIE.2022.3231251},
doi = {10.1109/TIE.2022.3231251},
timestamp = {Fri, 23 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/AlcaideGLBKF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AlcaideKALVMBLF23,
author = {Abraham Marquez Alcaide and
Youngjong Ko and
Markus Andresen and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Vito Giuseppe Monopoli and
Giampaolo Buticchi and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Capacitor Lifetime Extension of Interleaved {DC-DC} Converters for
Multistring {PV} Systems},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {70},
number = {5},
pages = {4854--4864},
year = {2023},
url = {https://doi.org/10.1109/TIE.2022.3187579},
doi = {10.1109/TIE.2022.3187579},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/AlcaideKALVMBLF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AlcaideMZBLVLF23,
author = {Abraham Marquez Alcaide and
Vito Giuseppe Monopoli and
Eduardo Zafra and
Giampaolo Buticchi and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Generalized Multicarrier {PWM} Technique for Two-Level Voltage Source
Inverters},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {70},
number = {5},
pages = {4345--4355},
year = {2023},
url = {https://doi.org/10.1109/TIE.2022.3190872},
doi = {10.1109/TIE.2022.3190872},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/AlcaideMZBLVLF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/BalenciagaALAMLF23,
author = {Jon Xabier Balenciaga and
Abraham Marquez Alcaide and
Jos{\'{e}} I. Leon and
Eritz Aldazabal and
Danel Madariaga and
Iraitz Legarra and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Discontinuous {PWM} Technique With Reduced Low-Order Harmonic Distortion
for High-Power Applications},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {70},
number = {10},
pages = {9741--9750},
year = {2023},
url = {https://doi.org/10.1109/TIE.2022.3219120},
doi = {10.1109/TIE.2022.3219120},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/BalenciagaALAMLF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ZafraVAMFG23,
author = {Eduardo Zafra and
Sergio Vazquez and
Abraham Marquez Alcaide and
Emilia Perez Martin and
Leopoldo Garc{\'{\i}}a Franquelo and
Jose Ignacio Le{\'{o}}n Galv{\'{a}}n},
title = {Hybrid Sphere Decoder for Long Prediction Horizon {FCS-MPC}},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {70},
number = {6},
pages = {5484--5492},
year = {2023},
url = {https://doi.org/10.1109/TIE.2022.3194587},
doi = {10.1109/TIE.2022.3194587},
timestamp = {Fri, 10 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/ZafraVAMFG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/africanlp/AdelaniMAATMODO23,
author = {David Ifeoluwa Adelani and
Marek Masiak and
Israel Abebe Azime and
Jesujoba Oluwadara Alabi and
Atnafu Lambebo Tonja and
Christine Mwase and
Odunayo Ogundepo and
Bonaventure F. P. Dossou and
Akintunde Oladipo and
Doreen Nixdorf and
Chris Chinenye Emezue and
Sana Sabah Al{-}Azzawi and
Blessing K. Sibanda and
Davis David and
Lolwethu Ndolela and
Jonathan Mukiibi and
Tunde Oluwaseyi Ajayi and
Tatiana Moteu Ngoli and
Brian Odhiambo and
Abraham Toluwase Owodunni},
title = {MasakhaNEWS: News Topic Classification for African languages},
booktitle = {Proceedings of the 4th Workshop on African Natural Language Processing,
AfricaNLP@ICLR 2023, Kigali, Rwanda, May 1, 2023},
year = {2023},
url = {https://openreview.net/pdf?id=sj45chH1F1},
timestamp = {Wed, 06 Sep 2023 12:12:32 +0200},
biburl = {https://dblp.org/rec/conf/africanlp/AdelaniMAATMODO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/africon/KithekaMNA23,
author = {Joel Mwithui Kitheka and
Peter Musau Moses and
Abraham M. Nyete and
Nichodemus Odero Abungu},
title = {Transient Stability Analysis of a Line with Service Potential Transformer
Substations: {A} Case study of Juja-Rabai Line},
booktitle = {{IEEE} {AFRICON} 2023, Nairobi, Kenya, September 20-22, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/AFRICON55910.2023.10293661},
doi = {10.1109/AFRICON55910.2023.10293661},
timestamp = {Tue, 14 Nov 2023 16:37:30 +0100},
biburl = {https://dblp.org/rec/conf/africon/KithekaMNA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/camad/GarciaAOMR23,
author = {Carlos Rubio Garcia and
Abraham Cano Aguilera and
Juan Jose Vegas Olmos and
Idelfonso Tafur Monroy and
Simon Rommel},
title = {Quantum-Resistant {TLS} 1.3: {A} Hybrid Solution Combining Classical,
Quantum and Post-Quantum Cryptography},
booktitle = {28th {IEEE} International Workshop on Computer Aided Modeling and
Design of Communication Links and Networks , {CAMAD} 2023, Edinburgh,
United Kingdom, November 6-8, 2023},
pages = {246--251},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CAMAD59638.2023.10478407},
doi = {10.1109/CAMAD59638.2023.10478407},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/camad/GarciaAOMR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chiuxid/CuGSTO23,
author = {Monica Keisha Cu and
Vito Leon Gamboa and
Justin John Abraham Sy and
Shienie Mae Tan and
Ethel Ong},
title = {Humans + {AI:} Exploring the Collaboration Between {AI} and Human
Labor in the Workplace},
booktitle = {9th International {HCI} and {UX} Conference in Indonesia, CHIuXiD
2023, Bali, Indonesia, November 18, 2023},
pages = {35--40},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CHIuXiD59550.2023.10452733},
doi = {10.1109/CHIUXID59550.2023.10452733},
timestamp = {Tue, 02 Apr 2024 12:53:22 +0200},
biburl = {https://dblp.org/rec/conf/chiuxid/CuGSTO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clei/GamarraMorenoAAAHB23,
author = {Abraham Gamarra{-}Moreno and
Luis Aroni{-}Ordo{\~{n}}ez and
Edson Ambrosio{-}Carrasco and
Sergio Arias{-}Rafael and
Jordan Huam{\'{a}}n{-}Guizgueta and
Yeferson Balde{\'{o}}n{-}Huaccho},
title = {Detection of Areas of Deforestation in the Amazon Through Convolutional
Neural Networks in the Period of 2020-2022},
booktitle = {{XLIX} Latin American Computer Conference, {CLEI} 2023, La Paz, Bolivia,
October 16-20, 2023},
pages = {1--10},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CLEI60451.2023.10346180},
doi = {10.1109/CLEI60451.2023.10346180},
timestamp = {Fri, 09 Feb 2024 20:38:46 +0100},
biburl = {https://dblp.org/rec/conf/clei/GamarraMorenoAAAHB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/crypto/AbrahamJMMS23,
author = {Ittai Abraham and
Philipp Jovanovic and
Mary Maller and
Sarah Meiklejohn and
Gilad Stern},
editor = {Helena Handschuh and
Anna Lysyanskaya},
title = {Bingo: Adaptivity and Asynchrony in Verifiable Secret Sharing and
Distributed Key Generation},
booktitle = {Advances in Cryptology - {CRYPTO} 2023 - 43rd Annual International
Cryptology Conference, {CRYPTO} 2023, Santa Barbara, CA, USA, August
20-24, 2023, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14081},
pages = {39--70},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-38557-5\_2},
doi = {10.1007/978-3-031-38557-5\_2},
timestamp = {Mon, 14 Aug 2023 16:16:25 +0200},
biburl = {https://dblp.org/rec/conf/crypto/AbrahamJMMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dcis/DoblasCCDE0HJKL23,
author = {Max Doblas and
Gerard Cand{\'{o}}n and
Xavier Carril and
Marc Dom{\'{\i}}nguez and
Enric Erra and
Alberto Gonz{\'{a}}lez and
C{\'{e}}sar Hern{\'{a}}ndez and
V{\'{\i}}ctor Jim{\'{e}}nez and
Vatistas Kostalampros and
Rub{\'{e}}n Langarita and
Neiel Leyva and
Guillem L{\'{o}}pez{-}Parad{\'{\i}}s and
Jonnatan Mendoza and
Josep Oltra and
Juli{\'{a}}n Pav{\'{o}}n and
Crist{\'{o}}bal Ram{\'{\i}}rez and
Narc{\'{\i}}s Rodas and
Enrico Reggiani and
Mario Rodr{\'{\i}}guez and
Carlos Rojas and
Abraham Ruiz and
Hugo Safadi and
V{\'{\i}}ctor Soria and
Alejandro Suanes and
Iv{\'{a}}n Vargas and
Fernando Arreza and
Roger Figueras and
Pau Fontova{-}Must{\'{e}} and
Joan Marimon and
Ricardo Mart{\'{\i}}nez and
Sergio Moreno and
Jordi Sacrist{\'{a}}n and
Oscar Alonso and
Xavier Aragon{\`{e}}s and
Adri{\'{a}}n Cristal and
{\'{A}}ngel Di{\'{e}}guez and
Manuel L{\'{o}}pez and
Diego Mateo and
Francesc Moll and
Miquel Moret{\'{o}} and
Oscar Palomar and
Marco A. Ram{\'{\i}}rez and
Francisco Serra{-}Graells and
Nehir S{\"{o}}nmez and
Llu{\'{\i}}s Ter{\'{e}}s and
Osman S. Unsal and
Mateo Valero and
Luis Villa},
title = {Sargantana: An Academic SoC {RISC-V} Processor in 22nm {FDSOI} Technology},
booktitle = {38th Conference on Design of Circuits and Integrated Systems, {DCIS}
2023, M{\'{a}}laga, Spain, November 15-17, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/DCIS58620.2023.10335976},
doi = {10.1109/DCIS58620.2023.10335976},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dcis/DoblasCCDE0HJKL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/OgundepoGRCRADD23,
author = {Odunayo Ogundepo and
Tajuddeen Gwadabe and
Clara Rivera and
Jonathan H. Clark and
Sebastian Ruder and
David Ifeoluwa Adelani and
Bonaventure Dossou and
Abdou Aziz Diop and
Claytone Sikasote and
Gilles Hacheme and
Happy Buzaaba and
Ignatius Ezeani and
Rooweither Mabuya and
Salomey Osei and
Chris Emezue and
Albert Kahira and
Shamsuddeen Hassan Muhammad and
Akintunde Oladipo and
Abraham Toluwase Owodunni and
Atnafu Lambebo Tonja and
Iyanuoluwa Shode and
Akari Asai and
Aremu Anuoluwapo and
Ayodele Awokoya and
Bernard Opoku and
Chiamaka Chukwuneke and
Christine Mwase and
Clemencia Siro and
Stephen Arthur and
Tunde Ajayi and
Verrah Otiende and
Andre Niyongabo Rubungo and
Boyd Sinkala and
Daniel A. Ajisafe and
Emeka Onwuegbuzia and
Falalu Ibrahim Lawan and
Ibrahim Said Ahmad and
Jesujoba O. Alabi and
Chinedu E. Mbonu and
Mofetoluwa Adeyemi and
Mofya Phiri and
Orevaoghene Ahia and
Ruqayya Nasir Iro and
Sonia Adhiambo},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Cross-lingual Open-Retrieval Question Answering for African Languages},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {14957--14972},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.997},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.997},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/OgundepoGRCRADD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enc/VeraUribeAPR23,
author = {Ernesto M. Vera{-}Uribe and
Josu{\'{e}} S. Armenta and
Diobar Abraham Baez Perez and
Marcela D. Rodr{\'{\i}}guez},
title = {Validation of Computerized Tools Developed to Collect Data on Safety
Driving: {A} Pilot Study},
booktitle = {Mexican International Conference on Computer Science, {ENC} 2023,
Guanajuato, Guanajuato, Mexico, September 11-13, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ENC60556.2023.10508675},
doi = {10.1109/ENC60556.2023.10508675},
timestamp = {Wed, 15 May 2024 16:26:03 +0200},
biburl = {https://dblp.org/rec/conf/enc/VeraUribeAPR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icccnt/ThalakotturRVV23,
author = {Joel Thalakottur and
Ben Abraham Ray and
Alex Victor and
Aryan Vyas},
title = {DeFy: {P2P} Crypto Lending},
booktitle = {14th International Conference on Computing Communication and Networking
Technologies, {ICCCNT} 2023, Delhi, India, July 6-8, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCCNT56998.2023.10306743},
doi = {10.1109/ICCCNT56998.2023.10306743},
timestamp = {Thu, 30 Nov 2023 16:40:53 +0100},
biburl = {https://dblp.org/rec/conf/icccnt/ThalakotturRVV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccvw/AbrahamMKHS23,
author = {Sophia J. Abraham and
Kehelwala Dewage Gayan Maduranga and
Jeffery Kinnison and
Jonathan D. Hauenstein and
Walter J. Scheirer},
title = {{NCQS:} Nonlinear Convex Quadrature Surrogate Hyperparameter Optimization},
booktitle = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023
- Workshops, Paris, France, October 2-6, 2023},
pages = {1187--1195},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCVW60793.2023.00129},
doi = {10.1109/ICCVW60793.2023.00129},
timestamp = {Wed, 10 Jan 2024 14:20:12 +0100},
biburl = {https://dblp.org/rec/conf/iccvw/AbrahamMKHS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/AttiehZVFB23,
author = {Joseph Attieh and
Abraham Woubie Zewoudie and
Vladimir Vlassov and
Adrian Flanagan and
Tom B{\"{a}}ckstr{\"{o}}m},
editor = {Gernot A. Fink and
Rajiv Jain and
Koichi Kise and
Richard Zanibbi},
title = {Optimizing the Performance of Text Classification Models by Improving
the Isotropy of the Embeddings Using a Joint Loss Function},
booktitle = {Document Analysis and Recognition - {ICDAR} 2023 - 17th International
Conference, San Jos{\'{e}}, CA, USA, August 21-26, 2023, Proceedings,
Part {V}},
series = {Lecture Notes in Computer Science},
volume = {14191},
pages = {121--136},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-41734-4\_8},
doi = {10.1007/978-3-031-41734-4\_8},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icdar/AttiehZVFB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icibe/FelixCG23,
author = {Melani Daniela Pablo Felix and
Abraham Moises Pillaca Castro and
Jos{\'{e}} Antonio Taqu{\'{\i}}a Guti{\'{e}}rrez},
title = {Customer Analysis Using the {RFM} Methodology in {A} Dental Clinic},
booktitle = {Proceedings of the 2023 9th International Conference on Industrial
and Business Engineering, {ICIBE} 2023, Beijing, China, September
22-24, 2023},
pages = {454--458},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3629378.3629441},
doi = {10.1145/3629378.3629441},
timestamp = {Sun, 31 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icibe/FelixCG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/SimonKLGFA23,
author = {James B. Simon and
Maksis Knutins and
Ziyin Liu and
Daniel Geisz and
Abraham J. Fetterman and
Joshua Albrecht},
editor = {Andreas Krause and
Emma Brunskill and
Kyunghyun Cho and
Barbara Engelhardt and
Sivan Sabato and
Jonathan Scarlett},
title = {On the Stepwise Nature of Self-Supervised Learning},
booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
2023, Honolulu, Hawaii, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {202},
pages = {31852--31876},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v202/simon23a.html},
timestamp = {Mon, 28 Aug 2023 17:23:08 +0200},
biburl = {https://dblp.org/rec/conf/icml/SimonKLGFA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/AlcaidePVAKLF23,
author = {Abraham Marquez Alcaide and
Pablo Poblete and
Sergio Vazquez and
Ricardo P. Aguilera and
Samir Kouro and
Jos{\'{e}} I. Leon and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Feed-Forward Technique to Emulate Natural Sampling Method for Cascaded
H-Bridge Converters},
booktitle = {49th Annual Conference of the {IEEE} Industrial Electronics Society,
{IECON} 2023, Singapore, October 16-19, 2023},
pages = {1--7},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IECON51785.2023.10312396},
doi = {10.1109/IECON51785.2023.10312396},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iecon/AlcaidePVAKLF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifm/AbrahamKR23,
author = {Erika {\'{A}}brah{\'{a}}m and
J{\'{o}}zsef Kov{\'{a}}cs and
Anne Remke},
editor = {Paula Herber and
Anton Wijs},
title = {{SMT:} Something You Must Try},
booktitle = {iFM 2023 - 18th International Conference, iFM 2023, Leiden, The Netherlands,
November 13-15, 2023, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {14300},
pages = {3--18},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-47705-8\_1},
doi = {10.1007/978-3-031-47705-8\_1},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifm/AbrahamKR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RasmussenATSGWB23,
author = {Peter Rasmussen and
Jenna Abrahamson and
Xiaojing Tang and
Owen Smith and
Josh Gray and
Curtis Woodcock and
Marc Bosch},
title = {Assessment of Performance of Tree-Based Algorithms to Reduce Errors
of Omisssion and Commission in Change Detection},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {6676--6679},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10283320},
doi = {10.1109/IGARSS52108.2023.10283320},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/RasmussenATSGWB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/AdelaniMAATMODONEASDNMANOOOMMASYGABA23,
author = {David Ifeoluwa Adelani and
Marek Masiak and
Israel Abebe Azime and
Jesujoba O. Alabi and
Atnafu Lambebo Tonja and
Christine Mwase and
Odunayo Ogundepo and
Bonaventure F. P. Dossou and
Akintunde Oladipo and
Doreen Nixdorf and
Chris Chinenye Emezue and
Sana Sabah Al{-}Azzawi and
Blessing K. Sibanda and
Davis David and
Lolwethu Ndolela and
Jonathan Mukiibi and
Tunde Ajayi and
Tatiana Moteu Ngoli and
Brian Odhiambo and
Abraham Toluwase Owodunni and
Nnaemeka C. Obiefuna and
Muhidin Mohamed and
Shamsuddeen Hassan Muhammad and
Teshome Mulugeta Ababu and
Saheed Abdullahi Salahudeen and
Mesay Gemeda Yigezu and
Tajuddeen Gwadabe and
Idris Abdulmumin and
Mahlet Taye Bame and
Oluwabusayo Olufunke Awoyomi and
Iyanuoluwa Shode and
Tolulope Anu Adelani and
Habiba Abdulganiyu and
Abdul{-}Hakeem Omotayo and
Adetola Adeeko and
Afolabi Abeeb and
Aremu Anuoluwapo and
Samuel Olanrewaju and
Clemencia Siro and
Wangari Kimotho and
Onyekachi Raphael Ogbu and
Chinedu E. Mbonu and
Chiamaka Chukwuneke and
Samuel Fanijo and
Jessica Ojo and
Oyinkansola Awosan and
Tadesse Kebede Guge and
Sakayo Toadoum Sari and
Pamela Nyatsine and
Freedmore Sidume and
Oreen Yousuf and
Mardiyyah Oduwole and
Kanda Patrick Tshinu and
Ussen Kimanuka and
Thina Diko and
Siyanda Nxakama and
Sinodos G. Nugussie and
Abdulmejid Tuni Johar and
Shafie Abdi Mohamed and
Fuad Mire Hassan and
Moges Ahmed Mehamed and
Evrard Ngabire and
Jules Jules and
Ivan Ssenkungu and
Pontus Stenetorp},
editor = {Jong C. Park and
Yuki Arase and
Baotian Hu and
Wei Lu and
Derry Wijaya and
Ayu Purwarianti and
Adila Alfa Krisnadhi},
title = {MasakhaNEWS: News Topic Classification for African languages},
booktitle = {Proceedings of the 13th International Joint Conference on Natural
Language Processing and the 3rd Conference of the Asia-Pacific Chapter
of the Association for Computational Linguistics, {IJCNLP} 2023 -Volume
1: Long Papers, Nusa Dua, Bali, November 1 - 4, 2023},
pages = {144--159},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.ijcnlp-main.10},
doi = {10.18653/V1/2023.IJCNLP-MAIN.10},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/AdelaniMAATMODONEASDNMANOOOMMASYGABA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggrapha/JohnsonCLBKG23,
author = {Joel Johnson and
Kenneth J. Chau and
Wei Sen Loi and
Abraham Beauferris and
Swati Kanwal and
Yingqian Gu},
editor = {June Kim and
Rajesh Sharma},
title = {Deep Albedo: {A} Spatially Aware Autoencoder Approach to Interactive
Human Skin Rendering},
booktitle = {{SIGGRAPH} Asia 2023 Posters, Sydney, NSW, Australia, December 12-15,
2023},
pages = {13:1--13:2},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3610542.3626112},
doi = {10.1145/3610542.3626112},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/siggrapha/JohnsonCLBKG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sp/BitaabCOLWAWBSD23,
author = {Marzieh Bitaab and
Haehyun Cho and
Adam Oest and
Zhuoer Lyu and
Wei Wang and
Jorij Abraham and
Ruoyu Wang and
Tiffany Bao and
Yan Shoshitaishvili and
Adam Doup{\'{e}}},
title = {Beyond Phish: Toward Detecting Fraudulent e-Commerce Websites at Scale},
booktitle = {44th {IEEE} Symposium on Security and Privacy, {SP} 2023, San Francisco,
CA, USA, May 21-25, 2023},
pages = {2566--2583},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SP46215.2023.10179461},
doi = {10.1109/SP46215.2023.10179461},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sp/BitaabCOLWAWBSD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssw/Louw23,
author = {Johannes A. Louw},
editor = {G{\'{e}}rard Bailly and
Thomas Hueber and
Damien Lolive and
Nicolas Obin and
Olivier Perrotin},
title = {Cross-lingual transfer using phonological features for resource-scarce
text-to-speech},
booktitle = {12th {ISCA} Speech Synthesis Workshop, {SSW} 2023, Grenoble, France,
August 26-28, 2023},
pages = {55--61},
publisher = {{ISCA}},
year = {2023},
url = {https://doi.org/10.21437/SSW.2023-9},
doi = {10.21437/SSW.2023-9},
timestamp = {Fri, 02 Aug 2024 11:49:04 +0200},
biburl = {https://dblp.org/rec/conf/ssw/Louw23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tagml/PapillonHMFZJMHSPGRLDRBSNZBGBMBBSANTS23,
author = {Mathilde Papillon and
Mustafa Hajij and
Audun Myers and
Florian Frantzen and
Ghada Zamzmi and
Helen Jenne and
Johan Mathe and
Josef Hoppe and
Michael T. Schaub and
Theodore Papamarkou and
Aldo Guzm{\'{a}}n{-}S{\'{a}}enz and
Bastian Rieck and
Neal Livesay and
Tamal K. Dey and
Abraham Rabinowitz and
Aiden Brent and
Alessandro Salatiello and
Alexander Nikitin and
Ali Zia and
Claudio Battiloro and
Dmitrii Gavrilev and
Georg B{\"{o}}kman and
German Magai and
Gleb Bazhenov and
Guillermo Bern{\'{a}}rdez and
Indro Spinelli and
Jens Agerberg and
Kalyan Varma Nadimpalli and
Lev Telyatnikov and
Luca Scofano and
Lucia Testa and
Manuel Lecha and
Maosheng Yang and
Mohammed Hassanin and
Odin Hoff Gardaa and
Olga Zaghen and
Paul H{\"{a}}usner and
Paul Snopoff and
Pavlo Melnyk and
Rub{\'{e}}n Ballester and
Sadrodin Barikbin and
Sergio Escalera and
Simone Fiorellino and
Henry Kvinge and
Jan Meissner and
Karthikeyan Natesan Ramamurthy and
Michael Scholkemper and
Paul Rosen and
Robin Walters and
Shreyas N. Samaga and
Soham Mukherjee and
Sophia Sanborn and
Tegan Emerson and
Timothy Doster and
Tolga Birdal and
Vincent P. Grande and
Abdelwahed Khamis and
Simone Scardapane and
Suraj Singh and
Tatiana Malygina and
Yixiao Yue and
Nina Miolane},
editor = {Timothy Doster and
Tegan Emerson and
Henry Kvinge and
Nina Miolane and
Mathilde Papillon and
Bastian Rieck and
Sophia Sanborn},
title = {{ICML} 2023 Topological Deep Learning Challenge: Design and Results},
booktitle = {Topological, Algebraic and Geometric Learning Workshops 2023, 28 July
2023, Honolulu, HI, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {221},
pages = {3--8},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v221/papillon23a.html},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tagml/PapillonHMFZJMHSPGRLDRBSNZBGBMBBSANTS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tase/DelicarisSAR23,
author = {Joanna Delicaris and
Stefan Schupp and
Erika {\'{A}}brah{\'{a}}m and
Anne Remke},
editor = {Cristina David and
Meng Sun},
title = {Maximizing Reachability Probabilities in Rectangular Automata with
Random Clocks},
booktitle = {Theoretical Aspects of Software Engineering - 17th International Symposium,
{TASE} 2023, Bristol, UK, July 4-6, 2023, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13931},
pages = {164--182},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-35257-7\_10},
doi = {10.1007/978-3-031-35257-7\_10},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tase/DelicarisSAR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wdag/AbrahamDEH23,
author = {Ittai Abraham and
Danny Dolev and
Ittay Eyal and
Joseph Y. Halpern},
editor = {Rotem Oshman},
title = {Colordag: An Incentive-Compatible Blockchain},
booktitle = {37th International Symposium on Distributed Computing, {DISC} 2023,
October 10-12, 2023, L'Aquila, Italy},
series = {LIPIcs},
volume = {281},
pages = {1:1--1:22},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2023},
url = {https://doi.org/10.4230/LIPIcs.DISC.2023.1},
doi = {10.4230/LIPICS.DISC.2023.1},
timestamp = {Wed, 21 Aug 2024 22:46:00 +0200},
biburl = {https://dblp.org/rec/conf/wdag/AbrahamDEH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/23/Davila-NicanorJVML23,
author = {Leticia D{\'{a}}vila{-}Nicanor and
Irene Aguilar Juarez and
Joel Ayala de la Vega and
Abraham Banda Madrid and
Sochitl Cruz L{\'{o}}pez},
editor = {Kendra M. L. Cooper and
Antonio Bucchiarone},
title = {Performance on Software Architecture Design to Serious Games for Mobile
Devices},
booktitle = {Software Engineering for Games in Serious Contexts - Theories, Methods,
Tools, and Experiences},
pages = {63--84},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-33338-5\_4},
doi = {10.1007/978-3-031-33338-5\_4},
timestamp = {Tue, 07 May 2024 19:59:13 +0200},
biburl = {https://dblp.org/rec/books/sp/23/Davila-NicanorJVML23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-15438,
author = {James B. Simon and
Maksis Knutins and
Ziyin Liu and
Daniel Geisz and
Abraham J. Fetterman and
Joshua Albrecht},
title = {On the stepwise nature of self-supervised learning},
journal = {CoRR},
volume = {abs/2303.15438},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.15438},
doi = {10.48550/ARXIV.2303.15438},
eprinttype = {arXiv},
eprint = {2303.15438},
timestamp = {Fri, 14 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-15438.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-05246,
author = {William Jonas and
Alexandre Abraham and
L{\'{e}}o Dreyfus{-}Schmidt},
title = {OpenAL: Evaluation and Interpretation of Active Learning Strategies},
journal = {CoRR},
volume = {abs/2304.05246},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.05246},
doi = {10.48550/ARXIV.2304.05246},
eprinttype = {arXiv},
eprint = {2304.05246},
timestamp = {Wed, 19 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-05246.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-09972,
author = {David Ifeoluwa Adelani and
Marek Masiak and
Israel Abebe Azime and
Jesujoba Oluwadara Alabi and
Atnafu Lambebo Tonja and
Christine Mwase and
Odunayo Ogundepo and
Bonaventure F. P. Dossou and
Akintunde Oladipo and
Doreen Nixdorf and
Chris Chinenye Emezue and
Sana Sabah Al{-}Azzawi and
Blessing K. Sibanda and
Davis David and
Lolwethu Ndolela and
Jonathan Mukiibi and
Tunde Oluwaseyi Ajayi and
Tatiana Moteu Ngoli and
Brian Odhiambo and
Abraham Toluwase Owodunni and
Nnaemeka C. Obiefuna and
Shamsuddeen Hassan Muhammad and
Saheed Abdullahi Salahudeen and
Mesay Gemeda Yigezu and
Tajuddeen Gwadabe and
Idris Abdulmumin and
Mahlet Taye Bame and
Oluwabusayo Olufunke Awoyomi and
Iyanuoluwa Shode and
Tolulope Anu Adelani and
Habiba Abdulganiy Kailani and
Abdul{-}Hakeem Omotayo and
Adetola Adeeko and
Afolabi Abeeb and
Aremu Anuoluwapo and
Samuel Olanrewaju and
Clemencia Siro and
Wangari Kimotho and
Onyekachi Raphael Ogbu and
Chinedu E. Mbonu and
Chiamaka Chukwuneke and
Samuel Fanijo and
Jessica Ojo and
Oyinkansola Awosan and
Tadesse Kebede Guge and
Sakayo Toadoum Sari and
Pamela Nyatsine and
Freedmore Sidume and
Oreen Yousuf and
Mardiyyah Oduwole and
Ussen Kimanuka and
Kanda Patrick Tshinu and
Thina Diko and
Siyanda Nxakama and
Abdulmejid Tuni Johar and
Sinodos Gebre and
Muhidin Mohamed and
Shafie Abdi Mohamed and
Fuad Mire Hassan and
Moges Ahmed Mehamed and
Evrard Ngabire and
Pontus Stenetorp},
title = {MasakhaNEWS: News Topic Classification for African languages},
journal = {CoRR},
volume = {abs/2304.09972},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.09972},
doi = {10.48550/ARXIV.2304.09972},
eprinttype = {arXiv},
eprint = {2304.09972},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-09972.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-14996,
author = {Joanna Delicaris and
Stefan Schupp and
Erika {\'{A}}brah{\'{a}}m and
Anne Remke},
title = {Maximizing Reachability Probabilities in Rectangular Automata with
Random Clocks},
journal = {CoRR},
volume = {abs/2304.14996},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.14996},
doi = {10.48550/ARXIV.2304.14996},
eprinttype = {arXiv},
eprint = {2304.14996},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-14996.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-06897,
author = {Odunayo Ogundepo and
Tajuddeen R. Gwadabe and
Clara E. Rivera and
Jonathan H. Clark and
Sebastian Ruder and
David Ifeoluwa Adelani and
Bonaventure F. P. Dossou and
Abdou Aziz Diop and
Claytone Sikasote and
Gilles Hacheme and
Happy Buzaaba and
Ignatius Ezeani and
Rooweither Mabuya and
Salomey Osei and
Chris Emezue and
Albert Njoroge Kahira and
Shamsuddeen Hassan Muhammad and
Akintunde Oladipo and
Abraham Toluwase Owodunni and
Atnafu Lambebo Tonja and
Iyanuoluwa Shode and
Akari Asai and
Tunde Oluwaseyi Ajayi and
Clemencia Siro and
Steven Arthur and
Mofetoluwa Adeyemi and
Orevaoghene Ahia and
Aremu Anuoluwapo and
Oyinkansola Awosan and
Chiamaka Chukwuneke and
Bernard Opoku and
Awokoya Ayodele and
Verrah Otiende and
Christine Mwase and
Boyd Sinkala and
Andre Niyongabo Rubungo and
Daniel A. Ajisafe and
Emeka Felix Onwuegbuzia and
Habib Mbow and
Emile Niyomutabazi and
Eunice Mukonde and
Falalu Ibrahim Lawan and
Ibrahim Said Ahmad and
Jesujoba O. Alabi and
Martin Namukombo and
Chinedu Emmanuel Mbonu and
Mofya Phiri and
Neo Putini and
Ndumiso Mngoma and
Priscilla A. Amuok and
Ruqayya Nasir Iro and
Sonia Adhiambo},
title = {AfriQA: Cross-lingual Open-Retrieval Question Answering for African
Languages},
journal = {CoRR},
volume = {abs/2305.06897},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.06897},
doi = {10.48550/ARXIV.2305.06897},
eprinttype = {arXiv},
eprint = {2305.06897},
timestamp = {Wed, 06 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-06897.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-08055,
author = {Abraham J. Fetterman and
Ellie Kitanidis and
Joshua Albrecht and
Zachary Polizzi and
Bryden Fogelman and
Maksis Knutins and
Bartosz Wr{\'{o}}blewski and
James B. Simon and
Kanjun Qiu},
title = {Tune As You Scale: Hyperparameter Optimization For Compute Efficient
Training},
journal = {CoRR},
volume = {abs/2306.08055},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.08055},
doi = {10.48550/ARXIV.2306.08055},
eprinttype = {arXiv},
eprint = {2306.08055},
timestamp = {Sun, 18 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-08055.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-02715,
author = {Jong Hoon Park and
Gauri Pramod Dalwankar and
Alison Bartsch and
Abraham George and
Amir Barati Farimani},
title = {Fluid Property Prediction Leveraging {AI} and Robotics},
journal = {CoRR},
volume = {abs/2308.02715},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.02715},
doi = {10.48550/ARXIV.2308.02715},
eprinttype = {arXiv},
eprint = {2308.02715},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-02715.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-03317,
author = {Sophia J. Abraham and
Kehelwala D. G. Maduranga and
Jeffery Kinnison and
Zachariah Carmichael and
Jonathan D. Hauenstein and
Walter J. Scheirer},
title = {HomOpt: {A} Homotopy-Based Hyperparameter Optimization Method},
journal = {CoRR},
volume = {abs/2308.03317},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.03317},
doi = {10.48550/ARXIV.2308.03317},
eprinttype = {arXiv},
eprint = {2308.03317},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-03317.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-11379,
author = {Ittai Abraham and
Danny Dolev and
Ittay Eyal and
Joseph Y. Halpern},
title = {Colordag: An Incentive-Compatible Blockchain},
journal = {CoRR},
volume = {abs/2308.11379},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.11379},
doi = {10.48550/ARXIV.2308.11379},
eprinttype = {arXiv},
eprint = {2308.11379},
timestamp = {Wed, 30 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-11379.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-18648,
author = {Anh Nguyen{-}Duc and
Beatriz Cabrero Daniel and
Adam Przybylek and
Chetan Arora and
Dron Khanna and
Tomas Herda and
Usman Rafiq and
Jorge Melegati and
Eduardo Guerra and
Kai{-}Kristian Kemell and
Mika Saari and
Zheying Zhang and
Huy Le and
Tho Quan and
Pekka Abrahamsson},
title = {Generative Artificial Intelligence for Software Engineering - {A}
Research Agenda},
journal = {CoRR},
volume = {abs/2310.18648},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.18648},
doi = {10.48550/ARXIV.2310.18648},
eprinttype = {arXiv},
eprint = {2310.18648},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-18648.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-10631,
author = {Mikkel Abrahamsen and
Joakim Blikstad and
Andr{\'{e}} Nusser and
Hanwen Zhang},
title = {Minimum Star Partitions of Simple Polygons in Polynomial Time},
journal = {CoRR},
volume = {abs/2311.10631},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.10631},
doi = {10.48550/ARXIV.2311.10631},
eprinttype = {arXiv},
eprint = {2311.10631},
timestamp = {Wed, 22 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-10631.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-07348,
author = {Lin Kyi and
Abraham Mhaidli and
Cristiana Teixeira Santos and
Franziska Roesner and
Asia Biega},
title = {"It doesn't tell me anything about how my data is used": User Perceptions
of Data Collection Purposes},
journal = {CoRR},
volume = {abs/2312.07348},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.07348},
doi = {10.48550/ARXIV.2312.07348},
eprinttype = {arXiv},
eprint = {2312.07348},
timestamp = {Thu, 04 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-07348.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dagstuhl-reports/AbrahamHHSW23,
author = {Erika {\'{A}}brah{\'{a}}m and
Stefan Hallerstede and
John Hatcliff and
Danielle Stewart and
Noah {Abou El Wafa}},
title = {Integrated Rigorous Analysis in Cyber-Physical Systems Engineering
(Dagstuhl Seminar 23041)},
journal = {Dagstuhl Reports},
volume = {13},
number = {1},
pages = {155--183},
year = {2023},
url = {https://doi.org/10.4230/DagRep.13.1.155},
doi = {10.4230/DAGREP.13.1.155},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dagstuhl-reports/AbrahamHHSW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AlcaideGZMRLVF22,
author = {Abraham Marquez Alcaide and
Rub{\'{e}}n G{\'{o}}mez{-}Merch{\'{a}}n and
Eduardo Zafra and
Emilia Perez Martin and
Juan M. Lopez Rodriguez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {The Influence of {MPPT} Algorithms in the Lifespan of the Capacitor
Across the {PV} Array},
journal = {{IEEE} Access},
volume = {10},
pages = {40945--40952},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3164411},
doi = {10.1109/ACCESS.2022.3164411},
timestamp = {Thu, 20 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/AlcaideGZMRLVF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/MapundaSBC22,
author = {Galefang Allycan Mapunda and
Abraham Sanenga and
Bokamoso Basutli and
Joseph Monamati Chuma},
title = {Optimization of a Color-Based Spatial Modulation Scheme for {VLC}
Under Illuminance and {SINR} Constraints},
journal = {{IEEE} Access},
volume = {10},
pages = {119970--119984},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3221747},
doi = {10.1109/ACCESS.2022.3221747},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/MapundaSBC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SelvamKRAMWS22,
author = {Prabu Selvam and
Joseph Abraham Sundar Koilraj and
Carlos Andr{\'{e}}s Tavera Romero and
Meshal Alharbi and
Abolfazl Mehbodniya and
Julian L. Webber and
Sudhakar Sengan},
title = {A Transformer-Based Framework for Scene Text Recognition},
journal = {{IEEE} Access},
volume = {10},
pages = {100895--100910},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3207469},
doi = {10.1109/ACCESS.2022.3207469},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SelvamKRAMWS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/anor/KungwalsongMKPM22,
author = {Kanokporn Kungwalsong and
Abraham Mendoza and
Vasanth Kamath and
Subramanian Pazhani and
Jos{\'{e}} Antonio Marmolejo{-}Saucedo},
title = {An application of interactive fuzzy optimization model for redesigning
supply chain for resilience},
journal = {Ann. Oper. Res.},
volume = {315},
number = {2},
pages = {1803--1839},
year = {2022},
url = {https://doi.org/10.1007/s10479-022-04542-5},
doi = {10.1007/S10479-022-04542-5},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/anor/KungwalsongMKPM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/anor/VenturaGML22,
author = {Jos{\'{e}} A. Ventura and
Boaz Golany and
Abraham Mendoza and
Chenxi Li},
title = {A multi-product dynamic supply chain inventory model with supplier
selection, joint replenishment, and transportation cost},
journal = {Ann. Oper. Res.},
volume = {316},
number = {2},
pages = {729--762},
year = {2022},
url = {https://doi.org/10.1007/s10479-021-04508-z},
doi = {10.1007/S10479-021-04508-Z},
timestamp = {Thu, 22 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/anor/VenturaGML22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/HahnLPANHCKBRWL22,
author = {Georg Hahn and
Sanghun Lee and
Dmitry Prokopenko and
Jonathan Abraham and
Tanya Novak and
Julian Hecker and
Michael H. Cho and
Surender Khurana and
Lindsey R. Baden and
Adrienne G. Randolph and
Scott T. Weiss and
Christoph Lange},
title = {Unsupervised outlier detection applied to SARS-CoV-2 nucleotide sequences
can identify sequences of common variants and other variants of interest},
journal = {{BMC} Bioinform.},
volume = {23},
number = {1},
pages = {547},
year = {2022},
url = {https://doi.org/10.1186/s12859-022-05105-y},
doi = {10.1186/S12859-022-05105-Y},
timestamp = {Wed, 31 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/HahnLPANHCKBRWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/ChakrabortyBBMM22,
author = {Rajkumar Chakraborty and
Gourab Bhattacharje and
Joydeep Baral and
Bharat Manna and
Jayati Mullick and
Basavaraj S. Mathapati and
Priya Abraham and
Madhumathi J and
Yasha Hasija and
Amit Ghosh and
Amit Kumar Das},
title = {\emph{In-silico} screening and \emph{in-vitro} assay show the antiviral
effect of Indomethacin against SARS-CoV-2},
journal = {Comput. Biol. Medicine},
volume = {147},
pages = {105788},
year = {2022},
url = {https://doi.org/10.1016/j.compbiomed.2022.105788},
doi = {10.1016/J.COMPBIOMED.2022.105788},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/ChakrabortyBBMM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Aguilar-Jauregui22,
author = {Mar{\'{\i}}a Elena Aguilar{-}J{\'{a}}uregui and
Jos{\'{e}} Abraham Balderas L{\'{o}}pez and
Eduardo San Mart{\'{\i}}n{-}Martinez},
title = {Synthesis and Characterization of ZnS Nanoparticles and Effects of
Nanoparticle Size on Optical Properties},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {26},
number = {2},
year = {2022},
url = {https://cys.cic.ipn.mx/ojs/index.php/CyS/article/view/4292},
timestamp = {Fri, 11 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cys/Aguilar-Jauregui22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dint/HidalgaDXMEGMC22,
author = {Abraham Nieva de la Hidalga and
Donato Decarolis and
Shaojun Xu and
Santhosh Matam and
Willinton Yesid Hern{\'{a}}ndez Enciso and
Josephine Goodall and
Brian Matthews and
C. Richard A. Catlow},
title = {A Workflow Demonstrator for Processing Catalysis Research Data},
journal = {Data Intell.},
volume = {4},
number = {2},
pages = {455--470},
year = {2022},
url = {https://doi.org/10.1162/dint\_a\_00143},
doi = {10.1162/DINT\_A\_00143},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dint/HidalgaDXMEGMC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eait/Barron-EstradaZ22,
author = {Mar{\'{\i}}a Luc{\'{\i}}a Barr{\'{o}}n{-}Estrada and
Ram{\'{o}}n Zatara{\'{\i}}n{-}Cabada and
Jorge Abraham Romero{-}Polo and
Julieta Noguez{-}Monroy},
title = {Patrony: {A} mobile application for pattern recognition learning},
journal = {Educ. Inf. Technol.},
volume = {27},
number = {1},
pages = {1237--1260},
year = {2022},
url = {https://doi.org/10.1007/s10639-021-10636-7},
doi = {10.1007/S10639-021-10636-7},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eait/Barron-EstradaZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AbrahamKH22,
author = {Joanna Abraham and
Madhumitha Kandasamy and
Ashley Huggins},
title = {Articulation of postsurgical patient discharges: coordinating care
transitions from hospital to home},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {9},
pages = {1546--1558},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocac099},
doi = {10.1093/JAMIA/OCAC099},
timestamp = {Sat, 10 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/AbrahamKH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AbrahamMOPWGHKA22,
author = {Joanna Abraham and
Alicia Meng and
Arianna Montes de Oca and
Mary C. Politi and
Troy Wildes and
Stephen Gregory and
Bernadette Henrichs and
Thomas George Kannampallil and
Michael S. Avidan},
title = {An ethnographic study on the impact of a novel telemedicine-based
support system in the operating room},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {11},
pages = {1919--1930},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocac138},
doi = {10.1093/JAMIA/OCAC138},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/AbrahamMOPWGHKA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AbrahamMTKK22,
author = {Joanna Abraham and
Alicia Meng and
Sanjna Tripathy and
Spyros Kitsiou and
Thomas George Kannampallil},
title = {Effect of health information technology (HIT)-based discharge transition
interventions on patient readmissions and emergency room visits: a
systematic review},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {4},
pages = {735--748},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocac013},
doi = {10.1093/JAMIA/OCAC013},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/AbrahamMTKK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AtwoliEGHNKLMMM22,
author = {Lukoye Atwoli and
Gregory E. Erhabor and
Aiah A Gbakima and
Abraham Haileamlak and
Jean{-}Marie Kayembe Ntumba and
James Kigera and
Laurie Laybourn{-}Langton and
Robert Mash and
Joy Muhia and
Fhumulani Mavis Mulaudzi and
David Ofori{-}Adjei and
Friday Okonofua and
Arash Rashidian and
Maha El{-}Adawy and
Siaka Sidib{\'{e}} and
Abdelmadjid Snouber and
James Tumwine and
Mohammad Sahar Yassien and
Paul Yonga and
Lilia Zakhama and
Chris Zielinski},
title = {{COP27} Climate Change Conference: urgent action needed for Africa
and the world},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {12},
pages = {2000--2002},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocac190},
doi = {10.1093/JAMIA/OCAC190},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/AtwoliEGHNKLMMM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/BurtonVSANKHHB22,
author = {Shirley Burton and
Annette L. Valenta and
Justin Starren and
Joanna Abraham and
Therese A. Nelson and
Karl Kochendorfer and
Ashley Hughes and
Bhrandon Harris and
Andrew D. Boyd},
title = {Examining perspectives on the adoption and use of computer-based patient-reported
outcomes among clinicians and health professionals: a {Q} methodology
study},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {3},
pages = {443--452},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocab257},
doi = {10.1093/JAMIA/OCAB257},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/BurtonVSANKHHB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/WeiKTSPDBA22,
author = {Duo (Helen) Wei and
Polina V. Kukhareva and
Donghua Tao and
Margarita Sordo and
Deepti Pandita and
Prerna Dua and
Imon Banerjee and
Joanna Abraham},
title = {Assessing perceived effectiveness of career development efforts led
by the women in American Medical Informatics Association Initiative},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {9},
pages = {1593--1606},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocac101},
doi = {10.1093/JAMIA/OCAC101},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/WeiKTSPDBA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/ZhongBBWS22,
author = {Jie Zhong and
Jonelle Boafo and
Abraham Brody and
Bei Wu and
Tina Sadarangani},
title = {A qualitative analysis of communication workflows between adult day
service centers and primary care providers},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {5},
pages = {882--890},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocab284},
doi = {10.1093/JAMIA/OCAB284},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/ZhongBBWS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsan/PrabhakarPABJKN22,
author = {Ashish John Prabhakar and
Srikanth Prabhu and
Aayush Agrawal and
Siddhisa Banerjee and
Abraham M. Joshua and
Yogeesh Dattakumar Kamat and
Gopal Nath and
Saptarshi Sengupta},
title = {Use of Machine Learning for Early Detection of Knee Osteoarthritis
and Quantifying Effectiveness of Treatment Using Force Platform},
journal = {J. Sens. Actuator Networks},
volume = {11},
number = {3},
pages = {48},
year = {2022},
url = {https://doi.org/10.3390/jsan11030048},
doi = {10.3390/JSAN11030048},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsan/PrabhakarPABJKN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/GabiDMAUZZ22,
author = {Danlami Gabi and
Nasiru Muhammed Dankolo and
Abubakar Atiku Muslim and
Ajith Abraham and
Mohammed Joda Usman and
Anazida Zainal and
Zalmiyah Zakaria},
title = {Dynamic scheduling of heterogeneous resources across mobile edge-cloud
continuum using fruit fly-based simulated annealing optimization scheme},
journal = {Neural Comput. Appl.},
volume = {34},
number = {16},
pages = {14085--14105},
year = {2022},
url = {https://doi.org/10.1007/s00521-022-07260-y},
doi = {10.1007/S00521-022-07260-Y},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nca/GabiDMAUZZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RichardsonFMAF22,
author = {David P. Richardson and
John J. Foxe and
Kevin A. Mazurek and
Nicholas Abraham and
Edward G. Freedman},
title = {Neural markers of proactive and reactive cognitive control are altered
during walking: {A} Mobile Brain-Body Imaging (MoBI) study},
journal = {NeuroImage},
volume = {247},
pages = {118853},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2021.118853},
doi = {10.1016/J.NEUROIMAGE.2021.118853},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/RichardsonFMAF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/StrainBTGMDMCGD22,
author = {Jeremy F. Strain and
Matthew R. Brier and
Aaron Tanenbaum and
Brian A. Gordon and
John E. McCarthy and
Aylin Dincer and
Daniel S. Marcus and
Jasmeer P. Chhatwal and
Neill R. Graff{-}Radford and
Gregory S. Day and
Christian la Foug{\`{e}}re and
Richard J. Perrin and
Stephen P. Salloway and
Peter R. Schofield and
Igor Yakushev and
Takeshi Ikeuchi and
Jonathan V{\"{o}}glein and
John C. Morris and
Tammie L. S. Benzinger and
Randall J. Bateman and
Beau M. Ances and
Abraham Z. Snyder},
title = {Covariance-based vs. correlation-based functional connectivity dissociates
healthy aging from Alzheimer disease},
journal = {NeuroImage},
volume = {261},
pages = {119511},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2022.119511},
doi = {10.1016/J.NEUROIMAGE.2022.119511},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/StrainBTGMDMCGD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/TraczWPKPTARLPJ22,
author = {Jovanna A. Tracz and
Lukas Wille and
Dylan Pathiraja and
Savita V. Kendre and
Ron Pfisterer and
Ethan Turett and
Christoffer K. Abrahamsson and
Samuel E. Root and
Won{-}Kyu Lee and
Daniel J. Preston and
Haihui Joy Jiang and
George M. Whitesides and
Markus P. Nemitz},
title = {Tube-Balloon Logic for the Exploration of Fluidic Control Elements},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {7},
number = {2},
pages = {5483--5488},
year = {2022},
url = {https://doi.org/10.1109/LRA.2022.3156174},
doi = {10.1109/LRA.2022.3156174},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ral/TraczWPKPTARLPJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/AbrahamDZMFM22,
author = {Lizy Abraham and
Steven Davy and
Muhammad Zawish and
Rahul Umesh Mhapsekar and
John A. Finn and
Patrick Moran},
title = {Preliminary Classification of Selected Farmland Habitats in Ireland
Using Deep Neural Networks},
journal = {Sensors},
volume = {22},
number = {6},
pages = {2190},
year = {2022},
url = {https://doi.org/10.3390/s22062190},
doi = {10.3390/S22062190},
timestamp = {Mon, 10 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/AbrahamDZMFM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/Cantu-GonzalezH22,
author = {Jos{\'{e}} Roberto Cant{\'{u}}{-}Gonz{\'{a}}lez and
Filiberto Hueyotl{-}Zahuantitla and
Jes{\'{u}}s Abraham Castorena{-}Pe{\~{n}}a and
Mario A. Aguirre{-}L{\'{o}}pez},
title = {The Attack-Block-Court Defense Algorithm: {A} New Volleyball Index
Supported by Data Science},
journal = {Symmetry},
volume = {14},
number = {8},
pages = {1499},
year = {2022},
url = {https://doi.org/10.3390/sym14081499},
doi = {10.3390/SYM14081499},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/Cantu-GonzalezH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/te/AsfawBBCCCCDDEE22,
author = {Abraham Asfaw and
Alexandre Blais and
Kenneth R. Brown and
Jonathan Candelaria and
Christopher Cantwell and
Lincoln D. Carr and
Joshua Combes and
Dripto M. Debroy and
John M. Donohue and
Sophia E. Economou and
Emily Edwards and
Michael F. J. Fox and
Steven M. Girvin and
Alan Ho and
Hilary M. Hurst and
Zubin Jacob and
Blake R. Johnson and
Ezekiel Johnston{-}Halperin and
Robert Joynt and
Eliot Kapit and
Judith Klein{-}Seetharaman and
Martin Laforest and
H. J. Lewandowski and
Theresa W. Lynn and
Corey Rae H. McRae and
Celia Merzbacher and
Spyridon Michalakis and
Prineha Narang and
William D. Oliver and
Jens Palsberg and
David P. Pappas and
Michael G. Raymer and
David J. Reilly and
Mark Saffman and
Thomas A. Searles and
Jeffrey H. Shapiro and
Chandralekha Singh},
title = {Building a Quantum Engineering Undergraduate Program},
journal = {{IEEE} Trans. Educ.},
volume = {65},
number = {2},
pages = {220--242},
year = {2022},
url = {https://doi.org/10.1109/TE.2022.3144943},
doi = {10.1109/TE.2022.3144943},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/te/AsfawBBCCCCDDEE22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/KimAABCFHKLLLMORSSSY22,
author = {Edward Kim and
Saji Abraham and
Joel Amato and
William J. Blackwell and
Peter Cho and
James Fuentes and
Mark Hernquist and
James Kam and
Robert Vincent Leslie and
Quanhua (Mark) Liu and
Cheng{-}Hsuan Lyu and
Taichien Mao and
Idahosa A. Osaretin and
Fabian Rodriguez{-}Gutierrez and
Matthew Sammons and
Craig K. Smith and
Ninghai Sun and
Hu Yang},
title = {An Evaluation of {NOAA-20} {ATMS} Instrument Pre-Launch and On-Orbit
Performance Characterization},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--13},
year = {2022},
url = {https://doi.org/10.1109/tgrs.2022.3148663},
doi = {10.1109/TGRS.2022.3148663},
timestamp = {Thu, 11 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/KimAABCFHKLLLMORSSSY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/YangISLLSFKLA22,
author = {Hu Yang and
Robbie Iacovazzi and
Ninghai Sun and
Quanhua (Mark) Liu and
Robert Vincent Leslie and
Matthew Sammons and
James Fuentes and
Edward Kim and
Cheng{-}Hsuan Lyu and
Saji Abraham},
title = {{ATMS} Radiance Data Products' Calibration and Evaluation},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--11},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2021.3123576},
doi = {10.1109/TGRS.2021.3123576},
timestamp = {Thu, 11 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/YangISLLSFKLA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/LiuSAYLVWF22,
author = {Jianxing Liu and
Xiaoning Shen and
Abraham Marquez Alcaide and
Yunfei Yin and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Ligang Wu and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Sliding Mode Control of Grid-Connected Neutral-Point-Clamped Converters
Via High-Gain Observer},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {69},
number = {4},
pages = {4010--4021},
year = {2022},
url = {https://doi.org/10.1109/TIE.2021.3070496},
doi = {10.1109/TIE.2021.3070496},
timestamp = {Wed, 13 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/LiuSAYLVWF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/YinVMLLWF22,
author = {Yunfei Yin and
Sergio Vazquez and
Abraham Marquez and
Jianxing Liu and
Jos{\'{e}} I. Leon and
Ligang Wu and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Observer-Based Sliding-Mode Control for Grid-Connected Power Converters
Under Unbalanced Grid Conditions},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {69},
number = {1},
pages = {517--527},
year = {2022},
url = {https://doi.org/10.1109/TIE.2021.3050387},
doi = {10.1109/TIE.2021.3050387},
timestamp = {Wed, 13 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/YinVMLLWF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ZafraVAFLM22,
author = {Eduardo Zafra and
Sergio Vazquez and
Abraham Marquez Alcaide and
Leopoldo Garc{\'{\i}}a Franquelo and
Jos{\'{e}} I. Leon and
Emilia Perez Martin},
title = {K-Best Sphere Decoding Algorithm for Long Prediction Horizon {FCS-MPC}},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {69},
number = {8},
pages = {7571--7581},
year = {2022},
url = {https://doi.org/10.1109/TIE.2021.3104600},
doi = {10.1109/TIE.2021.3104600},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/ZafraVAFLM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/umuai/GrasserTSAMZ22,
author = {Felix Gr{\"{a}}{\ss}er and
Falko Tesch and
Jochen Schmitt and
Susanne Abraham and
Hagen Malberg and
Sebastian Zaunseder},
title = {A pharmaceutical therapy recommender system enabling shared decision-making},
journal = {User Model. User Adapt. Interact.},
volume = {32},
number = {5},
pages = {1019--1062},
year = {2022},
url = {https://doi.org/10.1007/s11257-021-09298-4},
doi = {10.1007/S11257-021-09298-4},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/umuai/GrasserTSAMZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ws/PernischDSGB22,
author = {Romana Pernisch and
Daniele Dell'Aglio and
Mirko Serbak and
Rafael S. Gon{\c{c}}alves and
Abraham Bernstein},
title = {Visualising the effects of ontology changes and studying their understanding
with ChImp},
journal = {J. Web Semant.},
volume = {74},
pages = {100715},
year = {2022},
url = {https://doi.org/10.1016/j.websem.2022.100715},
doi = {10.1016/J.WEBSEM.2022.100715},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ws/PernischDSGB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/AbrahamMWBK22,
author = {Joanna Abraham and
Alicia Meng and
Benjamin C. Warner and
Thaddeus P. Budelier and
Thomas George Kannampallil},
title = {Role of Telemedicine in Remote Intraoperative Decision Support},
booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 5-9, 2022},
publisher = {{AMIA}},
year = {2022},
url = {https://knowledge.amia.org/76677-amia-1.4637602/f007-1.4641746/f007-1.4641747/383-1.4642151/469-1.4642148},
timestamp = {Wed, 17 Apr 2024 11:46:45 +0200},
biburl = {https://dblp.org/rec/conf/amia/AbrahamMWBK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/AbrahamSWKPDBT22,
author = {Joanna Abraham and
Margarita Sordo and
Duo Helen Wei and
Polina V. Kukhareva and
Deepti Pandita and
Prerna Dua and
Imon Banerjee and
Donghua Tao},
title = {Impact of {COVID-19} on Career and Family Life for Women in {AMIA}},
booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 5-9, 2022},
publisher = {{AMIA}},
year = {2022},
url = {https://knowledge.amia.org/76677-amia-1.4637602/f007-1.4641746/f007-1.4641747/383-1.4642151},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/AbrahamSWKPDBT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/LouKHWPAK22,
author = {Sunny S. Lou and
Seunghwan Kim and
Derek Harford and
Benjamin C. Warner and
Philip R. O. Payne and
Joanna Abraham and
Thomas George Kannampallil},
title = {Effect of Patient Switching on EHR-based Workload and Wrong-Patient
Errors},
booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 5-9, 2022},
publisher = {{AMIA}},
year = {2022},
url = {https://knowledge.amia.org/76677-amia-1.4637602/f007-1.4641746/f007-1.4641747/433-1.4641964/37-1.4641961},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/LouKHWPAK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bioma/MartinSantamariaCD22,
author = {Ra{\'{u}}l Mart{\'{\i}}n{-}Santamar{\'{\i}}a and
Jos{\'{e}} Manuel Colmenar and
Abraham Duarte},
editor = {Luca Di Gaspero and
Paola Festa and
Amir Nakib and
Mario Pavone},
title = {A Scatter Search Approach for the Parallel Row Ordering Problem},
booktitle = {Metaheuristics - 14th International Conference, {MIC} 2022, Syracuse,
Italy, July 11-14, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13838},
pages = {506--512},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-26504-4\_40},
doi = {10.1007/978-3-031-26504-4\_40},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bioma/MartinSantamariaCD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvip/JosephPMPJP22,
author = {Jiffy Joseph and
Rita Prasanth and
Sebin Abraham Maret and
P. N. Pournami and
P. B. Jayaraj and
Niyas Puzhakkal},
editor = {Deep Gupta and
Kishor M. Bhurchandi and
Subrahmanyam Murala and
Balasubramanian Raman and
Sanjeev Kumar},
title = {{CT} Image Synthesis from {MR} Image Using Edge-Aware Generative Adversarial
Network},
booktitle = {Computer Vision and Image Processing - 7th International Conference,
{CVIP} 2022, Nagpur, India, November 4-6, 2022, Revised Selected Papers,
Part {I}},
series = {Communications in Computer and Information Science},
volume = {1776},
pages = {141--153},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-31407-0\_11},
doi = {10.1007/978-3-031-31407-0\_11},
timestamp = {Sun, 17 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvip/JosephPMPJP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dcis/CaboCCDDGHJKLLL22,
author = {Guillem Cabo and
Gerard Cand{\'{o}}n and
Xavier Carril and
Max Doblas and
Marc Dom{\'{\i}}nguez and
Alberto Gonz{\'{a}}lez and
C{\'{e}}sar Hern{\'{a}}ndez and
V{\'{\i}}ctor Jim{\'{e}}nez and
Vatistas Kostalampros and
Rub{\'{e}}n Langarita and
Neiel Leyva and
Guillem L{\'{o}}pez{-}Parad{\'{\i}}s and
Jonnatan Mendoza and
Francesco Minervini and
Juli{\'{a}}n Pav{\'{o}}n and
Crist{\'{o}}bal Ram{\'{\i}}rez and
Narc{\'{\i}}s Rodas and
Enrico Reggiani and
Mario Rodr{\'{\i}}guez and
Carlos Rojas and
Abraham Ruiz and
V{\'{\i}}ctor Soria and
Alejandro Suanes and
Iv{\'{a}}n Vargas and
Roger Figueras and
Pau Fontova and
Joan Marimon and
V{\'{\i}}ctor Montabes and
Adri{\'{a}}n Cristal and
Carles Hern{\'{a}}ndez and
Ricardo Mart{\'{\i}}nez and
Miquel Moret{\'{o}} and
Francesc Moll and
Oscar Palomar and
Marco A. Ram{\'{\i}}rez and
Antonio Rubio and
Jordi Sacrist{\'{a}}n and
Francisco Serra{-}Graells and
Nehir S{\"{o}}nmez and
Llu{\'{\i}}s Ter{\'{e}}s and
Osman S. Unsal and
Mateo Valero and
Lu{\'{\i}}s Villa},
title = {{DVINO:} {A} {RISC-V} Vector Processor Implemented in 65nm Technology},
booktitle = {37th Conference on Design of Circuits and Integrated Systems, {DCIS}
2022, Pamplona, Spain, November 16-18, 2022},
pages = {1--6},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/DCIS55711.2022.9970128},
doi = {10.1109/DCIS55711.2022.9970128},
timestamp = {Mon, 25 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dcis/CaboCCDDGHJKLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ease/VakkuriKTJHA22,
author = {Ville Vakkuri and
Kai{-}Kristian Kemell and
Joel Tolvanen and
Marianna Jantunen and
Erika Halme and
Pekka Abrahamsson},
editor = {Miroslaw Staron and
Christian Berger and
Jocelyn Simmonds and
Rafael Prikladnicki},
title = {How Do Software Companies Deal with Artificial Intelligence Ethics?
{A} Gap Analysis},
booktitle = {{EASE} 2022: The International Conference on Evaluation and Assessment
in Software Engineering 2022, Gothenburg, Sweden, June 13 - 15, 2022},
pages = {100--109},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3530019.3530030},
doi = {10.1145/3530019.3530030},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ease/VakkuriKTJHA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edbt/KlinglerLMSBS22,
author = {Yasamin Klingler and
Claude Lehmann and
Jo{\~{a}}o Pedro Monteiro and
Carlo Saladin and
Abraham Bernstein and
Kurt Stockinger},
editor = {Julia Stoyanovich and
Jens Teubner and
Paolo Guagliardo and
Milos Nikolic and
Andreas Pieris and
Jan M{\"{u}}hlig and
Fatma {\"{O}}zcan and
Sebastian Schelter and
H. V. Jagadish and
Meihui Zhang},
title = {Evaluation of Algorithms for Interaction-Sparse Recommendations: Neural
Networks don't Always Win},
booktitle = {Proceedings of the 25th International Conference on Extending Database
Technology, {EDBT} 2022, Edinburgh, UK, March 29 - April 1, 2022},
pages = {2:475--2:486},
publisher = {OpenProceedings.org},
year = {2022},
url = {https://doi.org/10.48786/edbt.2022.42},
doi = {10.48786/EDBT.2022.42},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/edbt/KlinglerLMSBS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LeongNMFOW22,
author = {Colin Leong and
Joshua Nemecek and
Jacob Mansdorfer and
Anna Filighera and
Abraham Owodunni and
Daniel Whitenack},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {Bloom Library: Multimodal Datasets in 300+ Languages for a Variety
of Downstream Tasks},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {8608--8621},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.590},
doi = {10.18653/V1/2022.EMNLP-MAIN.590},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LeongNMFOW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hais/CasalMG22,
author = {Alejandro Gonz{\'{a}}lez Casal and
Pedro Jos{\'{e}} Trueba Mart{\'{\i}}nez and
Abraham Prieto Garc{\'{\i}}a},
editor = {Pablo Garc{\'{\i}}a Bringas and
Hilde P{\'{e}}rez Garc{\'{\i}}a and
Francisco Javier Mart{\'{\i}}nez de Pis{\'{o}}n and
Jos{\'{e}} Ram{\'{o}}n Villar Flecha and
Alicia Troncoso Lora and
Enrique A. de la Cal and
{\'{A}}lvaro Herrero and
Francisco Mart{\'{\i}}nez{-}{\'{A}}lvarez and
Giuseppe Psaila and
H{\'{e}}ctor Quinti{\'{a}}n and
Emilio Corchado},
title = {Evolving Dynamic Route Generators for Open-Ended ARPs},
booktitle = {Hybrid Artificial Intelligent Systems - 17th International Conference,
{HAIS} 2022, Salamanca, Spain, September 5-7, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13469},
pages = {348--359},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-15471-3\_30},
doi = {10.1007/978-3-031-15471-3\_30},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hais/CasalMG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/LeeRSKM22,
author = {Jong Youl Lee and
Balaraman Rajan and
Abraham Seidmann and
Dorota Kopycka{-}Kedzierawski and
Sean Mclaren},
title = {Optimal Location of a Remote Dental Unit},
booktitle = {55th Hawaii International Conference on System Sciences, {HICSS} 2022,
Virtual Event / Maui, Hawaii, USA, January 4-7, 2022},
pages = {1--9},
publisher = {ScholarSpace},
year = {2022},
url = {http://hdl.handle.net/10125/80129},
timestamp = {Wed, 11 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/LeeRSKM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/LiXKFAA022,
author = {Dingwen Li and
Bing Xue and
Christopher Ryan King and
Bradley A. Fritz and
Michael Avidan and
Joanna Abraham and
Chenyang Lu},
editor = {Xingquan Zhu and
Sanjay Ranka and
My T. Thai and
Takashi Washio and
Xindong Wu},
title = {Self-explaining Hierarchical Model for Intraoperative Time Series},
booktitle = {{IEEE} International Conference on Data Mining, {ICDM} 2022, Orlando,
FL, USA, November 28 - Dec. 1, 2022},
pages = {1041--1046},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICDM54844.2022.00128},
doi = {10.1109/ICDM54844.2022.00128},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icdm/LiXKFAA022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icost/ForchukRCLHBFMS22,
author = {Cheryl Forchuk and
Abraham Rudnick and
Deborah Corring and
Daniel J. Lizotte and
Jeffrey S. Hoch and
Richard Booth and
Barbara Frampton and
Rupinder Mann and
Jonathan Serrato},
editor = {Hamdi Aloulou and
Bessam Abdulrazak and
Antoine de Marass{\'{e}}{-}Enouf and
Mounir Mokhtari},
title = {Smart Technology in the Home for People Living in the Community with
Mental Illness and Physical Comorbidities},
booktitle = {Participative Urban Health and Healthy Aging in the Age of {AI} -
19th International Conference, {ICOST} 2022, Paris, France, June 27-30,
2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13287},
pages = {86--99},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-09593-1\_7},
doi = {10.1007/978-3-031-09593-1\_7},
timestamp = {Wed, 27 Jul 2022 22:15:50 +0200},
biburl = {https://dblp.org/rec/conf/icost/ForchukRCLHBFMS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/XueJKFKAA022,
author = {Bing Xue and
York Jiao and
Thomas George Kannampallil and
Bradley A. Fritz and
Christopher Ryan King and
Joanna Abraham and
Michael Avidan and
Chenyang Lu},
editor = {Aidong Zhang and
Huzefa Rangwala},
title = {Perioperative Predictions with Interpretable Latent Representation},
booktitle = {{KDD} '22: The 28th {ACM} {SIGKDD} Conference on Knowledge Discovery
and Data Mining, Washington, DC, USA, August 14 - 18, 2022},
pages = {4268--4278},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3534678.3539190},
doi = {10.1145/3534678.3539190},
timestamp = {Mon, 28 Aug 2023 21:17:29 +0200},
biburl = {https://dblp.org/rec/conf/kdd/XueJKFKAA022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/SandersSSCDBW22,
author = {Abraham Sanders and
Tomek Strzalkowski and
Mei Si and
Albert Chang and
Deepanshu Dey and
Jonas Braasch and
Dakuo Wang},
editor = {Marine Carpuat and
Marie{-}Catherine de Marneffe and
Iv{\'{a}}n Vladimir Meza Ru{\'{\i}}z},
title = {Towards a Progression-Aware Autonomous Dialogue Agent},
booktitle = {Proceedings of the 2022 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL} 2022, Seattle, WA, United States, July 10-15, 2022},
pages = {1194--1212},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.naacl-main.87},
doi = {10.18653/V1/2022.NAACL-MAIN.87},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/SandersSSCDBW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/AlbrechtFFKWSRK22,
author = {Joshua Albrecht and
Abraham J. Fetterman and
Bryden Fogelman and
Ellie Kitanidis and
Bartosz Wr{\'{o}}blewski and
Nicole Seo and
Michael Rosenthal and
Maksis Knutins and
Zack Polizzi and
James Simon and
Kanjun Qiu},
editor = {Sanmi Koyejo and
S. Mohamed and
A. Agarwal and
Danielle Belgrave and
K. Cho and
A. Oh},
title = {Avalon: {A} Benchmark for {RL} Generalization Using Procedurally Generated
Worlds},
booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference
on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
LA, USA, November 28 - December 9, 2022},
year = {2022},
url = {http://papers.nips.cc/paper\_files/paper/2022/hash/539f1f7dd156cfe1222b0be83f247d35-Abstract-Datasets\_and\_Benchmarks.html},
timestamp = {Mon, 08 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/AlbrechtFFKWSRK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sai/ValdezMRVLS22,
author = {Jos{\'{e}} Luis Cendejas Vald{\'{e}}z and
Heberto Ferreira Medina and
Mar{\'{\i}}a E. Ben{\'{\i}}tez Ram{\'{\i}}rez and
Gustavo Abraham Vanegas{-}Contreras and
Miguel A. Acu{\~{n}}a L{\'{o}}pez and
Jes{\'{u}}s Leonardo Soto{-}Sumuano},
editor = {Kohei Arai},
title = {Single Access for the Use of Information Technology in University
Education During the SARS-CoV-2 Pandemic},
booktitle = {Intelligent Computing - Proceedings of the 2022 Computing Conference,
Volume 3, {SAI} 2022, Virtual Event, 14-15 July 2022},
series = {Lecture Notes in Networks and Systems},
volume = {508},
pages = {279--293},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-10467-1\_17},
doi = {10.1007/978-3-031-10467-1\_17},
timestamp = {Thu, 02 Feb 2023 13:35:22 +0100},
biburl = {https://dblp.org/rec/conf/sai/ValdezMRVLS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc2/Malviya-ThakurH22,
author = {Addi Malviya{-}Thakur and
Seth Hitefield and
Marshall T. McDonnell and
Matthew Wolf and
Richard Archibald and
Lance Drane and
Kevin Roccapriore and
Maxim A. Ziatdinov and
Jesse McGaha and
Robert Smith and
John Hetrick and
Mark Abraham and
Sergey Yakubov and
Gregory R. Watson and
Ben Chance and
Clara Nguyen and
Matthew Baker and
J. Robert Michael and
Elke Arenholz and
Ben Mintz},
editor = {Douglas B. Kothe and
Al Geist and
Swaroop Pophale and
Hong Liu and
Suzanne Parete{-}Koon},
title = {Towards a Software Development Framework for Interconnected Science
Ecosystems},
booktitle = {Accelerating Science and Engineering Discoveries Through Integrated
Research Infrastructure for Experiment, Big Data, Modeling and Simulation
- 22nd Smoky Mountains Computational Sciences and Engineering Conference,
{SMC} 2022, Virtual Event, August 23-25, 2022, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1690},
pages = {206--224},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-23606-8\_13},
doi = {10.1007/978-3-031-23606-8\_13},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc2/Malviya-ThakurH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/websci/SandersREB22,
author = {Abraham Sanders and
Debjani Ray{-}Majumder and
John S. Erickson and
Kristin P. Bennett},
title = {Should we tweet this? Generative response modeling for predicting
reception of public health messaging on Twitter},
booktitle = {WebSci '22: 14th {ACM} Web Science Conference 2022, Barcelona, Spain,
June 26 - 29, 2022},
pages = {307--318},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3501247.3531574},
doi = {10.1145/3501247.3531574},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/websci/SandersREB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/22/Ching-ChiangFLGGJLM22,
author = {Lay{-}Wah Carolina Ching{-}Chiang and
Juan Manuel Fern{\'{a}}ndez{-}C{\'{a}}rdenas and
Nicole Lotz and
No{\'{e}} Abraham Gonz{\'{a}}lez{-}Nieto and
Mark Gaved and
Derek Jones and
Alejandra D{\'{\i}}az de Le{\'{o}}n and
Rafael Machado},
editor = {Jos{\'{e}} L. Abdelnour{-}Nocera and
Elisha Ondieki Makori and
Jose Antonio Robles{-}Flores and
Constance Bitso},
title = {From Digital Divide to Digital Discovery: Re-thinking Online Learning
and Interactions in Marginalized Communities},
booktitle = {Innovation Practices for Digital Transformation in the Global South
- {IFIP} {WG} 13.8, 9.4, Invited Selection},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {645},
pages = {34--58},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-12825-7\_3},
doi = {10.1007/978-3-031-12825-7\_3},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/22/Ching-ChiangFLGGJLM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ibica/2021,
editor = {Ajith Abraham and
Ana Maria Madureira and
Arturas Kaklauskas and
Niketa Gandhi and
Anu Bajaj and
Azah Kamilah Muda and
Dalia Kriksciuniene and
Jo{\~{a}}o Carlos Ferreira},
title = {Innovations in Bio-Inspired Computing and Applications - Proceedings
of the 12th International Conference on Innovations in Bio-Inspired
Computing and Applications {(IBICA} 2021) Held During December 16-18,
2021},
series = {Lecture Notes in Networks and Systems},
volume = {419},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-030-96299-9},
doi = {10.1007/978-3-030-96299-9},
isbn = {978-3-030-96298-2},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ibica/2021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-10985,
author = {Alexander Quevedo and
Abraham S{\'{a}}nchez and
Raul Nancl{\'{a}}res and
Diana P. Montoya and
Juan Pacho and
Jorge Mart{\'{\i}}nez and
Eduardo Ulises Moya{-}S{\'{a}}nchez},
title = {Jalisco's multiclass land cover analysis and classification using
a novel lightweight convnet with real-world multispectral and relief
data},
journal = {CoRR},
volume = {abs/2201.10985},
year = {2022},
url = {https://arxiv.org/abs/2201.10985},
eprinttype = {arXiv},
eprint = {2201.10985},
timestamp = {Tue, 01 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-10985.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-03905,
author = {Jovanna A. Tracz and
Lukas Wille and
Dylan Pathiraja and
Savita V. Kendre and
Ron Pfisterer and
Ethan Turett and
Gus T. Teran and
Christoffer K. Abrahamsson and
Samuel E. Root and
Won{-}Kyu Lee and
Daniel J. Preston and
Haihui Joy Jiang and
George M. Whitesides and
Markus P. Nemitz},
title = {Tube-Balloon Logic for the Exploration of Fluidic Control Elements},
journal = {CoRR},
volume = {abs/2202.03905},
year = {2022},
url = {https://arxiv.org/abs/2202.03905},
eprinttype = {arXiv},
eprint = {2202.03905},
timestamp = {Thu, 10 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-03905.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-04950,
author = {Anh Nguyen{-}Duc and
Dron Khanna and
Des Greer and
Xiaofeng Wang and
Luciana Martinez Zaina and
Gerardo Matturro and
Jorge Melegati and
Eduardo Martins Guerra and
Giang Huong Le and
Petri Kettunen and
Sami Hyrynsalmi and
Henry Edison and
Afonso Sales and
Didzis Rutitis and
Kai{-}Kristian Kemell and
Abdullah Aldaeej and
Tommi Mikkonen and
Juan Garbajosa and
Pekka Abrahamsson},
title = {Work-from-home and its implication for project management, resilience
and innovation - a global survey on software companies},
journal = {CoRR},
volume = {abs/2202.04950},
year = {2022},
url = {https://arxiv.org/abs/2202.04950},
eprinttype = {arXiv},
eprint = {2202.04950},
timestamp = {Fri, 18 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-04950.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-04353,
author = {Abraham Sanders and
Debjani Ray{-}Majumder and
John S. Erickson and
Kristin P. Bennett},
title = {Should we tweet this? Generative response modeling for predicting
reception of public health messaging on Twitter},
journal = {CoRR},
volume = {abs/2204.04353},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.04353},
doi = {10.48550/ARXIV.2204.04353},
eprinttype = {arXiv},
eprint = {2204.04353},
timestamp = {Wed, 13 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-04353.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-03692,
author = {Abraham Sanders and
Tomek Strzalkowski and
Mei Si and
Albert Chang and
Deepanshu Dey and
Jonas Braasch and
Dakuo Wang},
title = {Towards a Progression-Aware Autonomous Dialogue Agent},
journal = {CoRR},
volume = {abs/2205.03692},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.03692},
doi = {10.48550/ARXIV.2205.03692},
eprinttype = {arXiv},
eprint = {2205.03692},
timestamp = {Wed, 11 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-03692.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-06464,
author = {P. Francis and
Abraham M. Illickan and
Lijo M. Jose and
Deepak Rajendraprasad},
title = {Disjoint Total Dominating Sets in Near-Triangulations},
journal = {CoRR},
volume = {abs/2205.06464},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.06464},
doi = {10.48550/ARXIV.2205.06464},
eprinttype = {arXiv},
eprint = {2205.06464},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-06464.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-09500,
author = {Pedro C. Neto and
Tiago Gon{\c{c}}alves and
Jo{\~{a}}o Ribeiro Pinto and
Wilson Silva and
Ana Filipa Sequeira and
Arun Ross and
Jaime S. Cardoso},
title = {Explainable Biometrics in the Age of Deep Learning},
journal = {CoRR},
volume = {abs/2208.09500},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.09500},
doi = {10.48550/ARXIV.2208.09500},
eprinttype = {arXiv},
eprint = {2208.09500},
timestamp = {Tue, 19 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-09500.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-04417,
author = {Dingwen Li and
Bing Xue and
Christopher Ryan King and
Bradley A. Fritz and
Michael Avidan and
Joanna Abraham and
Chenyang Lu},
title = {Self-explaining Hierarchical Model for Intraoperative Time Series},
journal = {CoRR},
volume = {abs/2210.04417},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.04417},
doi = {10.48550/ARXIV.2210.04417},
eprinttype = {arXiv},
eprint = {2210.04417},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-04417.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-13417,
author = {Joshua Albrecht and
Abraham J. Fetterman and
Bryden Fogelman and
Ellie Kitanidis and
Bartosz Wr{\'{o}}blewski and
Nicole Seo and
Michael Rosenthal and
Maksis Knutins and
Zachary Polizzi and
James B. Simon and
Kanjun Qiu},
title = {Avalon: {A} Benchmark for {RL} Generalization Using Procedurally Generated
Worlds},
journal = {CoRR},
volume = {abs/2210.13417},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.13417},
doi = {10.48550/ARXIV.2210.13417},
eprinttype = {arXiv},
eprint = {2210.13417},
timestamp = {Fri, 28 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-13417.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-14712,
author = {Colin Leong and
Joshua Nemecek and
Jacob Mansdorfer and
Anna Filighera and
Abraham Owodunni and
Daniel Whitenack},
title = {Bloom Library: Multimodal Datasets in 300+ Languages for a Variety
of Downstream Tasks},
journal = {CoRR},
volume = {abs/2210.14712},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.14712},
doi = {10.48550/ARXIV.2210.14712},
eprinttype = {arXiv},
eprint = {2210.14712},
timestamp = {Wed, 02 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-14712.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-04545,
author = {Karl{-}Dieter Crisman and
Abraham Holleran and
Micah Martin and
Josephine Noonan},
title = {Voting on Cyclic Orders, Group Theory, and Ballots},
journal = {CoRR},
volume = {abs/2211.04545},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.04545},
doi = {10.48550/ARXIV.2211.04545},
eprinttype = {arXiv},
eprint = {2211.04545},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-04545.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-03106,
author = {Joel Meyer and
Ahalya Prabhakar and
Allison Pinosky and
Ian Abraham and
Annalisa T. Taylor and
Millicent Schlafly and
Katarina Popovic and
Giovani Diniz and
Brendan Teich and
Borislava I. Simidchieva and
Shane Clark and
Todd D. Murphey},
title = {Scale-Invariant Specifications for Human-Swarm Systems},
journal = {CoRR},
volume = {abs/2212.03106},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.03106},
doi = {10.48550/ARXIV.2212.03106},
eprinttype = {arXiv},
eprint = {2212.03106},
timestamp = {Thu, 08 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-03106.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-06295,
author = {Joshua Albrecht and
Ellie Kitanidis and
Abraham J. Fetterman},
title = {Despite "super-human" performance, current LLMs are unsuited for decisions
about ethics and safety},
journal = {CoRR},
volume = {abs/2212.06295},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.06295},
doi = {10.48550/ARXIV.2212.06295},
eprinttype = {arXiv},
eprint = {2212.06295},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-06295.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-13792,
author = {Fernando Alonso{-}Fernandez and
Josef Big{\"{u}}n and
Julian Fi{\'{e}}rrez and
Naser Damer and
Hugo Proen{\c{c}}a and
Arun Ross},
title = {Periocular Biometrics: {A} Modality for Unconstrained Scenarios},
journal = {CoRR},
volume = {abs/2212.13792},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.13792},
doi = {10.48550/ARXIV.2212.13792},
eprinttype = {arXiv},
eprint = {2212.13792},
timestamp = {Thu, 05 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-13792.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/AbrahamDEH22,
author = {Ittai Abraham and
Danny Dolev and
Ittay Eyal and
Joseph Y. Halpern},
title = {Colordag: An Incentive-Compatible Blockchain},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {308},
year = {2022},
url = {https://eprint.iacr.org/2022/308},
timestamp = {Tue, 22 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iacr/AbrahamDEH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/AbrahamJMMS22,
author = {Ittai Abraham and
Philipp Jovanovic and
Mary Maller and
Sarah Meiklejohn and
Gilad Stern},
title = {Bingo: Adaptively Secure Packed Asynchronous Verifiable Secret Sharing
and Asynchronous Distributed Key Generation},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1759},
year = {2022},
url = {https://eprint.iacr.org/2022/1759},
timestamp = {Mon, 30 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iacr/AbrahamJMMS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AlcaideWYLMBVLF21,
author = {Abraham Marquez Alcaide and
Xuchen Wang and
Hao Yan and
Jos{\'{e}} I. Leon and
Vito Giuseppe Monopoli and
Giampaolo Buticchi and
Sergio Vazquez and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Common-Mode Voltage Mitigation of Dual Three-Phase Voltage Source
Inverters in a Motor Drive Application},
journal = {{IEEE} Access},
volume = {9},
pages = {67477--67487},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3072967},
doi = {10.1109/ACCESS.2021.3072967},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/AlcaideWYLMBVLF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AlcaideYWLGBVML21,
author = {Abraham Marquez Alcaide and
Hao Yan and
Xuchen Wang and
Jos{\'{e}} I. Leon and
Ram{\'{o}}n Portillo Guisado and
Giampaolo Buticchi and
Sergio Vazquez and
Vito Giuseppe Monopoli and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Common-Mode Voltage Mitigation Technique in Motor Drive Applications
by Applying a Sampling-Time Adaptive Multi-Carrier {PWM} Method},
journal = {{IEEE} Access},
volume = {9},
pages = {56115--56126},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3071125},
doi = {10.1109/ACCESS.2021.3071125},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/AlcaideYWLGBVML21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Escamilla-Ambrosio21,
author = {Ponciano Jorge Escamilla{-}Ambrosio and
David Alejandro Robles{-}Ram{\'{\i}}rez and
Theo Tryfonas and
Abraham Rodriguez{-}Mota and
Gina Gallegos{-}Garc{\'{\i}}a and
Mois{\'{e}}s Salinas{-}Rosales},
title = {IoTsecM: {A} UML/SysML Extension for Internet of Things Security Modeling},
journal = {{IEEE} Access},
volume = {9},
pages = {154112--154135},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3125979},
doi = {10.1109/ACCESS.2021.3125979},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/Escamilla-Ambrosio21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aci/AbrahamKM21,
author = {Joanna Abraham and
Christopher Ryan King and
Alicia Meng},
title = {Ascertaining Design Requirements for Postoperative Care Transition
Interventions},
journal = {Appl. Clin. Inform.},
volume = {12},
number = {01},
pages = {107--115},
year = {2021},
url = {https://doi.org/10.1055/s-0040-1721780},
doi = {10.1055/S-0040-1721780},
timestamp = {Thu, 18 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aci/AbrahamKM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ascom/PlanteWKDBKWAAA21,
author = {Paul La Plante and
Peter K. G. Williams and
Matthew Kolopanis and
Jesse Dillon and
Adam P. Beardsley and
Nicholas S. Kern and
Michael Wilensky and
Zaki S. Ali and
Zara Abdurashidova and
James E. Aguirre and
Paul Alexander and
Yanga Balfour and
Gianni Bernardi and
Tashalee S. Billings and
Judd D. Bowman and
Roxanne F. Bradley and
Phil Bull and
Jacob Burba and
Steve Carey and
Chris L. Carilli and
Carina Cheng and
David R. DeBoer and
Matt Dexter and
Eloy de Lera Acedo and
John Ely and
Aaron Ewall{-}Wice and
Nicolas Fagnoni and
Randall Fritz and
Steven R. Furlanetto and
Kingsley Gale{-}Sides and
Brian Glendenning and
Deepthi Gorthi and
Bradley Greig and
Jasper Grobbelaar and
Ziyaad Halday and
Bryna J. Hazelton and
Jacqueline N. Hewitt and
Jack Hickish and
Daniel C. Jacobs and
Austin Julius and
Joshua Kerrigan and
Piyanat Kittiwisit and
Saul A. Kohn and
Adam Lanman and
Telalo Lekalake and
David Lewis and
Adrian Liu and
David MacMahon and
Lourence Malan and
Cresshim Malgas and
Matthys Maree and
Zachary E. Martinot and
Eunice Matsetela and
Andrei Mesinger and
Mathakane Molewa and
Miguel F. Morales and
Tshegofalang Mosiane and
Steven G. Murray and
Abraham R. Neben and
Bojan Nikolic and
Aaron R. Parsons and
Robert Pascua and
Nipanjana Patra and
Samantha Pieterse and
Jonathan C. Pober and
Nima Razavi{-}Ghods and
Jon Ringuette and
James Robnett and
Kathryn Rosie and
Mario G. Santos and
Peter H. Sims and
Craig Smith and
Angelo Syce and
Nithyanandan Thyagarajan and
Haoxuan Zheng},
title = {A Real Time Processing system for big data in astronomy: Applications
to {HERA}},
journal = {Astron. Comput.},
volume = {36},
pages = {100489},
year = {2021},
url = {https://doi.org/10.1016/j.ascom.2021.100489},
doi = {10.1016/J.ASCOM.2021.100489},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ascom/PlanteWKDBKWAAA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/GleasonVO21,
author = {Joseph D. Gleason and
Abraham P. Vinod and
Meeko M. K. Oishi},
title = {Lagrangian approximations for stochastic reachability of a target
tube},
journal = {Autom.},
volume = {128},
pages = {109546},
year = {2021},
url = {https://doi.org/10.1016/j.automatica.2021.109546},
doi = {10.1016/J.AUTOMATICA.2021.109546},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/automatica/GleasonVO21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/di/AbrahamNMTR21,
author = {Joshua Abraham and
Ronnie Ng and
Marie Morelato and
Mark Tahtouh and
Claude Roux},
title = {Automatically classifying crime scene images using machine learning
methodologies},
journal = {Digit. Investig.},
volume = {39},
pages = {301273},
year = {2021},
url = {https://doi.org/10.1016/j.fsidi.2021.301273},
doi = {10.1016/J.FSIDI.2021.301273},
timestamp = {Fri, 21 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/di/AbrahamNMTR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/HerranCD21,
author = {Alberto Herr{\'{a}}n and
J. Manuel Colmenar and
Abraham Duarte},
title = {An efficient variable neighborhood search for the Space-Free Multi-Row
Facility Layout problem},
journal = {Eur. J. Oper. Res.},
volume = {295},
number = {3},
pages = {893--907},
year = {2021},
url = {https://doi.org/10.1016/j.ejor.2021.03.027},
doi = {10.1016/J.EJOR.2021.03.027},
timestamp = {Wed, 01 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eor/HerranCD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/UribeHCD21,
author = {Nicol{\'{a}}s R. Uribe and
Alberto Herr{\'{a}}n and
J. Manuel Colmenar and
Abraham Duarte},
title = {An improved {GRASP} method for the multiple row equal facility layout
problem},
journal = {Expert Syst. Appl.},
volume = {182},
pages = {115184},
year = {2021},
url = {https://doi.org/10.1016/j.eswa.2021.115184},
doi = {10.1016/J.ESWA.2021.115184},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/UribeHCD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gis/WuLCSCT21,
author = {Hao Wu and
Anqi Lin and
Keith C. Clarke and
Wenzhong Shi and
Abraham Cardenas{-}Tristan and
Zhenfa Tu},
title = {A comprehensive quality assessment framework for linear features from
Volunteered Geographic Information},
journal = {Int. J. Geogr. Inf. Sci.},
volume = {35},
number = {9},
pages = {1826--1847},
year = {2021},
url = {https://doi.org/10.1080/13658816.2020.1832228},
doi = {10.1080/13658816.2020.1832228},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gis/WuLCSCT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcini/CherukuriSALJ21,
author = {Aswani Kumar Cherukuri and
Radhika Shivhare and
Ajith Abraham and
Jinhai Li and
Annapurna Jonnalagadda},
title = {A Pragmatic Approach to Understand Hebbian Cell Assembly},
journal = {Int. J. Cogn. Informatics Nat. Intell.},
volume = {15},
number = {2},
pages = {73--95},
year = {2021},
url = {https://doi.org/10.4018/IJCINI.20210401.oa6},
doi = {10.4018/IJCINI.20210401.OA6},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcini/CherukuriSALJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/CasalinoDGBSATB21,
author = {Lorenzo Casalino and
Abigail C. Dommer and
Zied Gaieb and
Em{\'{\i}}lia P. Barros and
Terra Sztain and
Surl{-}Hee Ahn and
Anda Trifan and
Alexander Brace and
Anthony T. Bogetti and
Austin Clyde and
Heng Ma and
Hyungro Lee and
Matteo Turilli and
Syma Khalid and
Lillian T. Chong and
Carlos Simmerling and
David J. Hardy and
Julio D. C. Maia and
James C. Phillips and
Thorsten Kurth and
Abraham C. Stern and
Lei Huang and
John D. McCalpin and
Mahidhar Tatineni and
Tom Gibbs and
John E. Stone and
Shantenu Jha and
Arvind Ramanathan and
Rommie E. Amaro},
title = {AI-driven multiscale simulations illuminate mechanisms of SARS-CoV-2
spike dynamics},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {35},
number = {5},
year = {2021},
url = {https://doi.org/10.1177/10943420211006452},
doi = {10.1177/10943420211006452},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/CasalinoDGBSATB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/AbrahamMHBCAP21,
author = {Joanna Abraham and
Alicia Meng and
Katherine J. Holzer and
Luke Brawer and
Aparna Casarella and
Michael Avidan and
Mary C. Politi},
title = {Exploring patient perspectives on telemedicine monitoring within the
operating room},
journal = {Int. J. Medical Informatics},
volume = {156},
pages = {104595},
year = {2021},
url = {https://doi.org/10.1016/j.ijmedinf.2021.104595},
doi = {10.1016/J.IJMEDINF.2021.104595},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/AbrahamMHBCAP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/AbrahamMSWAK21,
author = {Joanna Abraham and
Alicia Meng and
Carrie Sona and
Troy Wildes and
Michael Avidan and
Thomas George Kannampallil},
title = {An observational study of postoperative handoff standardization failures},
journal = {Int. J. Medical Informatics},
volume = {151},
pages = {104458},
year = {2021},
url = {https://doi.org/10.1016/j.ijmedinf.2021.104458},
doi = {10.1016/J.IJMEDINF.2021.104458},
timestamp = {Tue, 15 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmi/AbrahamMSWAK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/LloydLADPRB21,
author = {Sheree Lloyd and
Karrie Long and
Abraham Oshni Alvandi and
Josie Di Donato and
Yasmine C. Probst and
Jeremy Roach and
Christopher Bain},
title = {A National Survey of {EMR} Usability: Comparisons between medical
and nursing professions in the hospital and primary care sectors in
Australia and Finland},
journal = {Int. J. Medical Informatics},
volume = {154},
pages = {104535},
year = {2021},
url = {https://doi.org/10.1016/j.ijmedinf.2021.104535},
doi = {10.1016/J.IJMEDINF.2021.104535},
timestamp = {Wed, 05 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/LloydLADPRB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jair/Saint-GuillainV21,
author = {Michael Saint{-}Guillain and
Tiago Vaquero and
Steve A. Chien and
Jagriti Agrawal and
Jordan R. Abrahams},
title = {Probabilistic Temporal Networks with Ordinary Distributions: Theory,
Robustness and Expected Utility},
journal = {J. Artif. Intell. Res.},
volume = {71},
pages = {1091--1136},
year = {2021},
url = {https://doi.org/10.1613/jair.1.13019},
doi = {10.1613/JAIR.1.13019},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jair/Saint-GuillainV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AbrahamGTXHLK21,
author = {Joanna Abraham and
William L. Galanter and
Daniel Touchette and
Yinglin Xia and
Katherine J. Holzer and
Vania Leung and
Thomas George Kannampallil},
title = {Risk factors associated with medication ordering errors},
journal = {J. Am. Medical Informatics Assoc.},
volume = {28},
number = {1},
pages = {86--94},
year = {2021},
url = {https://doi.org/10.1093/jamia/ocaa264},
doi = {10.1093/JAMIA/OCAA264},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/AbrahamGTXHLK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/KannampallilALP21,
author = {Thomas George Kannampallil and
Joanna Abraham and
Sunny S. Lou and
Philip R. O. Payne},
title = {Conceptual considerations for using EHR-based activity logs to measure
clinician burnout and its effects},
journal = {J. Am. Medical Informatics Assoc.},
volume = {28},
number = {5},
pages = {1032--1037},
year = {2021},
url = {https://doi.org/10.1093/jamia/ocaa305},
doi = {10.1093/JAMIA/OCAA305},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/KannampallilALP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/UnertlAB21,
author = {Kim M. Unertl and
Joanna Abraham and
Suzanne Bakken},
title = {Building on Diana Forsythe's legacy: the value of human experience
and context in biomedical and health informatics},
journal = {J. Am. Medical Informatics Assoc.},
volume = {28},
number = {2},
pages = {197--208},
year = {2021},
url = {https://doi.org/10.1093/jamia/ocaa337},
doi = {10.1093/JAMIA/OCAA337},
timestamp = {Tue, 23 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/UnertlAB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jrie/AlfaAOO21,
author = {Abraham Ayegba Alfa and
John Kolo Alhassan and
Olayemi Mikail Olaniyi and
Morufu Olalere},
title = {Blockchain technology in IoT systems: current trends, methodology,
problems, applications, and future directions},
journal = {J. Reliab. Intell. Environ.},
volume = {7},
number = {2},
pages = {115--143},
year = {2021},
url = {https://doi.org/10.1007/s40860-020-00116-z},
doi = {10.1007/S40860-020-00116-Z},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jrie/AlfaAOO21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/JothiarunaSA21,
author = {N. Jothiaruna and
K. Joseph Abraham Sundar and
M. Ifjaz Ahmed},
title = {A disease spot segmentation method using comprehensive color feature
with multi-resolution channel and region growing},
journal = {Multim. Tools Appl.},
volume = {80},
number = {3},
pages = {3327--3335},
year = {2021},
url = {https://doi.org/10.1007/s11042-020-09882-7},
doi = {10.1007/S11042-020-09882-7},
timestamp = {Tue, 26 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mta/JothiarunaSA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rbie/RamirezR21,
author = {Jos{\'{e}} Abraham Sol{\'{\i}}s Ram{\'{\i}}rez and
Jos{\'{e}} Rafael Rojano{-}C{\'{a}}ceres},
title = {Dise{\~{n}}o de una aplicaci{\'{o}}n de lectoescritura para ni{\~{n}}os
sordos},
journal = {Revista Brasileira de Inform{\'{a}}tica na Educ.},
volume = {29},
pages = {1038--1059},
year = {2021},
url = {https://doi.org/10.5753/rbie.2021.29.0.1038},
doi = {10.5753/RBIE.2021.29.0.1038},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rbie/RamirezR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/AbrahamsenSMLDB21,
author = {Eirik Bjorheim Abrahamsen and
Jon T{\o}mmer{\aa}s Selvik and
Maria Francesca Milazzo and
Henrik Langdalen and
Roy Endre Dahl and
Surbhi Bansal and
H{\aa}kon Bjorheim Abrahamsen},
title = {On the use of the 'Return Of Safety Investments' {(ROSI)} measure
for decision-making in the chemical processing industry},
journal = {Reliab. Eng. Syst. Saf.},
volume = {210},
pages = {107537},
year = {2021},
url = {https://doi.org/10.1016/j.ress.2021.107537},
doi = {10.1016/J.RESS.2021.107537},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ress/AbrahamsenSMLDB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/DaneshfarazAGKA21,
author = {Rasoul Daneshfaraz and
Ehsan Aminvash and
Amir Ghaderi and
Alban Kuriqi and
John Abraham},
title = {Three-Dimensional Investigation of Hydraulic Properties of Vertical
Drop in the Presence of Step and Grid Dissipators},
journal = {Symmetry},
volume = {13},
number = {5},
pages = {895},
year = {2021},
url = {https://doi.org/10.3390/sym13050895},
doi = {10.3390/SYM13050895},
timestamp = {Tue, 13 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/DaneshfarazAGKA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasI/HuAIF21,
author = {Xuan Hu and
Amy S. Abraham and
Jean Anne C. Incorvia and
Joseph S. Friedman},
title = {Hybrid Pass Transistor Logic With Ambipolar Transistors},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {68},
number = {1},
pages = {301--310},
year = {2021},
url = {https://doi.org/10.1109/TCSI.2020.3034042},
doi = {10.1109/TCSI.2020.3034042},
timestamp = {Tue, 26 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcasI/HuAIF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AlcaideLPYLVKF21,
author = {Abraham Marquez Alcaide and
Jos{\'{e}} I. Leon and
Ram{\'{o}}n C. Portillo and
Jiapeng Yin and
Wensheng Luo and
Sergio Vazquez and
Samir Kouro and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Variable-Angle {PS-PWM} Technique for Multilevel Cascaded H-Bridge
Converters With Large Number of Power Cells},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {68},
number = {8},
pages = {6773--6783},
year = {2021},
url = {https://doi.org/10.1109/TIE.2020.3000121},
doi = {10.1109/TIE.2020.3000121},
timestamp = {Tue, 27 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/AlcaideLPYLVKF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/Gomez-MerchanVA21,
author = {Rub{\'{e}}n G{\'{o}}mez{-}Merch{\'{a}}n and
Sergio Vazquez and
Abraham Marquez Alcaide and
Hossein Dehghani Tafti and
Jos{\'{e}} I. Leon and
Josep Pou and
Christian A. Rojas and
Samir Kouro and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Binary Search Based Flexible Power Point Tracking Algorithm for Photovoltaic
Systems},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {68},
number = {7},
pages = {5909--5920},
year = {2021},
url = {https://doi.org/10.1109/TIE.2020.2998743},
doi = {10.1109/TIE.2020.2998743},
timestamp = {Thu, 20 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/Gomez-MerchanVA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MarquezMTLBVLF21,
author = {Abraham Marquez and
Vito Giuseppe Monopoli and
Anatolii Tcai and
Jos{\'{e}} I. Leon and
Giampaolo Buticchi and
Sergio Vazquez and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Discontinuous-PWM Method for Multilevel {\textdollar}N{\textdollar}-Cell
Cascaded H-Bridge Converters},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {68},
number = {9},
pages = {7996--8005},
year = {2021},
url = {https://doi.org/10.1109/TIE.2020.3016245},
doi = {10.1109/TIE.2020.3016245},
timestamp = {Tue, 13 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/MarquezMTLBVLF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/assets/MackDJBTBBDGPP21,
author = {Kelly Mack and
Maitraye Das and
Dhruv Jain and
Danielle Bragg and
John Tang and
Andrew Begel and
Erin Beneteau and
Josh Urban Davis and
Abraham Glasser and
Joon Sung Park and
Venkatesh Potluri},
editor = {Jonathan Lazar and
Jinjuan Heidi Feng and
Faustina Hwang},
title = {Mixed Abilities and Varied Experiences: a group autoethnography of
a virtual summer internship},
booktitle = {{ASSETS} '21: The 23rd International {ACM} {SIGACCESS} Conference
on Computers and Accessibility, Virtual Event, USA, October 18-22,
2021},
pages = {21:1--21:13},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3441852.3471199},
doi = {10.1145/3441852.3471199},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/assets/MackDJBTBBDGPP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cf/MarshPAGSJSDMVA21,
author = {Ian Marsh and
Nicolae Paladi and
Henrik Abrahamsson and
Jonas Gustafsson and
Johan Sj{\"{o}}berg and
Andreas Johnsson and
Pontus Sk{\"{o}}ldstr{\"{o}}m and
Jim Dowling and
Paolo Monti and
Melina Vruna and
Mohsen Amiribesheli},
editor = {Maurizio Palesi and
Antonino Tumeo and
Georgios I. Goumas and
Carmen G. Almud{\'{e}}ver},
title = {Evolving 5G: ANIARA, an edge-cloud perspective},
booktitle = {{CF} '21: Computing Frontiers Conference, Virtual Event, Italy, May
11-13, 2021},
pages = {206--207},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3457388.3458622},
doi = {10.1145/3457388.3458622},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cf/MarshPAGSJSDMVA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/CambreWRBWT0K21,
author = {Julia Cambre and
Alex C. Williams and
Afsaneh Razi and
Ian Bicking and
Abraham Wallin and
Janice Y. Tsai and
Chinmay Kulkarni and
Jofish Kaye},
editor = {Yoshifumi Kitamura and
Aaron Quigley and
Katherine Isbister and
Takeo Igarashi and
Pernille Bj{\o}rn and
Steven Mark Drucker},
title = {Firefox Voice: An Open and Extensible Voice Assistant Built Upon the
Web},
booktitle = {{CHI} '21: {CHI} Conference on Human Factors in Computing Systems,
Virtual Event / Yokohama, Japan, May 8-13, 2021},
pages = {250:1--250:18},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3411764.3445409},
doi = {10.1145/3411764.3445409},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/chi/CambreWRBWT0K21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/JosephECAV21,
author = {Ebenezer Joseph and
Veena Easvaradoss and
David Chandran and
Suneera Abraham and
Sweta Vaddadi},
editor = {W. Tecumseh Fitch and
Claus Lamm and
Helmut Leder and
Kristin Te{\ss}mar{-}Raible},
title = {Malleability of Intelligence Through Chess Training - {A} Two Year
Empirical Study},
booktitle = {Proceedings of the 43rd Annual Meeting of the Cognitive Science Society,
CogSci 2021, virtual, July 26-29, 2021},
publisher = {cognitivesciencesociety.org},
year = {2021},
url = {https://escholarship.org/uc/item/767875c8},
timestamp = {Tue, 30 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/JosephECAV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compgeom/Abrahamsen0KLMU21,
author = {Mikkel Abrahamsen and
Jeff Erickson and
Irina Kostitsyna and
Maarten L{\"{o}}ffler and
Tillmann Miltzow and
J{\'{e}}r{\^{o}}me Urhausen and
Jordi L. Vermeulen and
Giovanni Viglietta},
editor = {Kevin Buchin and
{\'{E}}ric Colin de Verdi{\`{e}}re},
title = {Chasing Puppies: Mobile Beacon Routing on Closed Curves},
booktitle = {37th International Symposium on Computational Geometry, SoCG 2021,
June 7-11, 2021, Buffalo, NY, {USA} (Virtual Conference)},
series = {LIPIcs},
volume = {189},
pages = {5:1--5:19},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2021},
url = {https://doi.org/10.4230/LIPIcs.SoCG.2021.5},
doi = {10.4230/LIPICS.SOCG.2021.5},
timestamp = {Wed, 21 Aug 2024 22:46:00 +0200},
biburl = {https://dblp.org/rec/conf/compgeom/Abrahamsen0KLMU21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/HassanEBSVZHKKB21,
author = {Naimul Hassan and
Alexander J. Edwards and
Dhritiman Bhattacharya and
Mustafa M. Shihab and
Varun Venkat and
Peng Zhou and
Xuan Hu and
Shamik Kundu and
Abraham Peedikayil Kuruvila and
Kanad Basu and
Jayasimha Atulasimha and
Yiorgos Makris and
Joseph S. Friedman},
title = {Secure Logic Locking with Strain-Protected Nanomagnet Logic},
booktitle = {58th {ACM/IEEE} Design Automation Conference, {DAC} 2021, San Francisco,
CA, USA, December 5-9, 2021},
pages = {127--132},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/DAC18074.2021.9586258},
doi = {10.1109/DAC18074.2021.9586258},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/HassanEBSVZHKKB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/GonzalezZKG0WBA21,
author = {Abraham Gonzalez and
Jerry Zhao and
Ben Korpan and
Hasan Genc and
Colin Schmidt and
John Charles Wright and
Ayan Biswas and
Alon Amid and
Farhana Sheikh and
Anton Sorokin and
Sirisha Kale and
Mani Yalamanchi and
Ramya Yarlagadda and
Mark Flannigan and
Larry Abramowitz and
Elad Alon and
Yakun Sophia Shao and
Krste Asanovic and
Borivoje Nikolic},
title = {A 16mm\({}^{\mbox{2}}\) 106.1 {GOPS/W} Heterogeneous {RISC-V} Multi-Core
Multi-Accelerator SoC in Low-Power 22nm FinFET},
booktitle = {47th {ESSCIRC} 2021 - European Solid State Circuits Conference, {ESSCIR}
2021, Grenoble, France, September 13-22, 2021},
pages = {259--262},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ESSCIRC53450.2021.9567768},
doi = {10.1109/ESSCIRC53450.2021.9567768},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esscirc/GonzalezZKG0WBA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eucnc/Costa-RequenaAK21,
author = {Jos{\'{e}} Costa{-}Requena and
Abraham Afriyie and
Chartsias Panteleimon Konstantinos and
Karasoula Eleni and
Dimitrios Kritharidis and
Nicola Carapellese and
Eduardo Yusta Padilla},
title = {SDN-Enabled THz Wireless X-Haul for {B5G}},
booktitle = {Joint European Conference on Networks and Communications {\&}
6G Summit, EuCNC/6G Summit 2021, Porto, Portugal, June 8-11, 2021},
pages = {211--216},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/EuCNC/6GSummit51104.2021.9482494},
doi = {10.1109/EUCNC/6GSUMMIT51104.2021.9482494},
timestamp = {Tue, 14 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eucnc/Costa-RequenaAK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibica/AlfaMAAODM21,
author = {Abraham Ayegba Alfa and
Sanjay Misra and
Blessing Iganya Attah and
Kharimah Bimbola Ahmed and
Jonathan Oluranti and
Robertas Damasevicius and
Rytis Maskeliunas},
editor = {Ajith Abraham and
Ana Maria Madureira and
Arturas Kaklauskas and
Niketa Gandhi and
Anu Bajaj and
Azah Kamilah Muda and
Dalia Kriksciuniene and
Jo{\~{a}}o Carlos Ferreira},
title = {Development of Students' Results Help Desk System for First Tier Tertiary
Institutions},
booktitle = {Innovations in Bio-Inspired Computing and Applications - Proceedings
of the 12th International Conference on Innovations in Bio-Inspired
Computing and Applications {(IBICA} 2021) Held During December 16-18,
2021},
series = {Lecture Notes in Networks and Systems},
volume = {419},
pages = {830--841},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-96299-9\_78},
doi = {10.1007/978-3-030-96299-9\_78},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ibica/AlfaMAAODM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/MagdalenoFAR21,
author = {Jos{\'{e}} Luis Robles Magdaleno and
Mondher Farza and
Leonel Ernesto Amabilis{-}Sosa and
Abraham Efraim Rodriguez{-}Mata},
title = {A Lipchitz Observer Application in Photobioreactors for Microalgae
Cultivation},
booktitle = {18th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2021, Mexico City, Mexico, November
10-12, 2021},
pages = {1--7},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CCE53527.2021.9633099},
doi = {10.1109/CCE53527.2021.9633099},
timestamp = {Mon, 03 Jan 2022 22:36:53 +0100},
biburl = {https://dblp.org/rec/conf/iceee/MagdalenoFAR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/SaadiABBBBBCCCC21,
author = {Aymen Al Saadi and
Dario Alf{\`{e}} and
Yadu N. Babuji and
Agastya Bhati and
Ben Blaiszik and
Alexander Brace and
Thomas S. Brettin and
Kyle Chard and
Ryan Chard and
Austin Clyde and
Peter V. Coveney and
Ian T. Foster and
Tom Gibbs and
Shantenu Jha and
Kristopher Keipert and
Dieter Kranzlm{\"{u}}ller and
Thorsten Kurth and
Hyungro Lee and
Zhuozhao Li and
Heng Ma and
Gerald Mathias and
Andr{\'{e}} Merzky and
Alexander Partin and
Arvind Ramanathan and
Ashka Shah and
Abraham C. Stern and
Rick Stevens and
Li Tan and
Mikhail Titov and
Anda Trifan and
Aristeidis Tsaris and
Matteo Turilli and
Huub J. J. Van Dam and
Shunzhou Wan and
David Wifling and
Junqi Yin},
editor = {Xian{-}He Sun and
Sameer Shende and
Laxmikant V. Kal{\'{e}} and
Yong Chen},
title = {{IMPECCABLE:} Integrated Modeling PipelinE for {COVID} Cure by Assessing
Better LEads},
booktitle = {{ICPP} 2021: 50th International Conference on Parallel Processing,
Lemont, IL, USA, August 9 - 12, 2021},
pages = {40:1--40:12},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3472456.3473524},
doi = {10.1145/3472456.3473524},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpp/SaadiABBBBBCCCC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ict/Costa-RequenaKD21,
author = {Jos{\'{e}} Costa{-}Requena and
Chartsias Panteleimon Konstantinos and
Dimitrios Kritharidis and
Abraham Afriyie and
Nicola Carapellese and
Eduardo Yusta Padilla},
title = {SDN-enabled terahertz x-haul network},
booktitle = {28th International Conference on Telecommunications, {ICT} 2021, London,
United Kingdom, June 1-3, 2021},
pages = {1--5},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICT52184.2021.9511544},
doi = {10.1109/ICT52184.2021.9511544},
timestamp = {Tue, 14 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ict/Costa-RequenaKD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/CorreiaRAC21,
author = {Paula Ferreira da Cruz Correia and
Jo{\~{a}}o Gilberto Mendes dos Reis and
Emerson Rodolfo Abraham and
Jaqueline Severino da Costa},
editor = {Alexandre Dolgui and
Alain Bernard and
David Lemoine and
Gregor von Cieminski and
David Romero},
title = {Predicting Exports Using Time Series and Regression Trend Lines: Brazil
and Germany Competition in Green and Roasted Coffee Industry},
booktitle = {Advances in Production Management Systems. Artificial Intelligence
for Sustainable and Resilient Production Systems - {IFIP} {WG} 5.7
International Conference, {APMS} 2021, Nantes, France, September 5-9,
2021, Proceedings, Part {II}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {631},
pages = {630--636},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-85902-2\_67},
doi = {10.1007/978-3-030-85902-2\_67},
timestamp = {Fri, 12 Apr 2024 12:51:34 +0200},
biburl = {https://dblp.org/rec/conf/ifip5-7/CorreiaRAC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/HaghgooNAJA21,
author = {Faeze Haghgoo and
Ali Navaei and
Amir Aghsami and
Fariborz Jolai and
Ajith Abraham},
editor = {Ajith Abraham and
Niketa Gandhi and
Thomas Hanne and
Tzung{-}Pei Hong and
Tatiane Nogueira Rios and
Weiping Ding},
title = {Designing a Humanitarian Supply Chain for Pre and Post Disaster Planning
with Transshipment and Considering Perishability of Products},
booktitle = {Intelligent Systems Design and Applications - 21st International Conference
on Intelligent Systems Design and Applications {(ISDA} 2021) Held
During December 13-15, 2021},
series = {Lecture Notes in Networks and Systems},
volume = {418},
pages = {601--612},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-96308-8\_56},
doi = {10.1007/978-3-030-96308-8\_56},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isda/HaghgooNAJA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/BalenciagaLM21,
author = {Jon Xabier Balenciaga and
Jos{\'{e}} I. Leon and
Abraham Marquez},
title = {Parallel Interleaved Three-level Inverters Operation with Continuous
and Discontinuous {PWM} Methods},
booktitle = {30th {IEEE} International Symposium on Industrial Electronics, {ISIE}
2021, Kyoto, Japan, June 20-23, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISIE45552.2021.9576444},
doi = {10.1109/ISIE45552.2021.9576444},
timestamp = {Mon, 01 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isie/BalenciagaLM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/midp/AbrahamDVAFCG21,
author = {Rebecca Abraham and
Madeleine S. Durkee and
Margaret Veselits and
Junting Ai and
Jordan D. Fuhrman and
Marcus R. Clark and
Maryellen L. Giger},
editor = {John E. Tomaszewski and
Aaron D. Ward},
title = {Application and generalizability of U-Net segmentation of immune cells
in inflamed tissue},
booktitle = {Medical Imaging 2021: Digital Pathology, Online, February 15-19, 2021},
series = {{SPIE} Proceedings},
volume = {11603},
publisher = {{SPIE}},
year = {2021},
url = {https://doi.org/10.1117/12.2581063},
doi = {10.1117/12.2581063},
timestamp = {Wed, 13 Mar 2024 20:30:11 +0100},
biburl = {https://dblp.org/rec/conf/midp/AbrahamDVAFCG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/podc/AbrahamJMMST21,
author = {Ittai Abraham and
Philipp Jovanovic and
Mary Maller and
Sarah Meiklejohn and
Gilad Stern and
Alin Tomescu},
editor = {Avery Miller and
Keren Censor{-}Hillel and
Janne H. Korhonen},
title = {Reaching Consensus for Asynchronous Distributed Key Generation},
booktitle = {{PODC} '21: {ACM} Symposium on Principles of Distributed Computing,
Virtual Event, Italy, July 26-30, 2021},
pages = {363--373},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3465084.3467914},
doi = {10.1145/3465084.3467914},
timestamp = {Mon, 26 Jul 2021 09:04:22 +0200},
biburl = {https://dblp.org/rec/conf/podc/AbrahamJMMST21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qrs/AuttoKUOKHFAVK21,
author = {Teemu Autto and
Joni Kultanen and
Joonas Uusn{\"{a}}kki and
Mikael Ovaska and
Antti Kariluoto and
Joonas Himmanen and
Tapio Frantti and
Pekka Abrahamsson and
Mikko Virtaneva and
Pasi Kaitila},
title = {Visualizing Human Interactions in a Workspace Setting and Maintaining
Privacy},
booktitle = {21st {IEEE} International Conference on Software Quality, Reliability
and Security, {QRS} 2021 - Companion, Hainan, China, December 6-10,
2021},
pages = {448--453},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/QRS-C55045.2021.00072},
doi = {10.1109/QRS-C55045.2021.00072},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qrs/AuttoKUOKHFAVK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qrs/KariluotoKSPA21,
author = {Antti Kariluoto and
Joni Kultanen and
Jukka Soininen and
Arto P{\"{a}}rn{\"{a}}nen and
Pekka Abrahamsson},
title = {Quality of Data in Machine Learning},
booktitle = {21st {IEEE} International Conference on Software Quality, Reliability
and Security, {QRS} 2021 - Companion, Hainan, China, December 6-10,
2021},
pages = {216--221},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/QRS-C55045.2021.00040},
doi = {10.1109/QRS-C55045.2021.00040},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qrs/KariluotoKSPA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tvx/GarciaAA21,
author = {Sarah Garcia and
Soumya Joseph Abraham and
Marvin Andujar},
title = {Exploring Perceptions of Bystander Intervention Training using Virtual
Reality},
booktitle = {{IMX} '21: {ACM} International Conference on Interactive Media Experiences,
Virtual Event, USA, June 21-23, 2021},
pages = {253--257},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3452918.3465497},
doi = {10.1145/3452918.3465497},
timestamp = {Mon, 28 Jun 2021 18:09:30 +0200},
biburl = {https://dblp.org/rec/conf/tvx/GarciaAA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/KwanCF21,
author = {Jonathan C. Kwan and
Jesse M. Chaulk and
Abraham O. Fapojuwo},
title = {Artificial Neural Networks-based Ambient {RF} Energy Harvesting with
Environment Detection},
booktitle = {94th {IEEE} Vehicular Technology Conference, {VTC} Fall 2021, Norman,
OK, USA, September 27-30, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/VTC2021-Fall52928.2021.9625536},
doi = {10.1109/VTC2021-FALL52928.2021.9625536},
timestamp = {Mon, 20 Dec 2021 11:29:26 +0100},
biburl = {https://dblp.org/rec/conf/vtc/KwanCF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/w4a/GlasserGHVK21,
author = {Abraham Glasser and
Joseline Garcia and
Chang Hwang and
Christian Vogler and
Raja S. Kushalnagar},
editor = {Silvia Rodr{\'{\i}}guez V{\'{a}}zquez and
Ted Drake and
Dragan Ahmetovic and
Victoria Yaneva},
title = {Effect of caption width on the {TV} user experience by deaf and hard
of hearing viewers},
booktitle = {{W4A} '21: 18th Web for All Conference, Virtual Event / Ljubljana,
Slovenia, April 19-20, 2021},
pages = {27:1--27:5},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3430263.3452435},
doi = {10.1145/3430263.3452435},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/w4a/GlasserGHVK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xpu/HalmeVKJKRA21,
author = {Erika Halme and
Ville Vakkuri and
Joni Kultanen and
Marianna Jantunen and
Kai{-}Kristian Kemell and
Rebekah Rousi and
Pekka Abrahamsson},
editor = {Peggy Gregory and
Casper Lassenius and
Xiaofeng Wang and
Philippe Kruchten},
title = {How to Write Ethical User Stories? Impacts of the {ECCOLA} Method},
booktitle = {Agile Processes in Software Engineering and Extreme Programming -
22nd International Conference on Agile Software Development, {XP}
2021, Virtual Event, June 14-18, 2021, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {419},
pages = {36--52},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-78098-2\_3},
doi = {10.1007/978-3-030-78098-2\_3},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/xpu/HalmeVKJKRA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/21/AbrahamBELW21,
author = {Ralf Abraham and
Stefan Bischoff and
Johannes Epple and
Nils Labusch and
Simon Weiss},
editor = {Stephan Aier and
Peter Rohner and
Joachim Schelp},
title = {Mind the Gap: Why There Is a Gap Between Information Systems Research
and Practice, and How to Manage It},
booktitle = {Engineering the Transformation of the Enterprise - {A} Design Science
Research Perspective},
pages = {355--368},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-84655-8\_22},
doi = {10.1007/978-3-030-84655-8\_22},
timestamp = {Sun, 06 Oct 2024 20:54:52 +0200},
biburl = {https://dblp.org/rec/books/sp/21/AbrahamBELW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-06500,
author = {Kai{-}Kristian Kemell and
Atte Elonen and
Mari Suoranta and
Anh Nguyen{-}Duc and
Juan Garbajosa and
Rafael Chanin and
Jorge Melegati and
Usman Rafiq and
Abdullah Aldaeej and
Nana Assyne and
Afonso Sales and
Sami Hyrynsalmi and
Juhani Risku and
Henry Edison and
Pekka Abrahamsson},
title = {Business Model Canvas Should Pay More Attention to the Software Startup
Team},
journal = {CoRR},
volume = {abs/2102.06500},
year = {2021},
url = {https://arxiv.org/abs/2102.06500},
eprinttype = {arXiv},
eprint = {2102.06500},
timestamp = {Tue, 30 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-06500.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-09041,
author = {Ittai Abraham and
Philipp Jovanovic and
Mary Maller and
Sarah Meiklejohn and
Gilad Stern and
Alin Tomescu},
title = {Reaching Consensus for Asynchronous Distributed Key Generation},
journal = {CoRR},
volume = {abs/2102.09041},
year = {2021},
url = {https://arxiv.org/abs/2102.09041},
eprinttype = {arXiv},
eprint = {2102.09041},
timestamp = {Wed, 24 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-09041.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-09366,
author = {Kai{-}Kristian Kemell and
Polina Feshchenko and
Joonas Himmanen and
Abrar Hossain and
Furqan Jameel and
Raffaele Luigi Puca and
Teemu Vitikainen and
Joni Kultanen and
Juhani Risku and
Johannes Impi{\"{o}} and
Anssi Sorvisto and
Pekka Abrahamsson},
title = {Software startup education: gamifying growth hacking},
journal = {CoRR},
volume = {abs/2102.09366},
year = {2021},
url = {https://arxiv.org/abs/2102.09366},
eprinttype = {arXiv},
eprint = {2102.09366},
timestamp = {Wed, 24 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-09366.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-09811,
author = {Mikkel Abrahamsen and
Jeff Erickson and
Irina Kostitsyna and
Maarten L{\"{o}}ffler and
Tillmann Miltzow and
J{\'{e}}r{\^{o}}me Urhausen and
Jordi L. Vermeulen and
Giovanni Viglietta},
title = {Chasing Puppies: Mobile Beacon Routing on Closed Curves},
journal = {CoRR},
volume = {abs/2103.09811},
year = {2021},
url = {https://arxiv.org/abs/2103.09811},
eprinttype = {arXiv},
eprint = {2103.09811},
timestamp = {Tue, 23 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-09811.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-12633,
author = {Joshua Abraham and
Calden Wloka},
title = {Edge Detection for Satellite Images without Deep Networks},
journal = {CoRR},
volume = {abs/2105.12633},
year = {2021},
url = {https://arxiv.org/abs/2105.12633},
eprinttype = {arXiv},
eprint = {2105.12633},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-12633.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-10542,
author = {Arun Jose and
Abraham Francis},
title = {Reversible Colour Density Compression of Images using cGANs},
journal = {CoRR},
volume = {abs/2106.10542},
year = {2021},
url = {https://arxiv.org/abs/2106.10542},
eprinttype = {arXiv},
eprint = {2106.10542},
timestamp = {Thu, 01 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-10542.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-05553,
author = {Mikael Ovaska and
Joni Kultanen and
Teemu Autto and
Joonas Uusn{\"{a}}kki and
Antti Kariluoto and
Joonas Himmanen and
Mikko Virtaneva and
Pasi Kaitila and
Pekka Abrahamsson},
title = {Deep Neural Network Voice Activity Detector for Downsampled Audio
Data: An Experiment Report},
journal = {CoRR},
volume = {abs/2108.05553},
year = {2021},
url = {https://arxiv.org/abs/2108.05553},
eprinttype = {arXiv},
eprint = {2108.05553},
timestamp = {Wed, 18 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-05553.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-09207,
author = {Moumita Bhattacharya and
Dai{-}Yin Lu and
Ioannis Ventoulis and
Gabriela V. Greenland and
Hulya Yalcin and
Yufan Guan and
Joseph E. Marine and
Jeffrey E. Olgin and
Stefan L. Zimmerman and
Theodore P. Abraham and
M. Roselle Abraham and
Hagit Shatkay},
title = {Machine Learning Methods for Identifying Atrial Fibrillation Cases
and Their Predictors in Patients With Hypertrophic Cardiomyopathy:
The HCM-AF-Risk Model},
journal = {CoRR},
volume = {abs/2109.09207},
year = {2021},
url = {https://arxiv.org/abs/2109.09207},
eprinttype = {arXiv},
eprint = {2109.09207},
timestamp = {Mon, 27 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-09207.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-09210,
author = {Moumita Bhattacharya and
Dai{-}Yin Lu and
Shibani M. Kudchadkar and
Gabriela Villarreal Greenland and
Prasanth Lingamaneni and
Celia P. Corona{-}Villalobos and
Yufan Guan and
Joseph E. Marine and
Jeffrey E. Olgin and
Stefan L. Zimmerman and
Theodore P. Abraham and
Hagit Shatkay and
Maria Roselle Abraham},
title = {Identifying Ventricular Arrhythmias and Their Predictors by Applying
Machine Learning Methods to Electronic Health Records in Patients
With Hypertrophic Cardiomyopathy(HCM-VAr-Risk Model)},
journal = {CoRR},
volume = {abs/2109.09210},
year = {2021},
url = {https://arxiv.org/abs/2109.09210},
eprinttype = {arXiv},
eprint = {2109.09210},
timestamp = {Mon, 27 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-09210.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-09400,
author = {Antti Kariluoto and
Arto P{\"{a}}rn{\"{a}}nen and
Joni Kultanen and
Jukka Soininen and
Pekka Abrahamsson},
title = {Quality of Data in Machine Learning},
journal = {CoRR},
volume = {abs/2112.09400},
year = {2021},
url = {https://arxiv.org/abs/2112.09400},
eprinttype = {arXiv},
eprint = {2112.09400},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-09400.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ParedesNSMLJG20,
author = {Abraham Elias Ortega Paredes and
Lauro Roberto Nunes and
Max Mauro Dias Santos and
Leonardo Rodrigues Ara{\'{u}}jo Xavier de Menezes and
Kathya Silvia Collazos Linares and
Jo{\~{a}}o Francisco Justo and
Zonghua Gu},
title = {Simulation Performance Enhancement in Automotive Embedded Control
Using the Unscented Transform},
journal = {{IEEE} Access},
volume = {8},
pages = {222041--222049},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2019.2917931},
doi = {10.1109/ACCESS.2019.2917931},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ParedesNSMLJG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aci/PfeiferLAK20,
author = {Ethan Pfeifer and
Margaret Lozovatsky and
Joanna Abraham and
Thomas George Kannampallil},
title = {Effect of an Alternative Newborn Naming Strategy on Wrong-Patient
Errors: {A} Quasi-Experimental Study},
journal = {Appl. Clin. Inform.},
volume = {11},
number = {02},
pages = {235--241},
year = {2020},
url = {https://doi.org/10.1055/s-0040-1705175},
doi = {10.1055/S-0040-1705175},
timestamp = {Fri, 04 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aci/PfeiferLAK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/algorithms/Rodriguez-MataL20,
author = {Abraham Efraim Rodriguez{-}Mata and
Ricardo Luna and
Jos{\'{e}} Ricardo P{\'{e}}rez{-}Correa and
Alejandro Gonzalez{-}Huitr{\'{o}}n and
Rafael Castro{-}Linares and
Manuel A. Duarte{-}Mermoud},
title = {Fractional Sliding Mode Nonlinear Procedure for Robust Control of
an Eutrophying Microalgae Photobioreactor},
journal = {Algorithms},
volume = {13},
number = {3},
pages = {50},
year = {2020},
url = {https://doi.org/10.3390/a13030050},
doi = {10.3390/A13030050},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/algorithms/Rodriguez-MataL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/ParkMKH20,
author = {Junho Park and
R. Abraham Martin and
Jeffrey Dean Kelly and
John D. Hedengren},
title = {Benchmark temperature microcontroller for process dynamics and control},
journal = {Comput. Chem. Eng.},
volume = {135},
pages = {106736},
year = {2020},
url = {https://doi.org/10.1016/j.compchemeng.2020.106736},
doi = {10.1016/J.COMPCHEMENG.2020.106736},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cce/ParkMKH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/SanengaMJMBC20,
author = {Abraham Sanenga and
Galefang Allycan Mapunda and
Tshepiso Merapelo Ludo Jacob and
Leatile Marata and
Bokamoso Basutli and
Joseph Monamati Chuma},
title = {An Overview of Key Technologies in Physical Layer Security},
journal = {Entropy},
volume = {22},
number = {11},
pages = {1261},
year = {2020},
url = {https://doi.org/10.3390/e22111261},
doi = {10.3390/E22111261},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/SanengaMJMBC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcm/FernandezLSV20,
author = {Jos{\'{e}} R. Fern{\'{a}}ndez and
Jos{\'{e}} A. L{\'{o}}pez{-}Campos and
Abraham Segade and
J. A. Vil{\'{a}}n},
title = {{CMMSE} 2017 - a numerical method based on genetic algorithms for
the characterization of viscoelastic materials},
journal = {Int. J. Comput. Math.},
volume = {97},
number = {1-2},
pages = {294--311},
year = {2020},
url = {https://doi.org/10.1080/00207160.2019.1578348},
doi = {10.1080/00207160.2019.1578348},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcm/FernandezLSV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdc/MhaidliHSJT20,
author = {Abraham H. Mhaidli and
Libby Hemphill and
Florian Schaub and
Cundiff Jordan and
Andrea K. Thomer},
title = {Privacy Impact Assessments for Digital Repositories},
journal = {Int. J. Digit. Curation},
volume = {15},
number = {1},
pages = {1--5},
year = {2020},
url = {https://doi.org/10.2218/ijdc.v15i1.692},
doi = {10.2218/IJDC.V15I1.692},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdc/MhaidliHSJT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsn/DashALMR20,
author = {Sujata Dash and
Ajith Abraham and
Ashish Kumar Luhach and
Jolanta Mizera{-}Pietraszko and
Joel J. P. C. Rodrigues},
title = {Hybrid chaotic firefly decision making model for Parkinson's disease
diagnosis},
journal = {Int. J. Distributed Sens. Networks},
volume = {16},
number = {1},
year = {2020},
url = {https://doi.org/10.1177/1550147719895210},
doi = {10.1177/1550147719895210},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijdsn/DashALMR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijictrame/AsabereAANA20,
author = {Nana Yaw Asabere and
Joseph Agyiri and
Amevi Acakpovi and
Abraham Nachanja and
Priscilla Awuku},
title = {Improving Education Delivery in a Technical University in Ghana Through
Mobile Learning Technology},
journal = {Int. J. {ICT} Res. Afr. Middle East},
volume = {9},
number = {2},
pages = {35--59},
year = {2020},
url = {https://doi.org/10.4018/ijictrame.2020070103},
doi = {10.4018/IJICTRAME.2020070103},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijictrame/AsabereAANA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/AbrahamBG20,
author = {Joanna Abraham and
Shirley Burton and
Howard S. Gordon},
title = {Moving patients from emergency department to medical intensive care
unit: Tracing barriers and root contributors},
journal = {Int. J. Medical Informatics},
volume = {133},
year = {2020},
url = {https://doi.org/10.1016/j.ijmedinf.2019.104012},
doi = {10.1016/J.IJMEDINF.2019.104012},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/AbrahamBG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpe/AbrahamsenSA20,
author = {Eirik Bjorheim Abrahamsen and
Jon T{\o}mmer{\aa}s Selvik and
H{\aa}kon Bjorheim Abrahamsen},
title = {Using Cost-Effectiveness Acceptability Curves as a Basis for Prioritizing
Investments in Safety Measures in the Offshore Oil and Gas Industry},
journal = {Int. J. Perform. Eng.},
volume = {16},
number = {2},
pages = {163--170},
year = {2020},
url = {https://doi.org/10.23940/ijpe.20.02.p1.163170},
doi = {10.23940/IJPE.20.02.P1.163170},
timestamp = {Thu, 01 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpe/AbrahamsenSA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpe/AbrahamsenSLA20,
author = {Eirik Bjorheim Abrahamsen and
Jon T{\o}mmer{\aa}s Selvik and
Hans Petter Lohne and
{\O}ystein Arild},
title = {Plug and Abandonment Decision-Making: Quality at the Right Price},
journal = {Int. J. Perform. Eng.},
volume = {16},
number = {1},
pages = {1--9},
year = {2020},
url = {https://doi.org/10.23940/ijpe.20.01.p1.19},
doi = {10.23940/IJPE.20.01.P1.19},
timestamp = {Thu, 01 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpe/AbrahamsenSLA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpe/SelvikIA20,
author = {Jon T{\o}mmer{\aa}s Selvik and
Stanley Ian and
Eirik Bjorheim Abrahamsen},
title = {{SMART} Criteria for Quality Assessment of Key Performance Indicators
Used in the Oil and Gas Industry},
journal = {Int. J. Perform. Eng.},
volume = {16},
number = {7},
pages = {999--1007},
year = {2020},
url = {https://doi.org/10.23940/ijpe.20.07.p2.9991007},
doi = {10.23940/IJPE.20.07.P2.9991007},
timestamp = {Thu, 01 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpe/SelvikIA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpe/ThorrudAS20,
author = {Benny Thorrud and
Eirik Bjorheim Abrahamsen and
Jon T{\o}mmer{\aa}s Selvik},
title = {Safety-Instrumented Systems in Oil and Gas Improved Situational Awareness
with Embedded Signature Curves in Mimics},
journal = {Int. J. Perform. Eng.},
volume = {16},
number = {5},
pages = {681--690},
year = {2020},
url = {https://doi.org/10.23940/ijpe.20.05.p1.681690},
doi = {10.23940/IJPE.20.05.P1.681690},
timestamp = {Thu, 01 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpe/ThorrudAS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itor/HerranCMD20,
author = {Alberto Herran and
Jos{\'{e}} Manuel Colmenar and
Rafael Mart{\'{\i}} and
Abraham Duarte},
title = {A parallel variable neighborhood search approach for the obnoxious
p-median problem},
journal = {Int. Trans. Oper. Res.},
volume = {27},
number = {1},
pages = {336--360},
year = {2020},
url = {https://doi.org/10.1111/itor.12510},
doi = {10.1111/ITOR.12510},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/itor/HerranCMD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/SantiniZVAAJ20,
author = {Brianda L. Santini and
Mat{\'{\i}}as Z{\'{u}}{\~{n}}iga{-}Bustos and
Abraham Vidal{-}Limon and
Joel B. Alderete and
Sergio A. Aguila and
Ver{\'{o}}nica A. Jim{\'{e}}nez},
title = {In Silico Design of Novel Mutant Anti-MUC1 Aptamers for Targeted Cancer
Therapy},
journal = {J. Chem. Inf. Model.},
volume = {60},
number = {2},
pages = {786--793},
year = {2020},
url = {https://doi.org/10.1021/acs.jcim.9b00756},
doi = {10.1021/ACS.JCIM.9B00756},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/SantiniZVAAJ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/HerranCD20,
author = {Alberto Herran and
J. Manuel Colmenar and
Abraham Duarte},
title = {An efficient metaheuristic for the K-page crossing number minimization
problem},
journal = {Knowl. Based Syst.},
volume = {207},
pages = {106352},
year = {2020},
url = {https://doi.org/10.1016/j.knosys.2020.106352},
doi = {10.1016/J.KNOSYS.2020.106352},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/HerranCD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/AmidBGGKLMMOPRS20,
author = {Alon Amid and
David Biancolin and
Abraham Gonzalez and
Daniel Grubb and
Sagar Karandikar and
Harrison Liew and
Albert Magyar and
Howard Mao and
Albert J. Ou and
Nathan Pemberton and
Paul Rigge and
Colin Schmidt and
John Charles Wright and
Jerry Zhao and
Yakun Sophia Shao and
Krste Asanovic and
Borivoje Nikolic},
title = {Chipyard: Integrated Design, Simulation, and Implementation Framework
for Custom SoCs},
journal = {{IEEE} Micro},
volume = {40},
number = {4},
pages = {10--21},
year = {2020},
url = {https://doi.org/10.1109/MM.2020.2996616},
doi = {10.1109/MM.2020.2996616},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/AmidBGGKLMMOPRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/FairMSPEVKFTKKM20,
author = {Damien A. Fair and
Oscar Miranda{-}Dominguez and
Abraham Z. Snyder and
Anders Perrone and
Eric A. Earl and
Andrew N. Van and
Jonathan M. Koller and
Eric Feczko and
M. Dylan Tisdall and
Andr{\'{e}} J. W. van der Kouwe and
Rachel L. Klein and
Amy E. Mirro and
Jacqueline M. Hampton and
Babatunde Adeyemo and
Timothy O. Laumann and
Caterina Gratton and
Deanna J. Greene and
Bradley L. Schlaggar and
Nico U. F. Dosenbach},
title = {Correction of respiratory artifacts in {MRI} head motion estimates},
journal = {NeuroImage},
volume = {208},
pages = {116400},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2019.116400},
doi = {10.1016/J.NEUROIMAGE.2019.116400},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/FairMSPEVKFTKKM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/GrattonDCALWKGF20,
author = {Caterina Gratton and
Ally Dworetsky and
Rebecca S. Coalson and
Babatunde Adeyemo and
Timothy O. Laumann and
Gagan S. Wig and
Tania S. Kong and
Gabriele Gratton and
Monica Fabiani and
Deanna M. Barch and
Daniel Tranel and
Oscar Miranda{-}Dominguez and
Damien A. Fair and
Nico U. F. Dosenbach and
Abraham Z. Snyder and
Joel S. Perlmutter and
Steven E. Petersen and
Meghan C. Campbell},
title = {Removal of high frequency contamination from motion estimates in single-band
fMRI saves data without biasing functional connectivity},
journal = {NeuroImage},
volume = {217},
pages = {116866},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2020.116866},
doi = {10.1016/J.NEUROIMAGE.2020.116866},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/GrattonDCALWKGF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/KraftMRDBSRCL20,
author = {Andrew W. Kraft and
Anish Mitra and
Zachary P. Rosenthal and
Nico U. F. Dosenbach and
Adam Q. Bauer and
Abraham Z. Snyder and
Marcus E. Raichle and
Joseph P. Culver and
Jin{-}Moo Lee},
title = {Electrically coupled inhibitory interneurons constrain long-range
connectivity of cortical networks},
journal = {NeuroImage},
volume = {215},
pages = {116810},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2020.116810},
doi = {10.1016/J.NEUROIMAGE.2020.116810},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/KraftMRDBSRCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/Moya-SanchezXSS20,
author = {Eduardo Ulises Moya{-}S{\'{a}}nchez and
Sebasti{\`{a}} Xamb{\'{o}}{-}Descamps and
Abraham S{\'{a}}nchez and
Sebasti{\'{a}}n Salazar{-}Colores and
Jorge Mart{\'{\i}}nez{-}Ortega and
Ulises Cort{\'{e}}s},
title = {A bio-inspired quaternion local phase {CNN} layer with contrast invariance
and linear sensitivity to rotation angles},
journal = {Pattern Recognit. Lett.},
volume = {131},
pages = {56--62},
year = {2020},
url = {https://doi.org/10.1016/j.patrec.2019.12.001},
doi = {10.1016/J.PATREC.2019.12.001},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/prl/Moya-SanchezXSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/quantum/WesterbaanWW20,
author = {Abraham Westerbaan and
Bas Westerbaan and
John van de Wetering},
title = {The three types of normal sequential effect algebras},
journal = {Quantum},
volume = {4},
pages = {378},
year = {2020},
url = {https://doi.org/10.22331/q-2020-12-24-378},
doi = {10.22331/Q-2020-12-24-378},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/quantum/WesterbaanWW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/CamposOQ20,
author = {Jos{\'{e}} Abraham Montelongo Campos and
H{\'{e}}ctor Rafael Orozco{-}Aguirre and
Maricela Quintana},
title = {Simulaci{\'{o}}n y evaluaci{\'{o}}n del comportamiento de
peregrinos guadalupanos en un evento de sismo para planificar rutas
de evacuaci{\'{o}}n},
journal = {Res. Comput. Sci.},
volume = {149},
number = {8},
pages = {1195--1210},
year = {2020},
url = {https://rcs.cic.ipn.mx/2020\_149\_8/Simulacion\%20y\%20evaluacion\%20del\%20comportamiento\%20de\%20peregrinos\%20guadalupanos\%20en\%20un\%20evento\%20de\%20sismo.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/CamposOQ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Navarro-Hernandez20,
author = {Mar{\'{\i}}a In{\'{e}}s Navarro{-}Hern{\'{a}}ndez and
Roberto Tom{\'{a}}s and
Juan M. Lopez{-}Sanchez and
Abraham Cardenas{-}Tristan and
Jordi J. Mallorqu{\'{\i}}},
title = {Spatial Analysis of Land Subsidence in the San Luis Potosi Valley
Induced by Aquifer Overexploitation Using the Coherent Pixels Technique
{(CPT)} and Sentinel-1 InSAR Observation},
journal = {Remote. Sens.},
volume = {12},
number = {22},
pages = {3822},
year = {2020},
url = {https://doi.org/10.3390/rs12223822},
doi = {10.3390/RS12223822},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/Navarro-Hernandez20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/AbrahamsenMSAA20,
author = {Eirik Bjorheim Abrahamsen and
Maria Francesca Milazzo and
Jon T. Selvik and
Frank Asche and
H{\aa}kon Bjorheim Abrahamsen},
title = {Prioritising investments in safety measures in the chemical industry
by using the Analytic Hierarchy Process},
journal = {Reliab. Eng. Syst. Saf.},
volume = {198},
pages = {106811},
year = {2020},
url = {https://doi.org/10.1016/j.ress.2020.106811},
doi = {10.1016/J.RESS.2020.106811},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ress/AbrahamsenMSAA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/LangdalenAS20,
author = {Henrik Langdalen and
Eirik Bjorheim Abrahamsen and
Jon T. Selvik},
title = {On the importance of systems thinking when using the {ALARP} principle
for risk management},
journal = {Reliab. Eng. Syst. Saf.},
volume = {204},
pages = {107222},
year = {2020},
url = {https://doi.org/10.1016/j.ress.2020.107222},
doi = {10.1016/J.RESS.2020.107222},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ress/LangdalenAS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/VakkuriKKA20,
author = {Ville Vakkuri and
Kai{-}Kristian Kemell and
Joni Kultanen and
Pekka Abrahamsson},
title = {The Current State of Industrial Practice in Artificial Intelligence
Ethics},
journal = {{IEEE} Softw.},
volume = {37},
number = {4},
pages = {50--57},
year = {2020},
url = {https://doi.org/10.1109/MS.2020.2985621},
doi = {10.1109/MS.2020.2985621},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/software/VakkuriKKA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/softx/HerringGAMAAGHH20,
author = {Patrick K. Herring and
Chirranjeevi Balaji Gopal and
Muratahan Aykol and
Joseph Montoya and
Abraham Anapolsky and
Peter M. Attia and
William Gent and
Jens S. Hummelsh{\o}j and
Linda Hung and
Ha{-}Kyung Kwon and
Patrick Moore and
Daniel Schweigert and
Kristen A. Severson and
Santosh Suram and
Zi Yang and
Richard D. Braatz and
Brian D. Storey},
title = {{BEEP:} {A} Python library for Battery Evaluation and Early Prediction},
journal = {SoftwareX},
volume = {11},
pages = {100506},
year = {2020},
url = {https://doi.org/10.1016/j.softx.2020.100506},
doi = {10.1016/J.SOFTX.2020.100506},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/softx/HerringGAMAAGHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/YinL0LLVFW20,
author = {Yunfei Yin and
Jianxing Liu and
Abraham Marquez and
Xinpo Lin and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo and
Ligang Wu},
title = {Advanced Control Strategies for {DC-DC} Buck Converters With Parametric
Uncertainties via Experimental Evaluation},
journal = {{IEEE} Trans. Circuits Syst.},
volume = {67-I},
number = {12},
pages = {5257--5267},
year = {2020},
url = {https://doi.org/10.1109/TCSI.2020.3009168},
doi = {10.1109/TCSI.2020.3009168},
timestamp = {Wed, 13 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcas/YinL0LLVFW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MarquezGMVLF20,
author = {Abraham Marquez and
Jose Ignacio Le{\'{o}}n Galv{\'{a}}n and
Vito Giuseppe Monopoli and
Sergio Vazquez and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Generalized Harmonic Control for {CHB} Converters With Unbalanced
Cells Operation},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {67},
number = {11},
pages = {9039--9047},
year = {2020},
url = {https://doi.org/10.1109/TIE.2019.2956383},
doi = {10.1109/TIE.2019.2956383},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/MarquezGMVLF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MarquezMLKBVLF20,
author = {Abraham Marquez and
Vito Giuseppe Monopoli and
Jos{\'{e}} I. Leon and
Youngjong Ko and
Giampaolo Buticchi and
Sergio Vazquez and
Marco Liserre and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Sampling-Time Harmonic Control for Cascaded H-Bridge Converters With
Thermal Control},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {67},
number = {4},
pages = {2776--2785},
year = {2020},
url = {https://doi.org/10.1109/TIE.2019.2908593},
doi = {10.1109/TIE.2019.2908593},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/MarquezMLKBVLF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/ShenLLGVAFW20,
author = {Xiaoning Shen and
Jianxing Liu and
Wensheng Luo and
Jose Ignacio Le{\'{o}}n Galv{\'{a}}n and
Sergio Vazquez and
Abraham Marquez Alcaide and
Leopoldo Garc{\'{\i}}a Franquelo and
Ligang Wu},
title = {High-Performance Second-Order Sliding Mode Control for {NPC} Converters},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {16},
number = {8},
pages = {5345--5356},
year = {2020},
url = {https://doi.org/10.1109/TII.2019.2960550},
doi = {10.1109/TII.2019.2960550},
timestamp = {Wed, 13 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tii/ShenLLGVAFW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aicv2/GarciaOMOAOM20,
author = {Humberto Garcia and
Alberto Ochoa{-}Zezzatti and
Abraham Mart{\'{\i}}nez{-}Retamoza and
Gilberto Ochoa and
Lina Aguilar and
Diego Oliva and
Jos{\'{e}} Mej{\'{\i}}a},
editor = {Aboul Ella Hassanien and
Ahmad Taher Azar and
Tarek Gaber and
Diego Oliva and
Mohamed Fahmy Tolba},
title = {Use of Deep Learning for Bird Detection to Reduction of Collateral
Damage in Fruit Fields},
booktitle = {Proceedings of the International Conference on Artificial Intelligence
and Computer Vision, {AICV} 2020, Cairo, Egypt, 8-10 April, 2020},
series = {Advances in Intelligent Systems and Computing},
volume = {1153},
pages = {381--392},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-44289-7\_36},
doi = {10.1007/978-3-030-44289-7\_36},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aicv2/GarciaOMOAOM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/AbrahamMK20,
author = {Joanna Abraham and
Alicia Meng and
Thomas George Kannampallil},
title = {Clinician Perceptions of Barriers and Facilitators to Effective Postoperative
Handoffs},
booktitle = {{AMIA} 2020, American Medical Informatics Association Annual Symposium,
Virtual Event, USA, November 14-18, 2020},
publisher = {{AMIA}},
year = {2020},
url = {https://knowledge.amia.org/72332-amia-1.4602255/t004-1.4605866/t004-1.4605867/3416622-1.4606201},
timestamp = {Wed, 17 Apr 2024 11:47:01 +0200},
biburl = {https://dblp.org/rec/conf/amia/AbrahamMK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/PfeiferWAK20,
author = {Ethan Pfeifer and
Najjuwah Walden and
Joanna Abraham and
Thomas George Kannampallil},
title = {Intraoperative Anesthesia Transitions of Care and Adverse Events:
{A} Systematic Review and Meta-Analysis},
booktitle = {{AMIA} 2020, American Medical Informatics Association Annual Symposium,
Virtual Event, USA, November 14-18, 2020},
publisher = {{AMIA}},
year = {2020},
url = {https://knowledge.amia.org/72332-amia-1.4602255/t005-1.4604904/t005-1.4604905/3416108-1.4605260/3417021-1.4605257},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/PfeiferWAK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arch/AbateBCDHKLPRSS20,
author = {Alessandro Abate and
Henk A. P. Blom and
Nathalie Cauchi and
Joanna Delicaris and
Arnd Hartmanns and
Mahmoud Khaled and
Abolfazl Lavaei and
Carina Pilch and
Anne Remke and
Stefan Schupp and
Fedor Shmarov and
Sadegh Soudjani and
Abraham P. Vinod and
Ben Wooding and
Majid Zamani and
Paolo Zuliani},
title = {{ARCH-COMP20} Category Report: Stochastic Models},
booktitle = {{ARCH20.} 7th International Workshop on Applied Verification of Continuous
and Hybrid Systems (ARCH20), Berlin, Germany, July 12, 2020},
series = {EPiC Series in Computing},
volume = {74},
pages = {76--106},
publisher = {EasyChair},
year = {2020},
url = {https://doi.org/10.29007/mqzc},
doi = {10.29007/MQZC},
timestamp = {Tue, 20 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/arch/AbateBCDHKLPRSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/AgrawalABCFHHTK20,
author = {Ankit Agrawal and
Sophia J. Abraham and
Benjamin Burger and
Chichi Christine and
Luke Fraser and
John M. Hoeksema and
Sarah Hwang and
Elizabeth Travnik and
Shreya Kumar and
Walter J. Scheirer and
Jane Cleland{-}Huang and
Michael Vierhauser and
Ryan Bauer and
Steve Cox},
editor = {Regina Bernhaupt and
Florian 'Floyd' Mueller and
David Verweij and
Josh Andres and
Joanna McGrenere and
Andy Cockburn and
Ignacio Avellino and
Alix Goguey and
Pernille Bj{\o}n and
Shengdong Zhao and
Briane Paul Samson and
Rafal Kocielnik},
title = {The Next Generation of Human-Drone Partnerships: Co-Designing an Emergency
Response System},
booktitle = {{CHI} '20: {CHI} Conference on Human Factors in Computing Systems,
Honolulu, HI, USA, April 25-30, 2020},
pages = {1--13},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3313831.3376825},
doi = {10.1145/3313831.3376825},
timestamp = {Wed, 12 Jun 2024 07:39:18 +0200},
biburl = {https://dblp.org/rec/conf/chi/AgrawalABCFHHTK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/JosephEAV20,
author = {Ebenezer Joseph and
Veena Easvaradoss and
Suneera Abraham and
Sweta Vaddadi},
editor = {Stephanie Denison and
Michael L. Mack and
Yang Xu and
Blair C. Armstrong},
title = {Malleability of Working Memory Through Chess in Schoolchildren - {A}
Two-Year Intervention Study},
booktitle = {Proceedings of the 42th Annual Meeting of the Cognitive Science Society
- Developing a Mind: Learning in Humans, Animals, and Machines, CogSci
2020, virtual, July 29 - August 1, 2020},
publisher = {cognitivesciencesociety.org},
year = {2020},
url = {https://cogsci.mindmodeling.org/2020/papers/0493/index.html},
timestamp = {Thu, 25 Apr 2024 16:58:16 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/JosephEAV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cui/WilliamsCBWTK20,
author = {Alex C. Williams and
Julia Cambre and
Ian Bicking and
Abraham Wallin and
Janice Y. Tsai and
Jofish Kaye},
editor = {Mar{\'{\i}}a In{\'{e}}s Torres and
Stephan Schl{\"{o}}gl and
Leigh Clark and
Martin Porcheron},
title = {Toward Voice-Assisted Browsers: {A} Preliminary Study with Firefox
Voice},
booktitle = {Proceedings of the 2nd Conference on Conversational User Interfaces,
{CUI} 2020, Bilbao, Spain, July 22-24, 2020},
pages = {49:1--49:4},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3405755.3406154},
doi = {10.1145/3405755.3406154},
timestamp = {Tue, 21 Jul 2020 16:29:26 +0200},
biburl = {https://dblp.org/rec/conf/cui/WilliamsCBWTK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/AmidBGGKLMMOPR020,
author = {Alon Amid and
David Biancolin and
Abraham Gonzalez and
Daniel Grubb and
Sagar Karandikar and
Harrison Liew and
Albert Magyar and
Howard Mao and
Albert J. Ou and
Nathan Pemberton and
Paul Rigge and
Colin Schmidt and
John Charles Wright and
Jerry Zhao and
Jonathan Bachrach and
Yakun Sophia Shao and
Borivoje Nikolic and
Krste Asanovic},
title = {Invited: Chipyard - An Integrated SoC Research and Implementation
Environment},
booktitle = {57th {ACM/IEEE} Design Automation Conference, {DAC} 2020, San Francisco,
CA, USA, July 20-24, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/DAC18072.2020.9218756},
doi = {10.1109/DAC18072.2020.9218756},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dac/AmidBGGKLMMOPR020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dcis/AbellaBCCCDFGHH20,
author = {Jaume Abella and
Calvin Bulla and
Guillem Cabo and
Francisco J. Cazorla and
Adri{\'{a}}n Cristal and
Max Doblas and
Roger Figueras and
Alberto Gonz{\'{a}}lez and
Carles Hern{\'{a}}ndez and
C{\'{e}}sar Hern{\'{a}}ndez and
V{\'{\i}}ctor Jim{\'{e}}nez and
Leonidas Kosmidis and
Vatistas Kostalabros and
Rub{\'{e}}n Langarita and
Neiel Leyva and
Guillem L{\'{o}}pez{-}Parad{\'{\i}}s and
Joan Marimon and
Ricardo Mart{\'{\i}}nez and
Jonnatan Mendoza and
Francesc Moll and
Miquel Moret{\'{o}} and
Juli{\'{a}}n Pav{\'{o}}n and
Crist{\'{o}}bal Ram{\'{\i}}rez and
Marco Antonio Ram{\'{\i}}rez and
Carlos Rojas Morales and
Antonio Rubio and
Abraham Ruiz and
Nehir S{\"{o}}nmez and
V{\'{\i}}ctor Soria and
Llu{\'{\i}}s Ter{\'{e}}s and
Osman S. Unsal and
Mateo Valero and
Iv{\'{a}}n Vargas Valdivieso and
Luis Villa},
title = {An Academic {RISC-V} Silicon Implementation Based on Open-Source Components},
booktitle = {{XXXV} Conference on Design of Circuits and Integrated Systems, {DCIS}
2020, Segovia, Spain, November 18-20, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/DCIS51330.2020.9268664},
doi = {10.1109/DCIS51330.2020.9268664},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dcis/AbellaBCCCDFGHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/KemellESNGCMRAA20,
author = {Kai{-}Kristian Kemell and
Atte Elonen and
Mari Suoranta and
Anh Nguyen{-}Duc and
Juan Garbajosa and
Rafael Chanin and
Jorge Melegati and
Usman Rafiq and
Abdullah Aldaeej and
Nana Assyne and
Afonso Sales and
Sami Hyrynsalmi and
Juhani Risku and
Henry Edison and
Pekka Abrahamsson},
title = {Business Model Canvas Should Pay More Attention to the Software Startup
Team},
booktitle = {46th Euromicro Conference on Software Engineering and Advanced Applications,
{SEAA} 2020, Portoroz, Slovenia, August 26-28, 2020},
pages = {342--345},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/SEAA51224.2020.00063},
doi = {10.1109/SEAA51224.2020.00063},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/euromicro/KemellESNGCMRAA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fusion/MaraisLBCWNS20,
author = {Laurette Marais and
Johannes A. Louw and
Jaco Badenhorst and
Karen Calteaux and
Ilana Wilken and
Nina van Niekerk and
Glenn Stein},
title = {AwezaMed: {A} Multilingual, Multimodal Speech-To-Speech Translation
Application for Maternal Health Care},
booktitle = {{IEEE} 23rd International Conference on Information Fusion, {FUSION}
2020, Rustenburg, South Africa, July 6-9, 2020},
pages = {1--8},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.23919/FUSION45008.2020.9190240},
doi = {10.23919/FUSION45008.2020.9190240},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fusion/MaraisLBCWNS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/his/YunanaAMDMJ20,
author = {Kefas Yunana and
Abraham Ayegba Alfa and
Sanjay Misra and
Robertas Damasevicius and
Rytis Maskeliunas and
Oluranti Jonathan},
editor = {Ajith Abraham and
Thomas Hanne and
Oscar Castillo and
Niketa Gandhi and
Tatiane Nogueira Rios and
Tzung{-}Pei Hong},
title = {Internet of Things: Applications, Adoptions and Components - {A} Conceptual
Overview},
booktitle = {Hybrid Intelligent Systems - 20th International Conference on Hybrid
Intelligent Systems {(HIS} 2020), Virtual Event, India, December 14-16,
2020},
series = {Advances in Intelligent Systems and Computing},
volume = {1375},
pages = {494--504},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-73050-5\_50},
doi = {10.1007/978-3-030-73050-5\_50},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/his/YunanaAMDMJ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/DasMFBJMPYMTMBC20,
author = {Priyanka Das and
Joseph McGrath and
Zhaoyuan Fang and
Aidan Boyd and
Ganghee Jang and
Amir Mohammadi and
Sandip Purnapatra and
David Yambay and
S{\'{e}}bastien Marcel and
Mateusz Trokielewicz and
Piotr Maciejewicz and
Kevin W. Bowyer and
Adam Czajka and
Stephanie Schuckers and
Juan E. Tapia and
Sebastian Gonzalez and
Meiling Fang and
Naser Damer and
Fadi Boutros and
Arjan Kuijper and
Renu Sharma and
Cunjian Chen and
Arun Ross},
title = {Iris Liveness Detection Competition (LivDet-Iris) - The 2020 Edition},
booktitle = {2020 {IEEE} International Joint Conference on Biometrics, {IJCB} 2020,
Houston, TX, USA, September 28 - October 1, 2020},
pages = {1--9},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IJCB48548.2020.9304941},
doi = {10.1109/IJCB48548.2020.9304941},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/DasMFBJMPYMTMBC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsa/Soto-SumuanoVMT20,
author = {Jes{\'{u}}s Leonardo Soto{-}Sumuano and
Jos{\'{e}} Luis Cendejas Vald{\'{e}}z and
Heberto Ferreira Medina and
Jos{\'{e}} Alberto Tlacuilo{-}Parra and
Gustavo Abraham Vanegas{-}Contreras and
Juan Jes{\'{u}}s Ocampo Hidalgo},
editor = {Osvaldo Gervasi and
Beniamino Murgante and
Sanjay Misra and
Chiara Garau and
Ivan Blecic and
David Taniar and
Bernady O. Apduhan and
Ana Maria A. C. Rocha and
Eufemia Tarantino and
Carmelo Maria Torre and
Yeliz Karaca},
title = {Human Health Impact of E-Waste in Mexico},
booktitle = {Computational Science and Its Applications - {ICCSA} 2020 - 20th International
Conference, Cagliari, Italy, July 1-4, 2020, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12250},
pages = {162--173},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-58802-1\_12},
doi = {10.1007/978-3-030-58802-1\_12},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccsa/Soto-SumuanoVMT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iciis/AbrahamKB20,
author = {Jasmine Mannil Abraham and
Hardeep Kumar and
G. Josemin Bala},
title = {Li-Fi: Illuminating the Future of Internet},
booktitle = {15th {IEEE} International Conference on Industrial and Information
Systems, {ICIIS} 2020, Rupnagar, India, November 26-28, 2020},
pages = {550--554},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICIIS51140.2020.9342641},
doi = {10.1109/ICIIS51140.2020.9342641},
timestamp = {Mon, 09 Aug 2021 09:51:51 +0200},
biburl = {https://dblp.org/rec/conf/iciis/AbrahamKB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icit2/YinLPMFV20,
author = {Jiapeng Yin and
Jos{\'{e}} I. Leon and
Marcelo A. P{\'{e}}rez and
Abraham Marquez and
Leopoldo Garc{\'{\i}}a Franquelo and
Sergio Vazquez},
title = {{FS-MPC} Method for MMCs with Large Number of Submodules with Reduced
Computational Cost},
booktitle = {2020 {IEEE} International Conference on Industrial Technology, {ICIT}
2020, Buenos Aires, Argentina, February 26-28, 2020},
pages = {1083--1088},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICIT45562.2020.9067174},
doi = {10.1109/ICIT45562.2020.9067174},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icit2/YinLPMFV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsc-cities/Escamilla-Ambrosio20,
author = {Ponciano Jorge Escamilla{-}Ambrosio and
Maria G. Pulido{-}Navarro and
Isabel V. Hern{\'{a}}ndez{-}Guti{\'{e}}rrez and
Abraham Rodriguez{-}Mota and
Marco Antonio Moreno Ibarra},
editor = {Sergio Nesmachnow and
Luis Hern{\'{a}}ndez{-}Callejo},
title = {Crowdsourcing and IoT Towards More Resilient Flooding Prone Cities},
booktitle = {Smart Cities - Third Ibero-American Congress, ICSC-Cities 2020, San
Jos{\'{e}}, Costa Rica, November 9-11, 2020, Revised Selected
Papers},
series = {Communications in Computer and Information Science},
volume = {1359},
pages = {139--153},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-69136-3\_10},
doi = {10.1007/978-3-030-69136-3\_10},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsc-cities/Escamilla-Ambrosio20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsob/KolehmainenLKKA20,
author = {Taija Kolehmainen and
Gabriella Laatikainen and
Joni Kultanen and
Erol Kazan and
Pekka Abrahamsson},
editor = {Eriks Klotins and
Krzysztof Wnuk},
title = {Using Blockchain in Digitalizing Enterprise Legacy Systems: An Experience
Report},
booktitle = {Software Business - 11th International Conference, {ICSOB} 2020, Karlskrona,
Sweden, November 16-18, 2020, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {407},
pages = {70--85},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-67292-8\_6},
doi = {10.1007/978-3-030-67292-8\_6},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icsob/KolehmainenLKKA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icta2/AlfaAOO20,
author = {Abraham Ayegba Alfa and
John Kolo Alhassan and
Olayemi Mikail Olaniyi and
Morufu Olalere},
editor = {Sanjay Misra and
Bilkisu Larai Muhammad{-}Bello},
title = {Sooner Lightweight Cryptosystem: Towards Privacy Preservation of Resource-Constrained
Devices},
booktitle = {Information and Communication Technology and Applications - Third
International Conference, {ICTA} 2020, Minna, Nigeria, November 24-27,
2020, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1350},
pages = {415--429},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-69143-1\_32},
doi = {10.1007/978-3-030-69143-1\_32},
timestamp = {Tue, 17 Aug 2021 16:31:26 +0200},
biburl = {https://dblp.org/rec/conf/icta2/AlfaAOO20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/JosephARJN20,
author = {Sherin Joseph and
Ajay Koshy Abraham and
Pinkymol Harikrishna Raj and
Jineeth Joseph and
K. R. M. Nair},
title = {An Iterative Algorithm for Optimum Design of High Frequency Transformer
in {SST} Application},
booktitle = {The 46th Annual Conference of the {IEEE} Industrial Electronics Society,
{IECON} 2020, Singapore, October 18-21, 2020},
pages = {1538--1543},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IECON43393.2020.9254914},
doi = {10.1109/IECON43393.2020.9254914},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/JosephARJN20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/KimLLSOASAAFHLR20,
author = {Edward Kim and
Robert Vincent Leslie and
C.{-}H. Joseph Lyu and
Craig K. Smith and
Idahosa A. Osaretin and
Saji Abraham and
Matt Sammons and
Kent Anderson and
Joel Amato and
James Fuentes and
Mark Hernquist and
Mike Landrum and
Fabian Rodriguez{-}Gutierrez and
James Kam and
Peter Cho and
Hu Yang and
Quanhua (Mark) Liu and
Ninghai Sun},
title = {Pre-Launch Performance of the Advanced Technology Microwave Sounder
{(ATMS)} on the Joint Polar Satellite System-2 Satellite {(JPSS-2)}},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2020, Waikoloa, HI, USA, September 26 - October 2, 2020},
pages = {6353--6356},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IGARSS39084.2020.9324605},
doi = {10.1109/IGARSS39084.2020.9324605},
timestamp = {Thu, 11 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/KimLLSOASAAFHLR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ilrn/XuMKCHC20,
author = {Xuanhui Xu and
Eleni E. Mangina and
David Kilroy and
Kathleen M. Curran and
John J. Healy and
Abraham G. Campbell},
editor = {Daphne Economou and
Alexander Klippel and
Heather Dodds and
Anasol Pe{\~{n}}a{-}R{\'{\i}}os and
Mark J. W. Lee and
Dennis Beck and
Johanna Pirker and
Andreas Dengel and
Tiago M. Peres and
Jonathon Richter},
title = {Doctoral Colloquium - {A} Snapshot of the Future: Virtual and Augmented
Reality Training for Radiology},
booktitle = {6th International Conference of the Immersive Learning Research Network,
iLRN 2020, San Luis Obispo, CA, USA, June 21-25, 2020},
pages = {407--410},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.23919/iLRN47897.2020.9155131},
doi = {10.23919/ILRN47897.2020.9155131},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ilrn/XuMKCHC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwai2/ImohiosenW020,
author = {Abraham Imohiosen and
Joe Watson and
Jan Peters},
editor = {Tim Verbelen and
Pablo Lanillos and
Christopher L. Buckley and
Cedric De Boom},
title = {Active Inference or Control as Inference? {A} Unifying View},
booktitle = {Active Inference - First International Workshop, {IWAI} 2020, Co-located
with {ECML/PKDD} 2020, Ghent, Belgium, September 14, 2020, Proceedings},
series = {Communications in Computer and Information Science},
volume = {1326},
pages = {12--19},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-64919-7\_2},
doi = {10.1007/978-3-030-64919-7\_2},
timestamp = {Mon, 08 May 2023 14:35:45 +0200},
biburl = {https://dblp.org/rec/conf/iwai2/ImohiosenW020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lics/WesterbaanWW20,
author = {Abraham Westerbaan and
Bas Westerbaan and
John van de Wetering},
editor = {Holger Hermanns and
Lijun Zhang and
Naoki Kobayashi and
Dale Miller},
title = {A characterisation of ordered abstract probabilities},
booktitle = {{LICS} '20: 35th Annual {ACM/IEEE} Symposium on Logic in Computer
Science, Saarbr{\"{u}}cken, Germany, July 8-11, 2020},
pages = {944--957},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3373718.3394742},
doi = {10.1145/3373718.3394742},
timestamp = {Sat, 30 Sep 2023 09:52:07 +0200},
biburl = {https://dblp.org/rec/conf/lics/WesterbaanWW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/AbrahamGSBCCJJS20,
author = {Basil Abraham and
Danish Goel and
Divya Siddarth and
Kalika Bali and
Manu Chopra and
Monojit Choudhury and
Pratik Joshi and
Preethi Jyothi and
Sunayana Sitaram and
Vivek Seshadri},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Crowdsourcing Speech Data for Low-Resource Languages from Low-Income
Workers},
booktitle = {Proceedings of The 12th Language Resources and Evaluation Conference,
{LREC} 2020, Marseille, France, May 11-16, 2020},
pages = {2819--2826},
publisher = {European Language Resources Association},
year = {2020},
url = {https://aclanthology.org/2020.lrec-1.343/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/AbrahamGSBCCJJS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micad/AbrahamJSKMYMLM20,
author = {Rohan Abraham and
Ian Janzen and
Saeed Seyyedi and
Sukhinder Khattra and
John Mayo and
Ren Yuan and
Renelle Myers and
Stephen Lam and
Calum E. MacAulay},
editor = {Horst K. Hahn and
Maciej A. Mazurowski},
title = {Machine learning and deep learning approaches for classification of
sub-cm lung nodules in {CT} scans (Conference Presentation)},
booktitle = {Medical Imaging 2020: Computer-Aided Diagnosis, Houston, TX, USA,
February 16-19, 2020},
series = {{SPIE} Proceedings},
volume = {11314},
publisher = {{SPIE}},
year = {2020},
url = {https://doi.org/10.1117/12.2546422},
doi = {10.1117/12.2546422},
timestamp = {Tue, 05 Mar 2024 15:24:16 +0100},
biburl = {https://dblp.org/rec/conf/micad/AbrahamJSKMYMLM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sacair/Louw20,
author = {Johannes A. Louw},
editor = {Aurona J. Gerber},
title = {Text-to-Speech Duration Models for Resource-Scarce Languages in Neural
Architectures},
booktitle = {Artificial Intelligence Research - First Southern African Conference
for {AI} Research, {SACAIR} 2020, Muldersdrift, South Africa, February
22-26, 2021, Proceedings},
series = {Communications in Computer and Information Science},
volume = {1342},
pages = {141--153},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-66151-9\_9},
doi = {10.1007/978-3-030-66151-9\_9},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sacair/Louw20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/20/KemellFHHJPVKRISA20,
author = {Kai{-}Kristian Kemell and
Polina Feshchenko and
Joonas Himmanen and
Abrar Hossain and
Furqan Jameel and
Raffaele Luigi Puca and
Teemu Vitikainen and
Joni Kultanen and
Juhani Risku and
Johannes Impi{\"{o}} and
Anssi Sorvisto and
Pekka Abrahamsson},
editor = {Anh Nguyen{-}Duc and
J{\"{u}}rgen M{\"{u}}nch and
Rafael Prikladnicki and
Xiaofeng Wang and
Pekka Abrahamsson},
title = {Software Startup Education: Gamifying Growth Hacking},
booktitle = {Fundamentals of Software Startups - Essential Engineering and Business
Aspects},
pages = {269--277},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-35983-6\_16},
doi = {10.1007/978-3-030-35983-6\_16},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/20/KemellFHHJPVKRISA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/socpar/2018,
editor = {Ana Maria Madureira and
Ajith Abraham and
Niketa Gandhi and
Catarina Silva and
M{\'{a}}rio Antunes},
title = {Proceedings of the Tenth International Conference on Soft Computing
and Pattern Recognition, SoCPaR 2018, Porto, Portugal, December 13-15,
2018},
series = {Advances in Intelligent Systems and Computing},
volume = {942},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-17065-3},
doi = {10.1007/978-3-030-17065-3},
isbn = {978-3-030-17064-6},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/socpar/2018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-03849,
author = {Ankit Agrawal and
Sophia J. Abraham and
Benjamin Burger and
Chichi Christine and
Luke Fraser and
John M. Hoeksema and
Sara Hwang and
Elizabeth Travnik and
Shreya Kumar and
Walter J. Scheirer and
Jane Cleland{-}Huang and
Michael Vierhauser and
Ryan Bauer and
Steve Cox},
title = {The Next Generation of Human-Drone Partnerships: Co-Designing an Emergency
Response System},
journal = {CoRR},
volume = {abs/2001.03849},
year = {2020},
url = {https://arxiv.org/abs/2001.03849},
eprinttype = {arXiv},
eprint = {2001.03849},
timestamp = {Mon, 07 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-03849.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-00782,
author = {Sanket Shah and
Basil Abraham and
Gurunath Reddy M and
Sunayana Sitaram and
Vikas Joshi},
title = {Learning to Recognize Code-switched Speech Without Forgetting Monolingual
Speech Recognition},
journal = {CoRR},
volume = {abs/2006.00782},
year = {2020},
url = {https://arxiv.org/abs/2006.00782},
eprinttype = {arXiv},
eprint = {2006.00782},
timestamp = {Tue, 09 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-00782.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-05257,
author = {Gurunath Reddy Madhumani and
Sanket Shah and
Basil Abraham and
Vikas Joshi and
Sunayana Sitaram},
title = {Learning not to Discriminate: Task Agnostic Learning for Improving
Monolingual and Code-switched Speech Recognition},
journal = {CoRR},
volume = {abs/2006.05257},
year = {2020},
url = {https://arxiv.org/abs/2006.05257},
eprinttype = {arXiv},
eprint = {2006.05257},
timestamp = {Fri, 12 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-05257.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-02641,
author = {Louis Abraham and
Gary B{\'{e}}cigneul and
Benjamin Coleman and
Bernhard Sch{\"{o}}lkopf and
Anshumali Shrivastava and
Alexander J. Smola},
title = {Bloom Origami Assays: Practical Group Testing},
journal = {CoRR},
volume = {abs/2008.02641},
year = {2020},
url = {https://arxiv.org/abs/2008.02641},
eprinttype = {arXiv},
eprint = {2008.02641},
timestamp = {Fri, 07 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-02641.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-00749,
author = {Priyanka Das and
Joseph McGrath and
Zhaoyuan Fang and
Aidan Boyd and
Ganghee Jang and
Amir Mohammadi and
Sandip Purnapatra and
David Yambay and
S{\'{e}}bastien Marcel and
Mateusz Trokielewicz and
Piotr Maciejewicz and
Kevin W. Bowyer and
Adam Czajka and
Stephanie Schuckers and
Juan E. Tapia and
Sebastian Gonzalez and
Meiling Fang and
Naser Damer and
Fadi Boutros and
Arjan Kuijper and
Renu Sharma and
Cunjian Chen and
Arun Ross},
title = {Iris Liveness Detection Competition (LivDet-Iris) - The 2020 Edition},
journal = {CoRR},
volume = {abs/2009.00749},
year = {2020},
url = {https://arxiv.org/abs/2009.00749},
eprinttype = {arXiv},
eprint = {2009.00749},
timestamp = {Tue, 14 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-00749.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-00262,
author = {Joe Watson and
Abraham Imohiosen and
Jan Peters},
title = {Active Inference or Control as Inference? {A} Unifying View},
journal = {CoRR},
volume = {abs/2010.00262},
year = {2020},
url = {https://arxiv.org/abs/2010.00262},
eprinttype = {arXiv},
eprint = {2010.00262},
timestamp = {Mon, 12 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-00262.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-06574,
author = {Aymen Al Saadi and
Dario Alf{\`{e}} and
Yadu N. Babuji and
Agastya Bhati and
Ben Blaiszik and
Thomas S. Brettin and
Kyle Chard and
Ryan Chard and
Peter V. Coveney and
Anda Trifan and
Alex Brace and
Austin Clyde and
Ian T. Foster and
Tom Gibbs and
Shantenu Jha and
Kristopher Keipert and
Thorsten Kurth and
Dieter Kranzlm{\"{u}}ller and
Hyungro Lee and
Zhuozhao Li and
Heng Ma and
Andr{\'{e}} Merzky and
Gerald Mathias and
Alexander Partin and
Junqi Yin and
Arvind Ramanathan and
Ashka Shah and
Abraham C. Stern and
Rick Stevens and
Li Tan and
Mikhail Titov and
Aristeidis Tsaris and
Matteo Turilli and
Huub J. J. Van Dam and
Shunzhou Wan and
David Wifling},
title = {{IMPECCABLE:} Integrated Modeling PipelinE for {COVID} Cure by Assessing
Better LEads},
journal = {CoRR},
volume = {abs/2010.06574},
year = {2020},
url = {https://arxiv.org/abs/2010.06574},
eprinttype = {arXiv},
eprint = {2010.06574},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-06574.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-10672,
author = {Johannes Schneider and
Rene Abraham and
Christian Meske},
title = {{AI} Governance for Businesses},
journal = {CoRR},
volume = {abs/2011.10672},
year = {2020},
url = {https://arxiv.org/abs/2011.10672},
eprinttype = {arXiv},
eprint = {2011.10672},
timestamp = {Wed, 15 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-10672.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aes/Lopez-CamposSCF19,
author = {Jos{\'{e}} A. L{\'{o}}pez{-}Campos and
Abraham Segade and
Enrique Casarejos and
Jos{\'{e}} R. Fern{\'{a}}ndez and
Gustavo R. D{\'{\i}}as},
title = {Hyperelastic characterization oriented to finite element applications
using genetic algorithms},
journal = {Adv. Eng. Softw.},
volume = {133},
pages = {52--59},
year = {2019},
url = {https://doi.org/10.1016/j.advengsoft.2019.04.001},
doi = {10.1016/J.ADVENGSOFT.2019.04.001},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aes/Lopez-CamposSCF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/HerranCD19,
author = {Alberto Herran and
J. Manuel Colmenar and
Abraham Duarte},
title = {A Variable Neighborhood Search approach for the Hamiltonian p-median
problem},
journal = {Appl. Soft Comput.},
volume = {80},
pages = {603--616},
year = {2019},
url = {https://doi.org/10.1016/j.asoc.2019.04.033},
doi = {10.1016/J.ASOC.2019.04.033},
timestamp = {Thu, 08 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asc/HerranCD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/BPMA19,
author = {Fathima Rizwana B. and
Johanan Christian Prasana and
S. Muthu and
Christina Susan Abraham},
title = {Molecular docking studies, charge transfer excitation and wave function
analyses (ESP, ELF, {LOL)} on valacyclovir : {A} potential antiviral
drug},
journal = {Comput. Biol. Chem.},
volume = {78},
pages = {9--17},
year = {2019},
url = {https://doi.org/10.1016/j.compbiolchem.2018.11.014},
doi = {10.1016/J.COMPBIOLCHEM.2018.11.014},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/candc/BPMA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cea/JothiarunaSK19,
author = {N. Jothiaruna and
K. Joseph Abraham Sundar and
Karthikeyan Balasubramanian},
title = {A segmentation method for disease spot images incorporating chrominance
in Comprehensive Color Feature and Region Growing},
journal = {Comput. Electron. Agric.},
volume = {165},
year = {2019},
url = {https://doi.org/10.1016/j.compag.2019.104934},
doi = {10.1016/J.COMPAG.2019.104934},
timestamp = {Thu, 19 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cea/JothiarunaSK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmm/Lopez-CamposSCF19,
author = {Jos{\'{e}} A. L{\'{o}}pez{-}Campos and
Abraham Segade and
Enrique Casarejos and
Jos{\'{e}} R. Fern{\'{a}}ndez},
title = {Behavior characterization of viscoelastic materials for the finite
element method calculation applying Prony series},
journal = {Comput. Math. Methods},
volume = {1},
number = {1},
year = {2019},
url = {https://doi.org/10.1002/cmm4.1014},
doi = {10.1002/CMM4.1014},
timestamp = {Tue, 13 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmm/Lopez-CamposSCF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Escamilla-Ambrosio19,
author = {Ponciano Jorge Escamilla{-}Ambrosio and
David Alejandro Robles{-}Ram{\'{\i}}rez and
Shada Alsalamah and
Theo Tryfonas and
Sandra Orantes{-}Jim{\'{e}}nez and
Abraham Rodriguez{-}Mota and
Sakher Alqahtani and
Thamer Nouh and
Hessah A. Alsalamah and
Shahad Almutawaa and
Hend Alkabani and
Mshael Alsmari and
Nouf Alashgar and
Abeer Alrajeh and
Heba A. Kurdi},
title = {Securing mHealth Applications Using IoTsecM Security Modelling: Dentify.Me
mApp Case Study for Urgent Care Management},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {23},
number = {4},
year = {2019},
url = {https://doi.org/10.13053/cys-23-4-3093},
doi = {10.13053/CYS-23-4-3093},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/Escamilla-Ambrosio19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/GuardadoFLAS19,
author = {Abraham V{\'{a}}zquez Guardado and
J. Alfredo Ramirez Flores and
Gisela Lopez{-}Galmiche and
J. Jes{\'{u}}s Escobedo Alatorre and
Jos{\'{e}} Javier S{\'{a}}nchez{-}Mondrag{\'{o}}n},
title = {Detection of Ethanol Concentration using a Generic Optical Sensor
Platform},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {23},
number = {1},
pages = {27},
year = {2019},
url = {https://doi.org/10.13053/cys-23-1-3138},
doi = {10.13053/CYS-23-1-3138},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/GuardadoFLAS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/Flores-VergaraI19,
author = {Abraham Flores{-}Vergara and
Everardo Inzunza{-}Gonz{\'{a}}lez and
Enrique Efr{\'{e}}n Garc{\'{\i}}a{-}Guerrero and
Oscar Roberto L{\'{o}}pez{-}Bonilla and
Eduardo Rodr{\'{\i}}guez{-}Orozco and
Juan Miguel Hern{\'{a}}ndez{-}Ontiveros and
Jos{\'{e}} Ricardo C{\'{a}}rdenas{-}Valdez and
Esteban Tlelo{-}Cuautle},
title = {Implementing a Chaotic Cryptosystem by Performing Parallel Computing
on Embedded Systems with Multiprocessors},
journal = {Entropy},
volume = {21},
number = {3},
pages = {268},
year = {2019},
url = {https://doi.org/10.3390/e21030268},
doi = {10.3390/E21030268},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/Flores-VergaraI19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/AydinTDERA19,
author = {Boran Ekin Aydin and
Xin Tian and
Joost R. Delsman and
Gualbert H. P. Oude Essink and
Martine Rutten and
Edo Abraham},
title = {Optimal salinity and water level control of water courses using Model
Predictive Control},
journal = {Environ. Model. Softw.},
volume = {112},
pages = {36--45},
year = {2019},
url = {https://doi.org/10.1016/j.envsoft.2018.11.010},
doi = {10.1016/J.ENVSOFT.2018.11.010},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/AydinTDERA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/SakaiPJTAC19,
author = {Yasufumi Sakai and
Bruno U. Pedroni and
Siddharth Joshi and
Satoshi Tanabe and
Abraham Akinin and
Gert Cauwenberghs},
title = {Dropout and DropConnect for Reliable Neuromorphic Inference Under
Communication Constraints in Network Connectivity},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {9},
number = {4},
pages = {658--667},
year = {2019},
url = {https://doi.org/10.1109/JETCAS.2019.2952642},
doi = {10.1109/JETCAS.2019.2952642},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esticas/SakaiPJTAC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/giq/ThomasCLC19,
author = {Manoj A. Thomas and
Joseph Cipolla and
Bob Lambert and
Lemuria D. Carter},
title = {Data management maturity assessment of public sector agencies},
journal = {Gov. Inf. Q.},
volume = {36},
number = {4},
year = {2019},
url = {https://doi.org/10.1016/j.giq.2019.101401},
doi = {10.1016/J.GIQ.2019.101401},
timestamp = {Wed, 28 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/giq/ThomasCLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijaip/SundarV19,
author = {K. Joseph Abraham Sundar and
V. Vaithiyanathan},
title = {A novel method for super resolution image reconstruction},
journal = {Int. J. Adv. Intell. Paradigms},
volume = {14},
number = {1/2},
pages = {46--54},
year = {2019},
url = {https://doi.org/10.1504/IJAIP.2019.102962},
doi = {10.1504/IJAIP.2019.102962},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijaip/SundarV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijinfoman/AbrahamSB19,
author = {Rene Abraham and
Johannes Schneider and
Jan vom Brocke},
title = {Data governance: {A} conceptual framework, structured review, and
research agenda},
journal = {Int. J. Inf. Manag.},
volume = {49},
pages = {424--438},
year = {2019},
url = {https://doi.org/10.1016/j.ijinfomgt.2019.07.008},
doi = {10.1016/J.IJINFOMGT.2019.07.008},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijinfoman/AbrahamSB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/AbrahamJIKK19,
author = {Joanna Abraham and
Joanna Jaros and
Imade Ihianle and
Karl Kochendorfer and
Thomas George Kannampallil},
title = {Impact of EHR-based rounding tools on interactive communication: {A}
prospective observational study},
journal = {Int. J. Medical Informatics},
volume = {129},
pages = {423--429},
year = {2019},
url = {https://doi.org/10.1016/j.ijmedinf.2019.07.012},
doi = {10.1016/J.IJMEDINF.2019.07.012},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmi/AbrahamJIKK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/HerranCD19,
author = {Alberto Herran and
J. Manuel Colmenar and
Abraham Duarte},
title = {A variable neighborhood search approach for the vertex bisection problem},
journal = {Inf. Sci.},
volume = {476},
pages = {1--18},
year = {2019},
url = {https://doi.org/10.1016/j.ins.2018.09.063},
doi = {10.1016/J.INS.2018.09.063},
timestamp = {Sat, 01 Dec 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/HerranCD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/KannampallilAJA19,
author = {Thomas George Kannampallil and
Saria S. Awadalla and
Steve Jones and
Joanna Abraham},
title = {A graph-based approach for characterizing resident and nurse handoff
conversations},
journal = {J. Biomed. Informatics},
volume = {94},
year = {2019},
url = {https://doi.org/10.1016/j.jbi.2019.103178},
doi = {10.1016/J.JBI.2019.103178},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/KannampallilAJA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/AbrahamABBBBCCC19,
author = {Mark James Abraham and
Rossen Apostolov and
Jonathan Barnoud and
Paul Bauer and
Christian Blau and
Alexandre M. J. J. Bonvin and
Matthieu Chavent and
John D. Chodera and
Karmen Condic{-}Jurkic and
Lucie Delemotte and
Helmut Grubm{\"{u}}ller and
Rebecca J. Howard and
E. Joseph Jordan and
Erik Lindahl and
Samuli Ollila and
Jana Selent and
Daniel G. A. Smith and
Phillip J. Stansfeld and
Johanna K. S. Tiemann and
Mika{\"{e}}l Trellet and
Christopher J. Woods and
Artem A. Zhmurov},
title = {Sharing Data from Molecular Simulations},
journal = {J. Chem. Inf. Model.},
volume = {59},
number = {10},
pages = {4093--4099},
year = {2019},
url = {https://doi.org/10.1021/acs.jcim.9b00665},
doi = {10.1021/ACS.JCIM.9B00665},
timestamp = {Wed, 24 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/AbrahamABBBBCCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/YuAWSWP19,
author = {Shujian Yu and
Zubin Abraham and
Heng Wang and
Mohak Shah and
Yantao Wei and
Jos{\'{e}} C. Pr{\'{\i}}ncipe},
title = {Concept drift detection and adaptation with hierarchical hypothesis
testing},
journal = {J. Frankl. Inst.},
volume = {356},
number = {5},
pages = {3187--3215},
year = {2019},
url = {https://doi.org/10.1016/j.jfranklin.2019.01.043},
doi = {10.1016/J.JFRANKLIN.2019.01.043},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfi/YuAWSWP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jksucis/JobinV19,
author = {Abraham Jobin and
Paul Varghese},
title = {An imperceptible spatial domain color image watermarking scheme},
journal = {J. King Saud Univ. Comput. Inf. Sci.},
volume = {31},
number = {1},
pages = {125--133},
year = {2019},
url = {https://doi.org/10.1016/j.jksuci.2016.12.004},
doi = {10.1016/J.JKSUCI.2016.12.004},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jksucis/JobinV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/SpellerMKFGSWJW19,
author = {Brittany Speller and
Kelly Metcalfe and
Erin D. Kennedy and
Marcia Facey and
Ellen Greenblatt and
Adena S. Scheer and
Ellen Warner and
Anil Abraham Joy and
Frances C. Wright and
Nancy N. Baxter},
title = {The "Begin Exploring Fertility Options, Risks and Expectations" {(BEFORE)}
decision aid: development and alpha testing of a fertility tool for
premenopausal breast cancer patients},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {19},
number = {1},
pages = {203:1--203:16},
year = {2019},
url = {https://doi.org/10.1186/s12911-019-0912-y},
doi = {10.1186/S12911-019-0912-Y},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/SpellerMKFGSWJW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/TLDPVG19,
author = {Valerio Galiote T. and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Jos{\'{e}} F. Texcucano D. and
Alfredo Toriz P. and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Elberfeld E. P{\'{e}}rez G.},
title = {Planificaci{\'{o}}n de movimientos basada en sensores para robots
m{\'{o}}viles en ambientes desconocidos},
journal = {Res. Comput. Sci.},
volume = {148},
number = {8},
pages = {147--158},
year = {2019},
url = {https://rcs.cic.ipn.mx/2019\_148\_8/Planificacion\%20de\%20movimientos\%20basada\%20en\%20sensores\%20para\%20robots\%20moviles\%20en\%20ambientes\%20desconocidos.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/TLDPVG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/SorskarSA19,
author = {Leif Inge K. S{\o}rsk{\aa}r and
Jon T. Selvik and
Eirik Bjorheim Abrahamsen},
title = {On the use of the vision zero principle and the {ALARP} principle
for production loss in the oil and gas industry},
journal = {Reliab. Eng. Syst. Saf.},
volume = {191},
year = {2019},
url = {https://doi.org/10.1016/j.ress.2019.106541},
doi = {10.1016/J.RESS.2019.106541},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/SorskarSA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/see/KretserMBAABDGH19,
author = {Alison Kretser and
Delia Murphy and
Stefano Bertuzzi and
Todd Abraham and
David B. Allison and
Kathryn J. Boor and
Johanna Dwyer and
Andrea Grantham and
Linda J. Harris and
Rachelle Hollander and
Chavonda Jacobs{-}Young and
Sarah M. Rovito and
Dorothea Vafiadis and
Catherine Woteki and
Jessica M. Wyndham and
Rickey Y. Yada},
title = {Scientific Integrity Principles and Best Practices: Recommendations
from a Scientific Integrity Consortium},
journal = {Sci. Eng. Ethics},
volume = {25},
number = {2},
pages = {327--355},
year = {2019},
url = {https://doi.org/10.1007/s11948-019-00094-3},
doi = {10.1007/S11948-019-00094-3},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/see/KretserMBAABDGH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/WuZSSCL19,
author = {Hao Wu and
Xiang Zhang and
Wenzhong Shi and
Shaoxian Song and
Abraham Cardenas{-}Tristan and
Kui Li},
title = {An Accurate and Robust Region-Growing Algorithm for Plane Segmentation
of {TLS} Point Clouds Using a Multiscale Tensor Voting Method},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {12},
number = {10},
pages = {4160--4168},
year = {2019},
url = {https://doi.org/10.1109/JSTARS.2019.2936662},
doi = {10.1109/JSTARS.2019.2936662},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/WuZSSCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/BazarraLLSF19,
author = {Noelia Bazarra and
Jos{\'{e}} A. L{\'{o}}pez{-}Campos and
Marcos L{\'{o}}pez and
Abraham Segade and
Jos{\'{e}} R. Fern{\'{a}}ndez},
title = {Analysis of a Poro-Thermo-Viscoelastic Model of Type {III}},
journal = {Symmetry},
volume = {11},
number = {10},
pages = {1214},
year = {2019},
url = {https://doi.org/10.3390/sym11101214},
doi = {10.3390/SYM11101214},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/BazarraLLSF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/teco/AbrahamDH19,
author = {Ittai Abraham and
Danny Dolev and
Joseph Y. Halpern},
title = {Distributed Protocols for Leader Election: {A} Game-Theoretic Perspective},
journal = {{ACM} Trans. Economics and Comput.},
volume = {7},
number = {1},
pages = {4:1--4:26},
year = {2019},
url = {https://doi.org/10.1145/3303712},
doi = {10.1145/3303712},
timestamp = {Fri, 10 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/teco/AbrahamDH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MonopoliMLKBL19,
author = {Vito Giuseppe Monopoli and
Abraham Marquez and
Jos{\'{e}} I. Leon and
Youngjong Ko and
Giampaolo Buticchi and
Marco Liserre},
title = {Improved Harmonic Performance of Cascaded H-Bridge Converters With
Thermal Control},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {66},
number = {7},
pages = {4982--4991},
year = {2019},
url = {https://doi.org/10.1109/TIE.2018.2868304},
doi = {10.1109/TIE.2018.2868304},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/MonopoliMLKBL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/Perez-LoyaAL19,
author = {J. Jose Perez{-}Loya and
Johan Abrahamsson and
Urban Lundin},
title = {Electromagnetic Losses in Synchronous Machines During Active Compensation
of Unbalanced Magnetic Pull},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {66},
number = {1},
pages = {124--131},
year = {2019},
url = {https://doi.org/10.1109/TIE.2018.2827991},
doi = {10.1109/TIE.2018.2827991},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/Perez-LoyaAL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnsm/ZeljkovicSLM19,
author = {Ensar Zeljkovic and
Nina Slamnik{-}Krijestorac and
Steven Latr{\'{e}} and
Johann M. M{\'{a}}rquez{-}Barja},
title = {{ABRAHAM:} Machine Learning Backed Proactive Handover Algorithm Using
{SDN}},
journal = {{IEEE} Trans. Netw. Serv. Manag.},
volume = {16},
number = {4},
pages = {1522--1536},
year = {2019},
url = {https://doi.org/10.1109/TNSM.2019.2948883},
doi = {10.1109/TNSM.2019.2948883},
timestamp = {Thu, 27 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnsm/ZeljkovicSLM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aicas/SakaiPJAC19,
author = {Yasufumi Sakai and
Bruno U. Pedroni and
Siddharth Joshi and
Abraham Akinin and
Gert Cauwenberghs},
title = {DropOut and DropConnect for Reliable Neuromorphic Inference under
Energy and Bandwidth Constraints in Network Connectivity},
booktitle = {{IEEE} International Conference on Artificial Intelligence Circuits
and Systems, {AICAS} 2019, Hsinchu, Taiwan, March 18-20, 2019},
pages = {76--80},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/AICAS.2019.8771533},
doi = {10.1109/AICAS.2019.8771533},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aicas/SakaiPJAC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aips/AbrahamsCDKLLBJ19,
author = {Jordan R. Abrahams and
David A. Chu and
Grace Diehl and
Marina Knittel and
Judy Lin and
William Lloyd and
James C. Boerkoel Jr. and
Frank Jeremy},
editor = {J. Benton and
Nir Lipovetzky and
Eva Onaindia and
David E. Smith and
Siddharth Srivastava},
title = {{DREAM:} An Algorithm for Mitigating the Overhead of Robust Rescheduling},
booktitle = {Proceedings of the Twenty-Ninth International Conference on Automated
Planning and Scheduling, {ICAPS} 2019, Berkeley, CA, USA, July 11-15,
2019},
pages = {3--12},
publisher = {{AAAI} Press},
year = {2019},
url = {https://ojs.aaai.org/index.php/ICAPS/article/view/3454},
timestamp = {Tue, 20 Aug 2024 07:54:44 +0200},
biburl = {https://dblp.org/rec/conf/aips/AbrahamsCDKLLBJ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bracis/SilvaAR19,
author = {Carla Fernandes da Silva and
Kuruvilla Joseph Abraham and
Evandro Eduardo Seron Ruiz},
title = {Comorbidity Prediction and Validation using a Disease Gene Graph and
Public Health Data},
booktitle = {8th Brazilian Conference on Intelligent Systems, {BRACIS} 2019, Salvador,
Brazil, October 15-18, 2019},
pages = {860--865},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BRACIS.2019.00153},
doi = {10.1109/BRACIS.2019.00153},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bracis/SilvaAR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/GleasonVO19,
author = {Joseph D. Gleason and
Abraham P. Vinod and
Meeko M. K. Oishi},
title = {The Maximal Hitting-Time Stochastic Reachability Problem},
booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
France, December 11-13, 2019},
pages = {7266--7272},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CDC40024.2019.9030186},
doi = {10.1109/CDC40024.2019.9030186},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/GleasonVO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/KhaledyanVOR19,
author = {Milad Khaledyan and
Abraham P. Vinod and
Meeko Oishi and
John A. Richards},
title = {Optimal Coverage Control and Stochastic Multi-Target Tracking},
booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
France, December 11-13, 2019},
pages = {2467--2472},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CDC40024.2019.9029307},
doi = {10.1109/CDC40024.2019.9029307},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/KhaledyanVOR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/JosephECA19,
author = {Ebenezer Joseph and
Veena Easvaradoss and
David Chandran and
Suneera Abraham},
editor = {Ashok K. Goel and
Colleen M. Seifert and
Christian Freksa},
title = {Impact of Chess Training on Creativity and Intelligence},
booktitle = {Proceedings of the 41th Annual Meeting of the Cognitive Science Society,
CogSci 2019: Creativity + Cognition + Computation, Montreal, Canada,
July 24-27, 2019},
pages = {1977},
publisher = {cognitivesciencesociety.org},
year = {2019},
url = {https://mindmodeling.org/cogsci2019/papers/0347/index.html},
timestamp = {Wed, 17 Apr 2024 12:43:09 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/JosephECA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fair2/Louw19,
author = {Johannes A. Louw},
editor = {Marelie H. Davel and
Etienne Barnard},
title = {Neural speech synthesis for resource-scarce languages},
booktitle = {Proceedings of the South African Forum for Artificial Intelligence
Research, Cape Town, South Africa, 4-6 December, 2019},
series = {{CEUR} Workshop Proceedings},
volume = {2540},
pages = {103--116},
publisher = {CEUR-WS.org},
year = {2019},
url = {https://ceur-ws.org/Vol-2540/FAIR2019\_paper\_66.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:19 +0100},
biburl = {https://dblp.org/rec/conf/fair2/Louw19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fmics/BergerNKAWR19,
author = {Philipp Berger and
Johanna Nellen and
Joost{-}Pieter Katoen and
Erika {\'{A}}brah{\'{a}}m and
Md Tawhid Bin Waez and
Thomas Rambow},
editor = {Kim Guldstrand Larsen and
Tim A. C. Willemse},
title = {Multiple Analyses, Requirements Once: - Simplifying Testing and Verification
in Automotive Model-Based Development},
booktitle = {Formal Methods for Industrial Critical Systems - 24th International
Conference, {FMICS} 2019, Amsterdam, The Netherlands, August 30-31,
2019, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11687},
pages = {59--75},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-27008-7\_4},
doi = {10.1007/978-3-030-27008-7\_4},
timestamp = {Tue, 07 May 2024 20:01:38 +0200},
biburl = {https://dblp.org/rec/conf/fmics/BergerNKAWR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hybrid/VinodGO19,
author = {Abraham P. Vinod and
Joseph D. Gleason and
Meeko M. K. Oishi},
editor = {Necmiye Ozay and
Pavithra Prabhakar},
title = {SReachTools: a {MATLAB} stochastic reachability toolbox},
booktitle = {Proceedings of the 22nd {ACM} International Conference on Hybrid Systems:
Computation and Control, {HSCC} 2019, Montreal, QC, Canada, April
16-18, 2019},
pages = {33--38},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3302504.3311809},
doi = {10.1145/3302504.3311809},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hybrid/VinodGO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hybrid/VinodGO19a,
author = {Abraham P. Vinod and
Joseph D. Gleason and
Meeko M. K. Oishi},
editor = {Necmiye Ozay and
Pavithra Prabhakar},
title = {SReachTools: {A} {MATLAB} stochastic reachability toolbox: demo abstract},
booktitle = {Proceedings of the 22nd {ACM} International Conference on Hybrid Systems:
Computation and Control, {HSCC} 2019, Montreal, QC, Canada, April
16-18, 2019},
pages = {264--265},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3302504.3313352},
doi = {10.1145/3302504.3313352},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hybrid/VinodGO19a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/GarciaSOL19,
author = {Vicente Garc{\'{\i}}a and
Jos{\'{e}} Salvador S{\'{a}}nchez and
Alberto Ochoa Ort{\'{\i}}z and
Abraham L{\'{o}}pez{-}Najera},
editor = {Aythami Morales and
Julian Fi{\'{e}}rrez and
Jos{\'{e}} Salvador S{\'{a}}nchez and
Bernardete Ribeiro},
title = {Instance Selection for the Nearest Neighbor Classifier: Connecting
the Performance to the Underlying Data Structure},
booktitle = {Pattern Recognition and Image Analysis - 9th Iberian Conference, IbPRIA
2019, Madrid, Spain, July 1-4, 2019, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {11867},
pages = {249--256},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-31332-6\_22},
doi = {10.1007/978-3-030-31332-6\_22},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ibpria/GarciaSOL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/PleshBJYBSJRS19,
author = {Richard Plesh and
Keivan Bahmani and
Ganghee Jang and
David Yambay and
Ken Brownlee and
Timothy Swyka and
Peter Johnson and
Arun Ross and
Stephanie Schuckers},
title = {Fingerprint Presentation Attack Detection utilizing Time-Series, Color
Fingerprint Captures},
booktitle = {2019 International Conference on Biometrics, {ICB} 2019, Crete, Greece,
June 4-7, 2019},
pages = {1--8},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICB45273.2019.8987297},
doi = {10.1109/ICB45273.2019.8987297},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/PleshBJYBSJRS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icost/ForchukSRCMF19,
author = {Cheryl Forchuk and
Jonathan Serrato and
Abraham Rudnick and
Deborah Corring and
Rupinder Mann and
Barbara Frampton},
editor = {Jos{\'{e}} Pag{\'{a}}n and
Mounir Mokhtari and
Hamdi Aloulou and
Bessam Abdulrazak and
Mar{\'{\i}}a Fernanda Cabrera},
title = {An Interconnected Smart Technology System for Individuals with Mental
Illness Living in the Community and Transitional Hospital Apartments},
booktitle = {How {AI} Impacts Urban Living and Public Health - 17th International
Conference, {ICOST} 2019, New York City, NY, USA, October 14-16, 2019,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11862},
pages = {131--142},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-32785-9\_12},
doi = {10.1007/978-3-030-32785-9\_12},
timestamp = {Fri, 31 Jan 2020 21:32:25 +0100},
biburl = {https://dblp.org/rec/conf/icost/ForchukSRCMF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icphm/GecgelEDSAN19,
author = {Ozhan Gecgel and
Stephen Ekwaro{-}Osire and
Jo{\~{a}}o Paulo Dias and
Abdul Serwadda and
Fisseha M. Alemayehu and
Abraham Nispel},
title = {Gearbox Fault Diagnostics Using Deep Learning with Simulated Data},
booktitle = {2019 {IEEE} International Conference on Prognostics and Health Management,
{ICPHM} 2019, San Francisco, CA, USA, June 17-20, 2019},
pages = {1--8},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICPHM.2019.8819423},
doi = {10.1109/ICPHM.2019.8819423},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icphm/GecgelEDSAN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/Melegati0A19,
author = {Jorge Melegati and
Xiaofeng Wang and
Pekka Abrahamsson},
title = {Hypotheses engineering: first essential steps of experiment-driven
software development},
booktitle = {Proceedings of the Joint 4th International Workshop on Rapid Continuous
Software Engineering and 1st International Workshop on Data-Driven
Decisions, Experimentation and Evolution, RCoSE-DDrEE@ICSE 2019, Montreal,
QC, Canada, May 27, 2019},
pages = {16--19},
publisher = {{IEEE} / {ACM}},
year = {2019},
url = {https://doi.org/10.1109/RCoSE/DDrEE.2019.00011},
doi = {10.1109/RCOSE/DDREE.2019.00011},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/Melegati0A19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/YarBGMLL19,
author = {Hao Yan and
Giampaolo Buticchi and
Chris Gerada and
Abraham Marquez and
Jos{\'{e}} I. Leon and
Marco Liserre},
title = {Current Harmonic Reduction of DC-Link Capacitor in Dual Motor Drive
System},
booktitle = {{IECON} 2019 - 45th Annual Conference of the {IEEE} Industrial Electronics
Society, Lisbon, Portugal, October 14-17, 2019},
pages = {3148--3153},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IECON.2019.8927343},
doi = {10.1109/IECON.2019.8927343},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/YarBGMLL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/AbrahamRSC19,
author = {Emerson Rodolfo Abraham and
Jo{\~{a}}o Gilberto Mendes dos Reis and
Aguinaldo Eduardo de Souza and
Adriane Paulieli Colossetti},
editor = {Farhad Ameri and
Kathryn E. Stecke and
Gregor von Cieminski and
Dimitris Kiritsis},
title = {Neuro-Fuzzy System for the Evaluation of Soya Production and Demand
in Brazilian Ports},
booktitle = {Advances in Production Management Systems. Production Management for
the Factory of the Future - {IFIP} {WG} 5.7 International Conference,
{APMS} 2019, Austin, TX, USA, September 1-5, 2019, Proceedings, Part
{I}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {566},
pages = {87--94},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-30000-5\_11},
doi = {10.1007/978-3-030-30000-5\_11},
timestamp = {Thu, 05 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip5-7/AbrahamRSC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/SantosRRAJS19,
author = {Renato M{\'{a}}rcio dos Santos and
Jo{\~{a}}o Gilberto Mendes dos Reis and
J{\'{u}}lio Cesar Raymundo and
Emerson Rodolfo Abraham and
Ataide Pereira Cardoso Junior and
Aguinaldo Eduardo de Souza},
editor = {Farhad Ameri and
Kathryn E. Stecke and
Gregor von Cieminski and
Dimitris Kiritsis},
title = {Port Performance Measures in Brazil: An Analysis in Port of Santos},
booktitle = {Advances in Production Management Systems. Production Management for
the Factory of the Future - {IFIP} {WG} 5.7 International Conference,
{APMS} 2019, Austin, TX, USA, September 1-5, 2019, Proceedings, Part
{I}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {566},
pages = {180--186},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-30000-5\_24},
doi = {10.1007/978-3-030-30000-5\_24},
timestamp = {Thu, 05 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip5-7/SantosRRAJS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/SouzaRJAVSP19,
author = {Aguinaldo Eduardo de Souza and
Jo{\~{a}}o Gilberto Mendes dos Reis and
Ataide Pereira Cardoso Junior and
Emerson Rodolfo Abraham and
Oduvaldo Vendrametto and
Renato M{\'{a}}rcio dos Santos and
Roberta Sobral Pinto},
editor = {Farhad Ameri and
Kathryn E. Stecke and
Gregor von Cieminski and
Dimitris Kiritsis},
title = {Port Terminals Assessment: An Empirical Analysis of Requirements of
Brazilian National Plan of Port Logistics},
booktitle = {Advances in Production Management Systems. Production Management for
the Factory of the Future - {IFIP} {WG} 5.7 International Conference,
{APMS} 2019, Austin, TX, USA, September 1-5, 2019, Proceedings, Part
{I}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {566},
pages = {135--141},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-30000-5\_18},
doi = {10.1007/978-3-030-30000-5\_18},
timestamp = {Thu, 05 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip5-7/SouzaRJAVSP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/podc/AbrahamDGH19,
author = {Ittai Abraham and
Danny Dolev and
Ivan Geffner and
Joseph Y. Halpern},
editor = {Peter Robinson and
Faith Ellen},
title = {Implementing Mediators with Asynchronous Cheap Talk},
booktitle = {Proceedings of the 2019 {ACM} Symposium on Principles of Distributed
Computing, {PODC} 2019, Toronto, ON, Canada, July 29 - August 2, 2019},
pages = {501--510},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3293611.3331623},
doi = {10.1145/3293611.3331623},
timestamp = {Fri, 19 Jul 2019 08:02:49 +0200},
biburl = {https://dblp.org/rec/conf/podc/AbrahamDGH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigsoft/KemellFHHJPVKRI19,
author = {Kai{-}Kristian Kemell and
Polina Feshchenko and
Joonas Himmanen and
Abrar Hossain and
Furqan Jameel and
Raffaele Luigi Puca and
Teemu Vitikainen and
Joni Kultanen and
Juhani Risku and
Johannes Impi{\"{o}} and
Anssi Sorvisto and
Pekka Abrahamsson},
editor = {Kari Smolander and
Paul Gr{\"{u}}nbacher and
Sami Hyrynsalmi and
Slinger Jansen},
title = {Software startup education: gamifying growth hacking},
booktitle = {Proceedings of the 2nd {ACM} {SIGSOFT} International Workshop on Software-Intensive
Business: Start-ups, Platforms, and Ecosystems, IWSiB@ESEC/SIGSOFT
{FSE} 2019, Tallinn, Estonia, August 26, 2019},
pages = {25--30},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3340481.3342734},
doi = {10.1145/3340481.3342734},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigsoft/KemellFHHJPVKRI19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tencon/NandakumarSAD19,
author = {Ammu Prameela Nandakumar and
Lalu Seban and
Rajesh Joseph Abraham and
M. V. Dhekane},
title = {{LQG} Controller for Load Relief Control of a Flexible Launch Vehicle},
booktitle = {{TENCON} 2019 - 2019 {IEEE} Region 10 Conference (TENCON), Kochi,
India, October 17-20, 2019},
pages = {626--631},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/TENCON.2019.8929336},
doi = {10.1109/TENCON.2019.8929336},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tencon/NandakumarSAD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tencon/PaulJKAM19,
author = {Preenu Paul and
Babita R. Jose and
Shahana Thottathikkulam Kassim and
Chikku Abraham and
Jimson Mathew},
title = {Isolated Switched Boost {DC-DC} Converter with Coupled Inductor and
Transformer},
booktitle = {{TENCON} 2019 - 2019 {IEEE} Region 10 Conference (TENCON), Kochi,
India, October 17-20, 2019},
pages = {1142--1147},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/TENCON.2019.8929652},
doi = {10.1109/TENCON.2019.8929652},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tencon/PaulJKAM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/KwanF19,
author = {Jonathan C. Kwan and
Abraham O. Fapojuwo},
title = {Optimized Wireless Energy Harvesting Sensor Network with Backscatter
Communication and Beamforming},
booktitle = {90th {IEEE} Vehicular Technology Conference, {VTC} Fall 2019, Honolulu,
HI, USA, September 22-25, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/VTCFall.2019.8891074},
doi = {10.1109/VTCFALL.2019.8891074},
timestamp = {Mon, 20 Dec 2021 11:29:04 +0100},
biburl = {https://dblp.org/rec/conf/vtc/KwanF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/KwanF19a,
author = {Jonathan C. Kwan and
Abraham O. Fapojuwo},
title = {Sum-Throughput and Fairness Optimization of a Wireless Energy Harvesting
Sensor Network},
booktitle = {90th {IEEE} Vehicular Technology Conference, {VTC} Fall 2019, Honolulu,
HI, USA, September 22-25, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/VTCFall.2019.8891499},
doi = {10.1109/VTCFALL.2019.8891499},
timestamp = {Mon, 20 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vtc/KwanF19a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-07993,
author = {Sebastian Junges and
Erika {\'{A}}brah{\'{a}}m and
Christian Hensel and
Nils Jansen and
Joost{-}Pieter Katoen and
Tim Quatmann and
Matthias Volk},
title = {Parameter Synthesis for Markov Models},
journal = {CoRR},
volume = {abs/1903.07993},
year = {2019},
url = {http://arxiv.org/abs/1903.07993},
eprinttype = {arXiv},
eprint = {1903.07993},
timestamp = {Tue, 02 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1903-07993.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-07083,
author = {Philipp Berger and
Johanna Nellen and
Joost{-}Pieter Katoen and
Erika {\'{A}}brah{\'{a}}m and
Md Tawhid Bin Waez and
Thomas Rambow},
title = {Multiple Analyses, Requirements Once: simplifying testing {\&}
verification in automotive model-based development},
journal = {CoRR},
volume = {abs/1906.07083},
year = {2019},
url = {http://arxiv.org/abs/1906.07083},
eprinttype = {arXiv},
eprint = {1906.07083},
timestamp = {Fri, 27 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-07083.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-07946,
author = {Ville Vakkuri and
Kai{-}Kristian Kemell and
Joni Kultanen and
Mikko T. Siponen and
Pekka Abrahamsson},
title = {Ethically Aligned Design of Autonomous Systems: Industry viewpoint
and an empirical study},
journal = {CoRR},
volume = {abs/1906.07946},
year = {2019},
url = {http://arxiv.org/abs/1906.07946},
eprinttype = {arXiv},
eprint = {1906.07946},
timestamp = {Mon, 24 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-07946.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-08717,
author = {Mateus Tarcinalli Machado and
Evandro Ruiz and
Kuruvilla Joseph Abraham},
title = {A New Statistical Approach for Comparing Algorithms for Lexicon Based
Sentiment Analysis},
journal = {CoRR},
volume = {abs/1906.08717},
year = {2019},
url = {http://arxiv.org/abs/1906.08717},
eprinttype = {arXiv},
eprint = {1906.08717},
timestamp = {Wed, 06 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-08717.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-01917,
author = {John Licato and
Zaid Marji and
Sophia Abraham},
title = {Scenarios and Recommendations for Ethical Interpretive {AI}},
journal = {CoRR},
volume = {abs/1911.01917},
year = {2019},
url = {http://arxiv.org/abs/1911.01917},
eprinttype = {arXiv},
eprint = {1911.01917},
timestamp = {Mon, 11 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-01917.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-10040,
author = {Abraham Westerbaan and
Bas Westerbaan and
John van de Wetering},
title = {A characterization of ordered abstract probabilities},
journal = {CoRR},
volume = {abs/1912.10040},
year = {2019},
url = {http://arxiv.org/abs/1912.10040},
eprinttype = {arXiv},
eprint = {1912.10040},
timestamp = {Tue, 07 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-10040.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/f1000research/KingAKFACHPTMBMGKWAG19,
author = {Christopher Ryan King and
Joanna Abraham and
Thomas George Kannampallil and
Bradley A. Fritz and
Arbi Ben Abdallah and
Yixin Chen and
Bernadette Henrichs and
Mary C. Politi and
Brian A. Torres and
Angela Mickle and
Thaddeus P. Budelier and
Sherry McKinnon and
Stephen Gregory and
Sachin Kheterpal and
Troy Wildes and
Michael S. Avidan and
TECTONICS Research Group},
title = {Protocol for the Effectiveness of an Anesthesiology Control Tower
System in Improving Perioperative Quality Metrics and Clinical Outcomes:
the {TECTONICS} randomized, pragmatic trial},
journal = {F1000Research},
volume = {8},
pages = {2032},
year = {2019},
url = {https://doi.org/10.12688/f1000research.21016.1},
doi = {10.12688/F1000RESEARCH.21016.1},
timestamp = {Thu, 01 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/f1000research/KingAKFACHPTMBMGKWAG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/FernandezLSV18,
author = {Jos{\'{e}} R. Fern{\'{a}}ndez and
Jos{\'{e}} A. L{\'{o}}pez{-}Campos and
Abraham Segade and
J. A. Vil{\'{a}}n},
title = {A genetic algorithm for the characterization of hyperelastic materials},
journal = {Appl. Math. Comput.},
volume = {329},
pages = {239--250},
year = {2018},
url = {https://doi.org/10.1016/j.amc.2018.02.008},
doi = {10.1016/J.AMC.2018.02.008},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/amc/FernandezLSV18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/ZhaoWARNSFPRC18,
author = {Sophie Zhao and
Ian Walsh and
Jodie L. Abrahams and
Louise Royle and
Terry Nguyen{-}Khuong and
Daniel Spencer and
Daryl L. Fernandes and
Nicolle H. Packer and
Pauline M. Rudd and
Matthew P. Campbell},
title = {GlycoStore: a database of retention properties for glycan analysis},
journal = {Bioinform.},
volume = {34},
number = {18},
pages = {3231--3232},
year = {2018},
url = {https://doi.org/10.1093/bioinformatics/bty319},
doi = {10.1093/BIOINFORMATICS/BTY319},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/ZhaoWARNSFPRC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/AbrahamMPAABS18,
author = {Christina Susan Abraham and
S. Muthu and
Johanan Christian Prasana and
Sanja J. Armakovic and
Stevan Armakovic and
Fathima Rizwana B. and
Ben Geoffrey A. S.},
title = {Spectroscopic profiling (FT-IR, FT-Raman, {NMR} and UV-Vis), autoxidation
mechanism {(H-BDE)} and molecular docking investigation of 3-(4-chlorophenyl)-N,
N-dimethyl-3-pyridin-2-ylpropan-1-amine by {DFT/TD-DFT} and molecular
dynamics: {A} potential {SSRI} drug},
journal = {Comput. Biol. Chem.},
volume = {77},
pages = {131--145},
year = {2018},
url = {https://doi.org/10.1016/j.compbiolchem.2018.08.010},
doi = {10.1016/J.COMPBIOLCHEM.2018.08.010},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/candc/AbrahamMPAABS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cg/RossGJQ18,
author = {Arun Ross and
Eduardo Simoes Lopes Gastal and
Joaquim A. Jorge and
Ricardo L. de Queiroz},
title = {Foreword to the Special Section on {SIBGRAPI} 2018},
journal = {Comput. Graph.},
volume = {77},
pages = {5},
year = {2018},
url = {https://doi.org/10.1016/j.cag.2018.10.005},
doi = {10.1016/J.CAG.2018.10.005},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cg/RossGJQ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasmp/ZewoudieLH18,
author = {Abraham Woubie Zewoudie and
Jordi Luque and
Javier Hernando},
title = {The use of long-term features for {GMM-} and i-vector-based speaker
diarization systems},
journal = {{EURASIP} J. Audio Speech Music. Process.},
volume = {2018},
pages = {14},
year = {2018},
url = {https://doi.org/10.1186/s13636-018-0140-x},
doi = {10.1186/S13636-018-0140-X},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejasmp/ZewoudieLH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/es/PriegoPDC18,
author = {Blanca Priego and
Abraham Prieto and
Richard J. Duro and
Jocelyn Chanussot},
title = {A cellular automata-based filtering approach to multi-temporal image
denoising},
journal = {Expert Syst. J. Knowl. Eng.},
volume = {35},
number = {2},
year = {2018},
url = {https://doi.org/10.1111/exsy.12235},
doi = {10.1111/EXSY.12235},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/es/PriegoPDC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ColmenarMD18,
author = {Jos{\'{e}} Manuel Colmenar and
Rafael Mart{\'{\i}} and
Abraham Duarte},
title = {Heuristics for the Bi-Objective Diversity Problem},
journal = {Expert Syst. Appl.},
volume = {108},
pages = {193--205},
year = {2018},
url = {https://doi.org/10.1016/j.eswa.2018.05.013},
doi = {10.1016/J.ESWA.2018.05.013},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/ColmenarMD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/AbrahamTMLCG18,
author = {Simon Abraham and
Panagiotis Tsirikoglou and
Jo{\~{a}}o Miranda and
Chris Lacor and
Francesco Contino and
Ghader Ghorbaniasl},
title = {Spectral representation of stochastic field data using sparse polynomial
chaos expansions},
journal = {J. Comput. Phys.},
volume = {367},
pages = {109--120},
year = {2018},
url = {https://doi.org/10.1016/j.jcp.2018.04.025},
doi = {10.1016/J.JCP.2018.04.025},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/AbrahamTMLCG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/ColmenarMD18,
author = {Jos{\'{e}} Manuel Colmenar and
Rafael Mart{\'{\i}} and
Abraham Duarte},
title = {Multi-objective memetic optimization for the bi-objective obnoxious
\emph{p}-median problem},
journal = {Knowl. Based Syst.},
volume = {144},
pages = {88--101},
year = {2018},
url = {https://doi.org/10.1016/j.knosys.2017.12.028},
doi = {10.1016/J.KNOSYS.2017.12.028},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/ColmenarMD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pai/ColmenarHMD18,
author = {J. Manuel Colmenar and
Arild Hoff and
Rafael Mart{\'{\i}} and
Abraham Duarte},
title = {Scatter search for the bi-criteria p-median p-dispersion problem},
journal = {Prog. Artif. Intell.},
volume = {7},
number = {1},
pages = {31--40},
year = {2018},
url = {https://doi.org/10.1007/s13748-017-0132-6},
doi = {10.1007/S13748-017-0132-6},
timestamp = {Sun, 10 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pai/ColmenarHMD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/YuZDAKSGSBTSMWL18,
author = {Wen{-}Han Yu and
Peng Zhao and
Monia Draghi and
Claudia Arevalo and
Christina B. Karsten and
Todd J. Suscovich and
Bronwyn Gunn and
Hendrik Streeck and
Abraham L. Brass and
Michael Tiemeyer and
Michael S. Seaman and
John R. Mascola and
Lance Wells and
Douglas A. Lauffenburger and
Galit Alter},
title = {Exploiting glycan topography for computational design of Env glycoprotein
antigenicity},
journal = {PLoS Comput. Biol.},
volume = {14},
number = {4},
year = {2018},
url = {https://doi.org/10.1371/journal.pcbi.1006093},
doi = {10.1371/JOURNAL.PCBI.1006093},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/YuZDAKSGSBTSMWL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/ArellanoDDSRA18,
author = {Jos{\'{e}} Francisco Rodr{\'{\i}}guez Arellano and
Emmanuel D{\'{a}}vila Delgado and
Mario Alberto Ru{\'{\i}}z Dur{\'{a}}n and
Mart{\'{\i}}n Isaac Falc{\'{o}}n Segovia and
Salvador Abraham Medina Rangel and
Cristian Jael Mej{\'{\i}}a Aguirre},
title = {Ernest: sistema embebido para control de casas inteligentes mediante
correos electr{\'{o}}nicos con cifrado {SSL}},
journal = {Res. Comput. Sci.},
volume = {147},
number = {8},
pages = {215--227},
year = {2018},
url = {https://rcs.cic.ipn.mx/2018\_147\_8/Ernest\_\%20sistema\%20embebido\%20para\%20control\%20de\%20casas\%20inteligentes\%20mediante\%20correos\%20electronicos.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/ArellanoDDSRA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ThomsonMBOGPSQS18,
author = {Eleanor R. Thomson and
Yadvinder Malhi and
Harm M. Bartholomeus and
Imma Oliveras and
Agne Gvozdevaite and
Theresa Peprah and
Juha Suomalainen and
John Quansah and
John Seidu and
Christian Adonteng and
Andrew J. Abraham and
Martin Herold and
Stephen Adu{-}Bredu and
Christopher E. Doughty},
title = {Mapping the Leaf Economic Spectrum across West African Tropical Forests
Using UAV-Acquired Hyperspectral Imagery},
journal = {Remote. Sens.},
volume = {10},
number = {10},
pages = {1532},
year = {2018},
url = {https://doi.org/10.3390/rs10101532},
doi = {10.3390/RS10101532},
timestamp = {Mon, 16 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/ThomsonMBOGPSQS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/AbrahamsenAMS18,
author = {Eirik Bjorheim Abrahamsen and
H{\aa}kon Bjorheim Abrahamsen and
Maria Francesca Milazzo and
Jon T. Selvik},
title = {Using the {ALARP} principle for safety management in the energy production
sector of chemical industry},
journal = {Reliab. Eng. Syst. Saf.},
volume = {169},
pages = {160--165},
year = {2018},
url = {https://doi.org/10.1016/j.ress.2017.08.014},
doi = {10.1016/J.RESS.2017.08.014},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/AbrahamsenAMS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/FramesSLLHRL18,
author = {Christopher W. Frames and
Rahul Soangra and
Thurmon E. Lockhart and
John C. Lach and
Dong Sam Ha and
Karen A. Roberto and
Abraham Lieberman},
title = {Dynamical Properties of Postural Control in Obese Community-Dwelling
Older Adults},
journal = {Sensors},
volume = {18},
number = {6},
pages = {1692},
year = {2018},
url = {https://doi.org/10.3390/s18061692},
doi = {10.3390/S18061692},
timestamp = {Fri, 20 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/FramesSLLHRL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/Lopez-CamposSCF18,
author = {Jos{\'{e}} A. L{\'{o}}pez{-}Campos and
Abraham Segade and
Enrique Casarejos and
Jos{\'{e}} R. Fern{\'{a}}ndez and
J. A. Vil{\'{a}}n and
P. Izquierdo},
title = {Finite Element Study of a Threaded Fastening: The Case of Surgical
Screws in Bone},
journal = {Symmetry},
volume = {10},
number = {8},
pages = {335},
year = {2018},
url = {https://doi.org/10.3390/sym10080335},
doi = {10.3390/SYM10080335},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/Lopez-CamposSCF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/NolandEPAL18,
author = {Jonas Kristiansen Noland and
Fredrik Evestedt and
J. Jose Perez{-}Loya and
Johan Abrahamsson and
Urban Lundin},
title = {Comparison of Thyristor Rectifier Configurations for a Six-Phase Rotating
Brushless Outer Pole {PM} Exciter},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {2},
pages = {968--976},
year = {2018},
url = {https://doi.org/10.1109/TIE.2017.2726963},
doi = {10.1109/TIE.2017.2726963},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/NolandEPAL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/Perez-LoyaAEL18,
author = {J. Jose Perez{-}Loya and
Johan Abrahamsson and
Fredrik Evestedt and
Urban Lundin},
title = {Demonstration of Synchronous Motor Start by Rotor Polarity Inversion},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {10},
pages = {8271--8273},
year = {2018},
url = {https://doi.org/10.1109/TIE.2017.2784342},
doi = {10.1109/TIE.2017.2784342},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/Perez-LoyaAEL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tlt/SchneiderBBDS18,
author = {Johannes Schneider and
Abraham Bernstein and
Jan vom Brocke and
Kostadin Damevski and
David C. Shepherd},
title = {Detecting Plagiarism Based on the Creation Process},
journal = {{IEEE} Trans. Learn. Technol.},
volume = {11},
number = {3},
pages = {348--361},
year = {2018},
url = {https://doi.org/10.1109/TLT.2017.2720171},
doi = {10.1109/TLT.2017.2720171},
timestamp = {Fri, 10 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tlt/SchneiderBBDS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ue/Rodriguez-MotaE18,
author = {Abraham Rodriguez{-}Mota and
Ponciano Jorge Escamilla{-}Ambrosio and
Eleazar Aguirre Anaya and
Jassim Happa},
title = {Reassessing Android Malware Analysis: From Apps to IoT System Modelling},
journal = {{EAI} Endorsed Trans. Ubiquitous Environ.},
volume = {4},
number = {13},
pages = {e3},
year = {2018},
url = {https://doi.org/10.4108/eai.12-1-2018.153565},
doi = {10.4108/EAI.12-1-2018.153565},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ue/Rodriguez-MotaE18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACMse/FuZA18,
author = {Bin Fu and
Fengjuan Zhu and
John Abraham},
editor = {Ka{-}Wing Wong and
Chi Shen and
Dana Brown},
title = {A model for donation verification},
booktitle = {Proceedings of the {ACMSE} 2018 Conference, Richmond, KY, USA, March
29-31, 2018},
pages = {28:1--28:4},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3190645.3190698},
doi = {10.1145/3190645.3190698},
timestamp = {Fri, 12 Mar 2021 15:27:48 +0100},
biburl = {https://dblp.org/rec/conf/ACMse/FuZA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acmicn/AbrahamPDDC18,
author = {Hila Ben Abraham and
Jyoti Parwatikar and
John D. DeHart and
Adam Drescher and
Patrick Crowley},
editor = {Edmund Yeh and
David Oran},
title = {Decoupling information and connectivity via information-centric transport},
booktitle = {Proceedings of the 5th {ACM} Conference on Information-Centric Networking,
{ICN} '18, Boston, Massachusetts, USA, September 21-23, 2018},
pages = {54--66},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3267955.3267963},
doi = {10.1145/3267955.3267963},
timestamp = {Wed, 29 May 2019 13:58:10 +0200},
biburl = {https://dblp.org/rec/conf/acmicn/AbrahamPDDC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/AbrahamICJKG18,
author = {Joanna Abraham and
Imade Ihianle and
Rishabh G. Choudhari and
Alan Jarman and
Thomas George Kannampallil and
William L. Galanter},
title = {Clinician Perspectives on Duplicate Medication Ordering Errors},
booktitle = {{AMIA} 2018, American Medical Informatics Association Annual Symposium,
San Francisco, CA, November 3-7, 2018},
publisher = {{AMIA}},
year = {2018},
url = {https://knowledge.amia.org/67852-amia-1.4259402/t006-1.4263223/t006-1.4263224/2971897-1.4263612/2976543-1.4263609},
timestamp = {Wed, 17 Apr 2024 11:47:15 +0200},
biburl = {https://dblp.org/rec/conf/amia/AbrahamICJKG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/BrarKSBOCH18,
author = {Raj Brar and
Shameer Khader and
Abraham Saraya and
Kevin Bock and
Michael I. Oppenheim and
John Chelico and
Jamie S. Hirsch},
title = {Unsupervised Learning of an Advanced Illness Cohort to Develop Patient
Stratification Models},
booktitle = {{AMIA} 2018, American Medical Informatics Association Annual Symposium,
San Francisco, CA, November 3-7, 2018},
publisher = {{AMIA}},
year = {2018},
url = {https://knowledge.amia.org/67852-amia-1.4259402/t007-1.4262189/t007-1.4262190/2976949-1.4263127/2976546-1.4263124},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/BrarKSBOCH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/FaiolaA18,
author = {Anthony Faiola and
Joanna Abraham},
title = {FAMcare: {A} {MICU} Room-to-Mobile System - Supporting the Communication
Needs of Families},
booktitle = {{AMIA} 2018, American Medical Informatics Association Annual Symposium,
San Francisco, CA, November 3-7, 2018},
publisher = {{AMIA}},
year = {2018},
url = {https://knowledge.amia.org/67852-amia-1.4259402/t006-1.4263223/t006-1.4263224/2976323-1.4263510/2977359-1.4263507},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/FaiolaA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/HirschBSBOCK18,
author = {Jamie S. Hirsch and
Raj Brar and
Abraham Saraya and
Kevin Bock and
Michael I. Oppenheim and
John Chelico and
Shameer Khader},
title = {MEWSCast: Predictive Forecasting of Modified Early Warning Scores
for Preemptive Management of Clinical Acuity},
booktitle = {{AMIA} 2018, American Medical Informatics Association Annual Symposium,
San Francisco, CA, November 3-7, 2018},
publisher = {{AMIA}},
year = {2018},
url = {https://knowledge.amia.org/67852-amia-1.4259402/t007-1.4262189/t007-1.4262190/2977250-1.4262884/2976508-1.4262881},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/HirschBSBOCK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/HansenSLCASYR18,
author = {Raymond A. Hansen and
Kathryn C. Seigfried{-}Spellar and
Seunghee Lee and
Siddarth S. Chowdhury and
Niveah Abraham and
John A. Springer and
Baijian Yang and
Marcus K. Rogers},
editor = {Naoki Abe and
Huan Liu and
Calton Pu and
Xiaohua Hu and
Nesreen K. Ahmed and
Mu Qiao and
Yang Song and
Donald Kossmann and
Bing Liu and
Kisung Lee and
Jiliang Tang and
Jingrui He and
Jeffrey S. Saltz},
title = {File Toolkit for Selective Analysis {\&} Reconstruction (FileTSAR)
for Large-Scale Networks},
booktitle = {{IEEE} International Conference on Big Data {(IEEE} BigData 2018),
Seattle, WA, USA, December 10-13, 2018},
pages = {3059--3065},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BigData.2018.8621914},
doi = {10.1109/BIGDATA.2018.8621914},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bigdataconf/HansenSLCASYR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/AbrahamERF18,
author = {Ashley Abraham and
Michael Eskenazi and
Jennifer Roche and
Jocelyn Folk},
editor = {Chuck Kalish and
Martina A. Rau and
Xiaojin (Jerry) Zhu and
Timothy T. Rogers},
title = {Parafoveal-on-Foveal Effects in High-Skill Spellers: Disambiguating
Previews Influence Ambiguous Word Recognition},
booktitle = {Proceedings of the 40th Annual Meeting of the Cognitive Science Society,
CogSci 2018, Madison, WI, USA, July 25-28, 2018},
publisher = {cognitivesciencesociety.org},
year = {2018},
url = {https://mindmodeling.org/cogsci2018/papers/0250/index.html},
timestamp = {Wed, 17 Apr 2024 12:43:20 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/AbrahamERF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fm/BergerKAWR18,
author = {Philipp Berger and
Joost{-}Pieter Katoen and
Erika {\'{A}}brah{\'{a}}m and
Md Tawhid Bin Waez and
Thomas Rambow},
editor = {Klaus Havelund and
Jan Peleska and
Bill Roscoe and
Erik P. de Vink},
title = {Verifying Auto-generated {C} Code from Simulink - An Experience Report
in the Automotive Domain},
booktitle = {Formal Methods - 22nd International Symposium, {FM} 2018, Held as
Part of the Federated Logic Conference, FloC 2018, Oxford, UK, July
15-17, 2018, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10951},
pages = {312--328},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-95582-7\_18},
doi = {10.1007/978-3-319-95582-7\_18},
timestamp = {Fri, 27 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fm/BergerKAWR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fm/NellenRWAK18,
author = {Johanna Nellen and
Thomas Rambow and
Md Tawhid Bin Waez and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen},
editor = {Klaus Havelund and
Jan Peleska and
Bill Roscoe and
Erik P. de Vink},
title = {Formal Verification of Automotive Simulink Controller Models: Empirical
Technical Challenges, Evaluation and Recommendations},
booktitle = {Formal Methods - 22nd International Symposium, {FM} 2018, Held as
Part of the Federated Logic Conference, FloC 2018, Oxford, UK, July
15-17, 2018, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10951},
pages = {382--398},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-95582-7\_23},
doi = {10.1007/978-3-319-95582-7\_23},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fm/NellenRWAK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/AbrahamKWBH18,
author = {Joanna Abraham and
Thomas George Kannampallil and
Charlotte Ward and
Christopher Bogan and
Abbas Hyderi},
editor = {Tung Bui},
title = {Effect of Handoff Training on Resident Communication Quality: An Observational
Study},
booktitle = {51st Hawaii International Conference on System Sciences, {HICSS} 2018,
Hilton Waikoloa Village, Hawaii, USA, January 3-6, 2018},
pages = {1--10},
publisher = {ScholarSpace / {AIS} Electronic Library (AISeL)},
year = {2018},
url = {https://hdl.handle.net/10125/50259},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/AbrahamKWBH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdim/AbrahamsL18,
author = {Muhammad Zaid Abrahams and
Josef J. Langerman},
title = {Compliance at Velocity within a DevOps Environment},
booktitle = {2018 Thirteenth International Conference on Digital Information Management
(ICDIM), Berlin, Germany, September 24-26, 2018},
pages = {94--101},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICDIM.2018.8847007},
doi = {10.1109/ICDIM.2018.8847007},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icdim/AbrahamsL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icls/AbrahamsonALBNW18,
author = {Dor Abrahamson and
Alejandro Andrade and
Oskar Lindwall and
Arthur Bakker and
Mitchell J. Nathan and
Candace A. Walkington and
Robb Lindgren and
David E. Brown and
Asnat R. Zohar and
Sharona T. Levy and
Joshua A. Danish and
Adam Maltese and
Noel Enyedy and
Megan Humburg and
Asmalina Saleh and
Maggie Dahn and
Christine Lee and
Xintian Tu and
Bria Davis and
Chris Georgen},
editor = {Manolis Mavrikis and
Kaska Porayska{-}Pomsta},
title = {Moving Forward: In Search of Synergy Across Diverse Views on the Role
of Physical Movement in Design for {STEM} Education},
booktitle = {Rethinking learning in the digital age: Making the Learning Sciences
count - Proceedings of the 13th International Conference of the Learning
Sciences, {ICLS} 2018, London, UK, June 23-27, 2018},
publisher = {International Society of the Learning Sciences},
year = {2018},
url = {https://repository.isls.org/handle/1/600},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icls/AbrahamsonALBNW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/GonzalezMLVFY18,
author = {Francisco J. Gonzalez and
Abraham Marquez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo and
Jiapeng Yin},
title = {Flexible Harmonic Control for Three-Level Selective Harmonic Modulation
Using the Exchange Market Algorithm},
booktitle = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics
Society, Washington, DC, USA, October 21-23, 2018},
pages = {5297--5302},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IECON.2018.8591231},
doi = {10.1109/IECON.2018.8591231},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/GonzalezMLVFY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MarquezLVFBL18,
author = {Abraham Marquez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo and
Giampaolo Buticchi and
Marco Liserre},
title = {Power Device Lifetime Extension of Dc-Dc Interleaved Converters via
Power Routing},
booktitle = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics
Society, Washington, DC, USA, October 21-23, 2018},
pages = {5332--5337},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IECON.2018.8592912},
doi = {10.1109/IECON.2018.8592912},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/MarquezLVFBL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/YinLFWM18,
author = {Jiapeng Yin and
Jos{\'{e}} I. Leon and
Leopoldo Garc{\'{\i}}a Franquelo and
Sergio Vazquez and
Abraham Marquez},
title = {Generating the Arm Voltage References of Modular Multilevel Converters
Employing Predictive Technique},
booktitle = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics
Society, Washington, DC, USA, October 21-23, 2018},
pages = {3949--3954},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IECON.2018.8591368},
doi = {10.1109/IECON.2018.8591368},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/YinLFWM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isalalife/TruebaP18,
author = {Pedro Trueba and
Abraham Prieto},
editor = {Takashi Ikegami and
Nathaniel Virgo and
Olaf Witkowski and
Mizuki Oka and
Reiji Suzuki and
Hiroyuki Iizuka},
title = {Improving performance in distributed embodied evolution: Distributed
Differential Embodied Evolution},
booktitle = {2018 Conference on Artificial Life, {ALIFE} 2018, Tokyo, Japan, July
23-27, 2018},
pages = {222--223},
publisher = {{MIT} Press},
year = {2018},
url = {https://doi.org/10.1162/isal\_a\_00046},
doi = {10.1162/ISAL\_A\_00046},
timestamp = {Tue, 26 Jul 2022 11:58:11 +0200},
biburl = {https://dblp.org/rec/conf/isalalife/TruebaP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/RiyahiCLNTZCWMD18,
author = {Sadegh Riyahi and
Wookjin Choi and
Chia{-}Ju Liu and
Saad Nadeem and
Shan Tan and
Hualiang Zhong and
Wengen Chen and
Abraham J. Wu and
James G. Mechalakos and
Joseph O. Deasy and
Wei Lu},
editor = {Andrew Melbourne and
Roxane Licandro and
Matthew D. DiFranco and
Paolo Rota and
Melanie Gau and
Martin Kampel and
Rosalind Aughwane and
Pim Moeskops and
Ernst Schwartz and
Emma C. Robinson and
Antonios Makropoulos},
title = {Quantification of Local Metabolic Tumor Volume Changes by Registering
Blended {PET-CT} Images for Prediction of Pathologic Tumor Response},
booktitle = {Data Driven Treatment Response Assessment - and - Preterm, Perinatal,
and Paediatric Image Analysis - First International Workshop, {DATRA}
2018 - and - Third International Workshop, {PIPPI} 2018, Held in Conjunction
with {MICCAI} 2018, Granada, Spain, September 16, 2018, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11076},
pages = {31--41},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-00807-9\_4},
doi = {10.1007/978-3-030-00807-9\_4},
timestamp = {Fri, 08 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miccai/RiyahiCLNTZCWMD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtip2r/SundarS18,
author = {K. Joseph Abraham Sundar and
R. Sekar},
editor = {KC Santosh and
Ravindra S. Hegadi},
title = {Multi-frame Super Resolution Using Enhanced Papoulis-Gerchberg Method},
booktitle = {Recent Trends in Image Processing and Pattern Recognition - Second
International Conference, {RTIP2R} 2018, Solapur, India, December
21-22, 2018, Revised Selected Papers, Part {I}},
series = {Communications in Computer and Information Science},
volume = {1035},
pages = {667--677},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-981-13-9181-1\_57},
doi = {10.1007/978-981-13-9181-1\_57},
timestamp = {Mon, 16 Jan 2023 08:52:16 +0100},
biburl = {https://dblp.org/rec/conf/rtip2r/SundarS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/corr/abs-1805-11496,
author = {Abraham Westerbaan and
Bas Westerbaan and
John van de Wetering},
editor = {Peter Selinger and
Giulio Chiribella},
title = {Pure Maps between Euclidean Jordan Algebras},
booktitle = {Proceedings 15th International Conference on Quantum Physics and Logic,
{QPL} 2018, Halifax, Canada, 3-7th June 2018},
series = {{EPTCS}},
volume = {287},
pages = {345--364},
year = {2018},
url = {https://doi.org/10.4204/EPTCS.287.19},
doi = {10.4204/EPTCS.287.19},
timestamp = {Sat, 28 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-11496.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-09886,
author = {Jay Aikat and
Ilya Baldin and
Mark Berman and
Joe Breen and
Richard R. Brooks and
Prasad Calyam and
Jeffrey S. Chase and
Wallace Chase and
Russ Clark and
Chip Elliott and
Jim Griffioen and
Dijiang Huang and
Julio Ibarra and
Tom Lehman and
Inder Monga and
Abraham Matta and
Christos Papadopoulos and
Mike Reiter and
Dipankar Raychaudhuri and
Glenn Ricart and
Robert Ricci and
Paul Ruth and
Ivan Seskar and
Jerry Sobieski and
Kobus van der Merwe and
Kuang{-}Ching Wang and
Tilman Wolf and
Michael Zink},
title = {The Future of {CISE} Distributed Research Infrastructure},
journal = {CoRR},
volume = {abs/1803.09886},
year = {2018},
url = {http://arxiv.org/abs/1803.09886},
eprinttype = {arXiv},
eprint = {1803.09886},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-09886.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1806-01214,
author = {Ittai Abraham and
Danny Dolev and
Ivan Geffner and
Joseph Y. Halpern},
title = {Implementing Mediators with Asynchronous Cheap Talk},
journal = {CoRR},
volume = {abs/1806.01214},
year = {2018},
url = {http://arxiv.org/abs/1806.01214},
eprinttype = {arXiv},
eprint = {1806.01214},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1806-01214.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1808-08312,
author = {Sadegh Riyahi and
Wookjin Choi and
Chia{-}Ju Liu and
Saad Nadeem and
Shan Tan and
Hualiang Zhong and
Wengen Chen and
Abraham J. Wu and
James G. Mechalakos and
Joseph O. Deasy and
Wei Lu},
title = {Quantification of Local Metabolic Tumor Volume Changes by Registering
Blended {PET-CT} Images for Prediction of Pathologic Tumor Response},
journal = {CoRR},
volume = {abs/1808.08312},
year = {2018},
url = {http://arxiv.org/abs/1808.08312},
eprinttype = {arXiv},
eprint = {1808.08312},
timestamp = {Fri, 08 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1808-08312.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1808-08357,
author = {Bijil Abraham Philip and
Manas Jog and
Apurv Milind Upasani},
title = {Dr. Tux: {A} Question Answering System for Ubuntu users},
journal = {CoRR},
volume = {abs/1808.08357},
year = {2018},
url = {http://arxiv.org/abs/1808.08357},
eprinttype = {arXiv},
eprint = {1808.08357},
timestamp = {Sun, 02 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1808-08357.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-07118,
author = {Joseph D. Gleason and
Abraham P. Vinod and
Meeko M. K. Oishi},
title = {Lagrangian Approximations for Stochastic Reachability of a Target
Tube},
journal = {CoRR},
volume = {abs/1810.07118},
year = {2018},
url = {http://arxiv.org/abs/1810.07118},
eprinttype = {arXiv},
eprint = {1810.07118},
timestamp = {Tue, 30 Oct 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-07118.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcopi/LorancaAVLSD17,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Mart{\'{\i}}n Estrada Analco and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az},
title = {Quadratic Assignation Problem: {A} solution approach with parallel
{GRASP}},
journal = {Int. J. Comb. Optim. Probl. Informatics},
volume = {8},
number = {3},
pages = {33--38},
year = {2017},
url = {https://ijcopi.org/index.php/ojs/article/view/16},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcopi/LorancaAVLSD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/KannampallilASP17,
author = {Thomas George Kannampallil and
Joanna Abraham and
Anna Solotskaya and
Sneha G. Philip and
Bruce L. Lambert and
Gordon D. Schiff and
Adam Wright and
William L. Galanter},
title = {Learning from errors: analysis of medication order voiding in {CPOE}
systems},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {4},
pages = {762--768},
year = {2017},
url = {https://doi.org/10.1093/jamia/ocw187},
doi = {10.1093/JAMIA/OCW187},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/KannampallilASP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/LopezGRSS17,
author = {Karen Dunn Lopez and
Sheila M. Gephart and
Rebecca Raszewski and
Vanessa Sousa and
Lauren E. Shehorn and
Joanna Abraham},
title = {Integrative review of clinical decision support for registered nurses
in acute care settings},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {2},
pages = {441--450},
year = {2017},
url = {https://doi.org/10.1093/jamia/ocw084},
doi = {10.1093/JAMIA/OCW084},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/LopezGRSS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/AbrahamKSGTC17,
author = {Joanna Abraham and
Thomas George Kannampallil and
Vignesh Srinivasan and
William L. Galanter and
Gail Tagney and
Trevor Cohen},
title = {Measuring content overlap during handoff communication using distributional
semantics: An exploratory study},
journal = {J. Biomed. Informatics},
volume = {65},
pages = {132--144},
year = {2017},
url = {https://doi.org/10.1016/j.jbi.2016.11.009},
doi = {10.1016/J.JBI.2016.11.009},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/AbrahamKSGTC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mbec/ChandyCTS17,
author = {D. Abraham Chandy and
Hepzibah A. Christinal and
Alwyn John Theodore and
S. Easter Selvan},
title = {Neighbourhood search feature selection method for content-based mammogram
retrieval},
journal = {Medical Biol. Eng. Comput.},
volume = {55},
number = {3},
pages = {493--505},
year = {2017},
url = {https://doi.org/10.1007/s11517-016-1513-x},
doi = {10.1007/S11517-016-1513-X},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mbec/ChandyCTS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/HuanKKHA17,
author = {Teo Ting Huan and
Anand J. Kulkarni and
Jeevan Kanesan and
Joon Huang Chuah and
Ajith Abraham},
title = {Ideology algorithm: a socio-inspired optimization methodology},
journal = {Neural Comput. Appl.},
volume = {28},
number = {{S-1}},
pages = {845--876},
year = {2017},
url = {https://doi.org/10.1007/s00521-016-2379-4},
doi = {10.1007/S00521-016-2379-4},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nca/HuanKKHA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/DosenbachKEMKVS17,
author = {Nico U. F. Dosenbach and
Jonathan M. Koller and
Eric A. Earl and
Oscar Miranda{-}Dominguez and
Rachel L. Klein and
Andrew N. Van and
Abraham Z. Snyder and
Bonnie J. Nagel and
Joel T. Nigg and
Annie L. Nguyen and
Victoria Wesevich and
Deanna J. Greene and
Damien A. Fair},
title = {Real-time motion analytics during brain {MRI} improve data quality
and reduce costs},
journal = {NeuroImage},
volume = {161},
pages = {80--93},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2017.08.025},
doi = {10.1016/J.NEUROIMAGE.2017.08.025},
timestamp = {Mon, 03 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/DosenbachKEMKVS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/MartinBPFH17,
author = {R. Abraham Martin and
Landen Blackburn and
Joshua Pulsipher and
Kevin Franke and
John D. Hedengren},
title = {Potential Benefits of Combining Anomaly Detection with View Planning
for {UAV} Infrastructure Modeling},
journal = {Remote. Sens.},
volume = {9},
number = {5},
pages = {434},
year = {2017},
url = {https://doi.org/10.3390/rs9050434},
doi = {10.3390/RS9050434},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/MartinBPFH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/LinBKH17,
author = {X. Lin and
Rob J. I. Basten and
A. A. Kranenburg and
G. J. van Houtum},
title = {Condition based spare parts supply},
journal = {Reliab. Eng. Syst. Saf.},
volume = {168},
pages = {240--248},
year = {2017},
url = {https://doi.org/10.1016/j.ress.2017.05.035},
doi = {10.1016/J.RESS.2017.05.035},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ress/LinBKH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/DhawanJSBCGJLMM17,
author = {Medhavi Dhawan and
Gurprit Johal and
Jim Stabile and
Vjekoslav Brajkovic and
James Chang and
Kapil Goyal and
Kevin James and
Zeeshan Lokhandwala and
Anny Mart{\'{\i}}nez Manzanilla and
Roger Michoud and
Maithem Munshed and
Srinivas Neginhal and
Konstantin Spirov and
Michael Wei and
Scott Fritchie and
Christopher J. Rossbach and
Ittai Abraham and
Dahlia Malkhi},
title = {Consistent Clustered Applications with Corfu},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {51},
number = {1},
pages = {78--82},
year = {2017},
url = {https://doi.org/10.1145/3139645.3139658},
doi = {10.1145/3139645.3139658},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigops/DhawanJSBCGJLMM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sivp/SundarV17,
author = {K. Joseph Abraham Sundar and
V. Vaithiyanathan},
title = {Multi-frame super-resolution using adaptive normalized convolution},
journal = {Signal Image Video Process.},
volume = {11},
number = {2},
pages = {357--362},
year = {2017},
url = {https://doi.org/10.1007/s11760-016-0952-z},
doi = {10.1007/S11760-016-0952-Z},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sivp/SundarV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/FangTYSZSA17,
author = {Jie Fang and
Shankar Thirunakkarasu and
Xuefeng Yu and
Fabian Silva{-}Rivas and
Chaoming Zhang and
Frank Singor and
Jacob A. Abraham},
title = {A 5-GS/s 10-b 76-mW Time-Interleaved {SAR} {ADC} in 28 nm {CMOS}},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {64-I},
number = {7},
pages = {1673--1683},
year = {2017},
url = {https://doi.org/10.1109/TCSI.2017.2661481},
doi = {10.1109/TCSI.2017.2661481},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/FangTYSZSA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MarquezGVGFFK17,
author = {Abraham Marquez and
Jose Ignacio Le{\'{o}}n Galv{\'{a}}n and
Sergio Vazquez and
Ram{\'{o}}n Portillo Guisado and
Leopoldo Garc{\'{\i}}a Franquelo and
Emilio Freire and
Samir Kouro},
title = {Variable-Angle Phase-Shifted {PWM} for Multilevel Three-Cell Cascaded
H-Bridge Converters},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {64},
number = {5},
pages = {3619--3628},
year = {2017},
url = {https://doi.org/10.1109/TIE.2017.2652406},
doi = {10.1109/TIE.2017.2652406},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/MarquezGVGFFK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tpds/UnatDHSABCCEFFH17,
author = {Didem Unat and
Anshu Dubey and
Torsten Hoefler and
John Shalf and
Mark James Abraham and
Mauro Bianco and
Bradford L. Chamberlain and
Romain Cledat and
H. Carter Edwards and
Hal Finkel and
Karl Fuerlinger and
Frank Hannig and
Emmanuel Jeannot and
Amir Kamil and
Jeff Keasler and
Paul H. J. Kelly and
Vitus J. Leung and
Hatem Ltaief and
Naoya Maruyama and
Chris J. Newburn and
Miquel Peric{\`{a}}s},
title = {Trends in Data Locality Abstractions for {HPC} Systems},
journal = {{IEEE} Trans. Parallel Distributed Syst.},
volume = {28},
number = {10},
pages = {3007--3020},
year = {2017},
url = {https://doi.org/10.1109/TPDS.2017.2703149},
doi = {10.1109/TPDS.2017.2703149},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tpds/UnatDHSABCCEFFH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/AbrahamBI17,
author = {Joanna Abraham and
Shirley Burton and
Imade Ihianle},
title = {Applying a Process-based Framework to examine Interunit Patient Transfers},
booktitle = {{AMIA} 2017, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 4-8, 2017},
publisher = {{AMIA}},
year = {2017},
url = {https://knowledge.amia.org/65881-amiab-1.4254737/t001-1.4259018/f001-1.4259019/2730992-1.4259382/2731599-1.4259379},
timestamp = {Wed, 17 Apr 2024 11:47:24 +0200},
biburl = {https://dblp.org/rec/conf/amia/AbrahamBI17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cade/AbrahamA0BBCDEF17,
author = {Erika {\'{A}}brah{\'{a}}m and
John Abbott and
Bernd Becker and
Anna Maria Bigatti and
Martin Brain and
Alessandro Cimatti and
James H. Davenport and
Matthew England and
Pascal Fontaine and
Stephen Forrest and
Vijay Ganesh and
Alberto Griggio and
Daniel Kroening and
Werner M. Seiler},
editor = {Giles Reger and
Dmitriy Traytel},
title = {SC-square: when Satisfiability Checking and Symbolic Computation join
forces},
booktitle = {{ARCADE} 2017, 1st International Workshop on Automated Reasoning:
Challenges, Applications, Directions, Exemplary Achievements, Gothenburg,
Sweden, 6th August 2017},
series = {EPiC Series in Computing},
volume = {51},
pages = {6--10},
publisher = {EasyChair},
year = {2017},
url = {https://doi.org/10.29007/p319},
doi = {10.29007/P319},
timestamp = {Thu, 27 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cade/AbrahamA0BBCDEF17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/KhodambashiGAM17,
author = {Soudabeh Khodambashi and
Jon Atle Gulla and
Pekka Abrahamsson and
Florentin Moser},
editor = {Panagiotis D. Bamidis and
Stathis Th. Konstantinidis and
Pedro Pereira Rodrigues},
title = {Design and Development of a Mobile Decision Support System: Guiding
Clinicians Regarding Law in the Practice of Psychiatry in Emergency
Department},
booktitle = {30th {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2017, Thessaloniki, Greece, June 22-24, 2017},
pages = {67--72},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/CBMS.2017.77},
doi = {10.1109/CBMS.2017.77},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/KhodambashiGAM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/GleasonVO17,
author = {Joseph D. Gleason and
Abraham P. Vinod and
Meeko M. K. Oishi},
title = {Underapproximation of reach-avoid sets for discrete-time stochastic
systems via Lagrangian methods},
booktitle = {56th {IEEE} Annual Conference on Decision and Control, {CDC} 2017,
Melbourne, Australia, December 12-15, 2017},
pages = {4283--4290},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/CDC.2017.8264291},
doi = {10.1109/CDC.2017.8264291},
timestamp = {Fri, 04 Mar 2022 13:29:55 +0100},
biburl = {https://dblp.org/rec/conf/cdc/GleasonVO17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/educon/BurkeFCJMC17,
author = {Emmet Burke and
Patrick Felle and
Claire Crowley and
James Jones and
Eleni E. Mangina and
Abraham G. Campbell},
title = {Augmented reality {EVAR} training in mixed reality educational space},
booktitle = {2017 {IEEE} Global Engineering Education Conference, {EDUCON} 2017,
Athens, Greece, April 25-28, 2017},
pages = {1571--1579},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/EDUCON.2017.7943058},
doi = {10.1109/EDUCON.2017.7943058},
timestamp = {Wed, 01 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/educon/BurkeFCJMC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcce/OrtizDLS17,
author = {Kristine Joyce P. Ortiz and
Christian A. Diaz and
Abraham M. Lim and
Daryl A. Sibayan},
title = {IoT-based pulmonary monitoring system},
booktitle = {{IEEE} 6th Global Conference on Consumer Electronics, {GCCE} 2017,
Nagoya, Japan, October 24-27, 2017},
pages = {1--5},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/GCCE.2017.8229446},
doi = {10.1109/GCCE.2017.8229446},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/gcce/OrtizDLS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/TruebaPB17,
author = {Pedro Trueba and
Abraham Prieto and
Francisco Bellas},
editor = {Peter A. N. Bosman},
title = {Embodied evolution versus cooperative coevolution in multi-robot optimization:
a practical comparison},
booktitle = {Genetic and Evolutionary Computation Conference, Berlin, Germany,
July 15-19, 2017, Companion Material Proceedings},
pages = {79--80},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3067695.3076083},
doi = {10.1145/3067695.3076083},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/TruebaPB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ghtc/AbrahamBM17,
author = {Shiny Abraham and
Joshua Beard and
Renjith Manijacob},
title = {Remote environmental monitoring using Internet of Things (IoT)},
booktitle = {{IEEE} Global Humanitarian Technology Conference, {GHTC} 2017, San
Jose, CA, USA, October 19-22, 2017},
pages = {1--6},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/GHTC.2017.8239335},
doi = {10.1109/GHTC.2017.8239335},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/ghtc/AbrahamBM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/AbrahamssonALNT17,
author = {Henrik Abrahamsson and
Bengt Ahlgren and
Patrik Lindvall and
Johanna Nieminen and
Per Tholin},
title = {Traffic characteristics on 1Gbit/s access aggregation links},
booktitle = {{IEEE} International Conference on Communications, {ICC} 2017, Paris,
France, May 21-25, 2017},
pages = {1--7},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICC.2017.7996770},
doi = {10.1109/ICC.2017.7996770},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/icc/AbrahamssonALNT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/GonzalezLMLPF17,
author = {Francisco J. Gonzalez and
Marta Laguna and
Abraham Marquez and
Jos{\'{e}} I. Leon and
Ram{\'{o}}n C. Portillo and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Selective harmonic mitigation technique based on the exchange market
algorithm for high-power applications},
booktitle = {{IECON} 2017 - 43rd Annual Conference of the {IEEE} Industrial Electronics
Society, Beijing, China, October 29 - November 1, 2017},
pages = {6488--6493},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IECON.2017.8217130},
doi = {10.1109/IECON.2017.8217130},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/GonzalezLMLPF17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MarquezLVFK17,
author = {Abraham Marquez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo and
Samir Kouro},
title = {Operation of an hybrid PV-battery system with improved harmonic performance},
booktitle = {{IECON} 2017 - 43rd Annual Conference of the {IEEE} Industrial Electronics
Society, Beijing, China, October 29 - November 1, 2017},
pages = {4272--4277},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IECON.2017.8216733},
doi = {10.1109/IECON.2017.8216733},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/MarquezLVFK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MarquezLVFP17,
author = {Abraham Marquez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo and
Marcelo A. P{\'{e}}rez},
title = {A comprehensive comparison of modulation methods for {MMC} converters},
booktitle = {{IECON} 2017 - 43rd Annual Conference of the {IEEE} Industrial Electronics
Society, Beijing, China, October 29 - November 1, 2017},
pages = {4459--4464},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IECON.2017.8216768},
doi = {10.1109/IECON.2017.8216768},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/MarquezLVFP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/AbrahamRCST17,
author = {Emerson Rodolfo Abraham and
Jo{\~{a}}o Gilberto Mendes dos Reis and
Adriane Paulieli Colossetti and
Aguinaldo Eduardo de Souza and
Rodrigo Carlo Toloi},
editor = {Hermann L{\"{o}}dding and
Ralph Riedel and
Klaus{-}Dieter Thoben and
Gregor von Cieminski and
Dimitris Kiritsis},
title = {Neural Network System to Forecast the Soybean Exportation on Brazilian
Port of Santos},
booktitle = {Advances in Production Management Systems. The Path to Intelligent,
Collaborative and Sustainable Manufacturing - {IFIP} {WG} 5.7 International
Conference, {APMS} 2017, Hamburg, Germany, September 3-7, 2017, Proceedings,
Part {II}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {514},
pages = {83--90},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-66926-7\_10},
doi = {10.1007/978-3-319-66926-7\_10},
timestamp = {Fri, 27 Mar 2020 09:00:33 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-7/AbrahamRCST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/SouzaRAM17,
author = {Aguinaldo Eduardo de Souza and
Jo{\~{a}}o Gilberto Mendes dos Reis and
Emerson Rodolfo Abraham and
Sivanilza Teixeira Machado},
editor = {Hermann L{\"{o}}dding and
Ralph Riedel and
Klaus{-}Dieter Thoben and
Gregor von Cieminski and
Dimitris Kiritsis},
title = {Brazilian Corn Exports: An Analysis of Cargo Flow in Santos and Paranagua
Port},
booktitle = {Advances in Production Management Systems. The Path to Intelligent,
Collaborative and Sustainable Manufacturing - {IFIP} {WG} 5.7 International
Conference, {APMS} 2017, Hamburg, Germany, September 3-7, 2017, Proceedings,
Part {II}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {514},
pages = {105--112},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-66926-7\_13},
doi = {10.1007/978-3-319-66926-7\_13},
timestamp = {Mon, 06 Nov 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-7/SouzaRAM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/TorresPDC17,
author = {Blanca Maria Priego Torres and
Abraham Prieto and
Richard J. Duro and
Jocelyn Chanussot},
title = {Spatio-temporal cellular automata-based filtering for image sequence
denoising},
booktitle = {2017 International Joint Conference on Neural Networks, {IJCNN} 2017,
Anchorage, AK, USA, May 14-19, 2017},
pages = {2362--2369},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IJCNN.2017.7966142},
doi = {10.1109/IJCNN.2017.7966142},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/TorresPDC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/AbrahamUJ17,
author = {Basil Abraham and
Srinivasan Umesh and
Neethu Mariam Joy},
editor = {Francisco Lacerda},
title = {Joint Estimation of Articulatory Features and Acoustic Models for
Low-Resource Languages},
booktitle = {18th Annual Conference of the International Speech Communication Association,
Interspeech 2017, Stockholm, Sweden, August 20-24, 2017},
pages = {2153--2157},
publisher = {{ISCA}},
year = {2017},
url = {https://doi.org/10.21437/Interspeech.2017-1028},
doi = {10.21437/INTERSPEECH.2017-1028},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/AbrahamUJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/JoyKUA17,
author = {Neethu Mariam Joy and
Sandeep Reddy Kothinti and
Srinivasan Umesh and
Basil Abraham},
editor = {Francisco Lacerda},
title = {Generalized Distillation Framework for Speaker Normalization},
booktitle = {18th Annual Conference of the International Speech Communication Association,
Interspeech 2017, Stockholm, Sweden, August 20-24, 2017},
pages = {739--743},
publisher = {{ISCA}},
year = {2017},
url = {https://doi.org/10.21437/Interspeech.2017-874},
doi = {10.21437/INTERSPEECH.2017-874},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/JoyKUA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/JoyUA17,
author = {Neethu Mariam Joy and
Srinivasan Umesh and
Basil Abraham},
editor = {Francisco Lacerda},
title = {On Improving Acoustic Models for {TORGO} Dysarthric Speech Database},
booktitle = {18th Annual Conference of the International Speech Communication Association,
Interspeech 2017, Stockholm, Sweden, August 20-24, 2017},
pages = {2695--2699},
publisher = {{ISCA}},
year = {2017},
url = {https://doi.org/10.21437/Interspeech.2017-878},
doi = {10.21437/INTERSPEECH.2017-878},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/JoyUA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/WongKLWMSHCHJWZ17,
author = {Jay Ming Wong and
Vincent Kee and
Tiffany Le and
Syler Wagner and
Gian Luca Mariottini and
Abraham Schneider and
Lei Hamilton and
Rahul Chipalkatty and
Mitchell Hebert and
David M. S. Johnson and
Jimmy Wu and
Bolei Zhou and
Antonio Torralba},
title = {SegICP: Integrated deep semantic segmentation and pose estimation},
booktitle = {2017 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2017, Vancouver, BC, Canada, September 24-28, 2017},
pages = {5784--5789},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IROS.2017.8206470},
doi = {10.1109/IROS.2017.8206470},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/WongKLWMSHCHJWZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/VeigaRPCFRGI17,
author = {C{\'{e}}sar Veiga and
Daniel Rivera and
Abraham Paz and
Diego Castineira and
Jos{\'{e}} Fari{\~{n}}a and
Juan J. Rodr{\'{\i}}guez{-}Andina and
Enrique Garc{\'{\i}}a and
Andr{\'{e}}s {\'{I}}{\~{n}}iguez},
title = {Optimized PPG-based wearable acquisition unit for massive analysis
of heart rhythms},
booktitle = {26th {IEEE} International Symposium on Industrial Electronics, {ISIE}
2017, Edinburgh, United Kingdom, June 19-21, 2017},
pages = {2044--2049},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISIE.2017.8001569},
doi = {10.1109/ISIE.2017.8001569},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isie/VeigaRPCFRGI17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kkio/Nguyen-DucKGKA17,
author = {Anh Nguyen{-}Duc and
Soudabeh Khodambashi and
Jon Atle Gulla and
John Krogstie and
Pekka Abrahamsson},
editor = {Piotr Kosiuczenko and
Lech Madeyski},
title = {Female Leadership in Software Projects - {A} Preliminary Result on
Leadership Style and Project Context Factors},
booktitle = {Towards a Synergistic Combination of Research and Practice in Software
Engineering [papers from {KKIO} 2017, Rzesz{\'{o}}w, Poland,
14-16 September 2017]},
series = {Studies in Computational Intelligence},
volume = {733},
pages = {149--163},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-65208-5\_11},
doi = {10.1007/978-3-319-65208-5\_11},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kkio/Nguyen-DucKGKA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mum/FastnachtFHZAM17,
author = {Till Fastnacht and
Patrick Tobias Fischer and
Eva Hornecker and
Sabine Zierold and
Abraham Ornelas Aispuro and
Johannes Marschall},
editor = {Niels Henze and
Pawel W. Wozniak and
Kaisa V{\"{a}}{\"{a}}n{\"{a}}nen and
Julie R. Williamson and
Stefan Schneegass},
title = {The hedonic value of sonnengarten: touching plants to trigger light},
booktitle = {Proceedings of the 16th International Conference on Mobile and Ubiquitous
Multimedia, {MUM} 2017, Stuttgart, Germany, November 26 - 29, 2017},
pages = {507--514},
publisher = {{ACM}},
year = {2017},
url = {https://dl.acm.org/citation.cfm?id=3157809},
timestamp = {Fri, 09 Apr 2021 14:27:57 +0200},
biburl = {https://dblp.org/rec/conf/mum/FastnachtFHZAM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recsys/GrasserBKAMSZ17,
author = {Felix Gr{\"{a}}{\ss}er and
Stefanie Beckert and
Denise K{\"{u}}ster and
Susanne Abraham and
Hagen Malberg and
Jochen Schmitt and
Sebastian Zaunseder},
editor = {David Elsweiler and
Santiago Hors{-}Fraile and
Bernd Ludwig and
Alan Said and
Hanna Sch{\"{a}}fer and
Christoph Trattner and
Helma Torkamaan and
Andr{\'{e}} Calero Valdez},
title = {Neighborhood-based Collaborative Filtering for Therapy Decision Support},
booktitle = {Proceedings of the 2nd International Workshop on Health Recommender
Systems co-located with the 11th International Conference on Recommender
Systems (RecSys 2017), Como, Italy, August 31, 2017},
series = {{CEUR} Workshop Proceedings},
volume = {1953},
pages = {22--26},
publisher = {CEUR-WS.org},
year = {2017},
url = {https://ceur-ws.org/Vol-1953/healthRecSys17\_paper\_10.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:14 +0100},
biburl = {https://dblp.org/rec/conf/recsys/GrasserBKAMSZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scsc/FlaxmanDDMSEVFM17,
author = {Abraham D. Flaxman and
Alec W. Deason and
Andrew J. Dolgert and
John Everett Mumford and
Reed J. D. Sorensen and
Erika Eldrenkamp and
Theo Vos and
Kyle Foreman and
Ali H. Mokdad and
Marcia R. Weaver},
title = {Untangling uncertainty with common random numbers: a simulation study},
booktitle = {Proceedings of the Summer Simulation Multi-Conference, SummerSim 2017,
Bellevue, WA, USA, July 9-12, 2017},
pages = {31:1--31:12},
publisher = {Society for Computer Simulation International / {ACM} {DL}},
year = {2017},
url = {http://dl.acm.org/citation.cfm?id=3140096},
timestamp = {Thu, 14 Sep 2017 14:23:02 +0200},
biburl = {https://dblp.org/rec/conf/scsc/FlaxmanDDMSEVFM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scsc/SorensenFDMEMW17,
author = {Reed J. D. Sorensen and
Abraham D. Flaxman and
Alec W. Deason and
John Everett Mumford and
Erika Eldrenkamp and
Mark Moses and
Marcia R. Weaver},
title = {Microsimulation models for cost-effectiveness analysis: a review and
introduction to {CEAM}},
booktitle = {Proceedings of the Summer Simulation Multi-Conference, SummerSim 2017,
Bellevue, WA, USA, July 9-12, 2017},
pages = {32:1--32:11},
publisher = {Society for Computer Simulation International / {ACM} {DL}},
year = {2017},
url = {http://dl.acm.org/citation.cfm?id=3140097},
timestamp = {Fri, 15 Sep 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/scsc/SorensenFDMEMW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uc/ChristinalJCG17,
author = {Hepzibah A. Christinal and
Rose Rani John and
D. Abraham Chandy and
Miguel Angel Guti{\'{e}}rrez{-}Naranjo},
editor = {Matthew J. Patitz and
Mike Stannett},
title = {Solving the Bin-Packing Problem by Means of Tissue {P} System with
2-Division},
booktitle = {Unconventional Computation and Natural Computation - 16th International
Conference, {UCNC} 2017, Fayetteville, AR, USA, June 5-9, 2017, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10240},
pages = {170--181},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-58187-3\_13},
doi = {10.1007/978-3-319-58187-3\_13},
timestamp = {Tue, 28 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uc/ChristinalJCG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vahc/ThomasKAM17,
author = {Manu Mathew Thomas and
Thomas George Kannampallil and
Joanna Abraham and
G. Elisabeta Marai},
title = {Echo: {A} large display interactive visualization of {ICU} data for
effective care handoffs},
booktitle = {{IEEE} Workshop on Visual Analytics in Healthcare, {VAHC} 2017, Phoenix,
AZ, USA, October 1, 2017},
pages = {47--54},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/VAHC.2017.8387500},
doi = {10.1109/VAHC.2017.8387500},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vahc/ThomasKAM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/GoncalvesFHKB17,
author = {Jorge Gon{\c{c}}alves and
Michael Feldman and
Subingqian Hu and
Vassilis Kostakos and
Abraham Bernstein},
editor = {Rick Barrett and
Rick Cummings and
Eugene Agichtein and
Evgeniy Gabrilovich},
title = {Task Routing and Assignment in Crowdsourcing based on Cognitive Abilities},
booktitle = {Proceedings of the 26th International Conference on World Wide Web
Companion, Perth, Australia, April 3-7, 2017},
pages = {1023--1031},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3041021.3055128},
doi = {10.1145/3041021.3055128},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/www/GoncalvesFHKB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/corr/SchuppNA17,
author = {Stefan Schupp and
Johanna Nellen and
Erika {\'{A}}brah{\'{a}}m},
editor = {Herbert Wiklicky and
Erik P. de Vink},
title = {Divide and Conquer: Variable Set Separation in Hybrid Systems Reachability
Analysis},
booktitle = {Proceedings 15th Workshop on Quantitative Aspects of Programming Languages
and Systems, QAPL@ETAPS 2017, Uppsala, Sweden, 23rd April 2017},
series = {{EPTCS}},
volume = {250},
pages = {1--14},
year = {2017},
url = {https://doi.org/10.4204/EPTCS.250.1},
doi = {10.4204/EPTCS.250.1},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/SchuppNA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GivonMSOI17,
author = {Lev E. Givon and
Laura J. Mariano and
Abraham R. Schneider and
David O'Dowd and
John M. Irvine},
title = {Cognitive Subscore Trajectory Prediction in Alzheimer's Disease},
journal = {CoRR},
volume = {abs/1706.08491},
year = {2017},
url = {http://arxiv.org/abs/1706.08491},
eprinttype = {arXiv},
eprint = {1706.08491},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GivonMSOI17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GleasonVO17,
author = {Joseph D. Gleason and
Abraham P. Vinod and
Meeko M. K. Oishi},
title = {Underapproximation of Reach-Avoid Sets for Discrete-Time Stochastic
Systems via Lagrangian Methods},
journal = {CoRR},
volume = {abs/1704.03555},
year = {2017},
url = {http://arxiv.org/abs/1704.03555},
eprinttype = {arXiv},
eprint = {1704.03555},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GleasonVO17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/SmithBHH17,
author = {Abraham D. Smith and
Paul Bendich and
John Harer and
Jay Hineman},
title = {Supervised Learning of Labeled Pointcloud Differences via Cover-Tree
Entropy Reduction},
journal = {CoRR},
volume = {abs/1702.07959},
year = {2017},
url = {http://arxiv.org/abs/1702.07959},
eprinttype = {arXiv},
eprint = {1702.07959},
timestamp = {Fri, 23 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/SmithBHH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WongKLWMSHCHJWZ17,
author = {Jay Ming Wong and
Vincent Kee and
Tiffany Le and
Syler Wagner and
Gian Luca Mariottini and
Abraham Schneider and
Lei Hamilton and
Rahul Chipalkatty and
Mitchell Hebert and
David M. S. Johnson and
Jimmy Wu and
Bolei Zhou and
Antonio Torralba},
title = {SegICP: Integrated Deep Semantic Segmentation and Pose Estimation},
journal = {CoRR},
volume = {abs/1703.01661},
year = {2017},
url = {http://arxiv.org/abs/1703.01661},
eprinttype = {arXiv},
eprint = {1703.01661},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/WongKLWMSHCHJWZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/YuAWSP17,
author = {Shujian Yu and
Zubin Abraham and
Heng Wang and
Mohak Shah and
Jos{\'{e}} C. Pr{\'{\i}}ncipe},
title = {Concept Drift Detection and Adaptation with Hierarchical Hypothesis
Testing},
journal = {CoRR},
volume = {abs/1707.07821},
year = {2017},
url = {http://arxiv.org/abs/1707.07821},
eprinttype = {arXiv},
eprint = {1707.07821},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/YuAWSP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1708-07973,
author = {Bin Fu and
Fengjuan Zhu and
John Abraham},
title = {A Model for Donation Verification},
journal = {CoRR},
volume = {abs/1708.07973},
year = {2017},
url = {http://arxiv.org/abs/1708.07973},
eprinttype = {arXiv},
eprint = {1708.07973},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1708-07973.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1709-07676,
author = {Anh Nguyen{-}Duc and
Soudabeh Khodambashi and
Jon Atle Gulla and
John Krogstie and
Pekka Abrahamsson},
title = {Female Leadership in Software Projects: {A} Preliminary Result on
Leadership Style and Project Context Factors},
journal = {CoRR},
volume = {abs/1709.07676},
year = {2017},
url = {http://arxiv.org/abs/1709.07676},
eprinttype = {arXiv},
eprint = {1709.07676},
timestamp = {Tue, 30 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1709-07676.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1711-02216,
author = {Jay Ming Wong and
Syler Wagner and
Richard Connor Lawson and
Vincent Kee and
Mitchell Hebert and
Justin Rooney and
Gian Luca Mariottini and
Rebecca L. Russell and
Abraham Schneider and
Rahul Chipalkatty and
David M. S. Johnson},
title = {SegICP-DSR: Dense Semantic Scene Reconstruction and Registration},
journal = {CoRR},
volume = {abs/1711.02216},
year = {2017},
url = {http://arxiv.org/abs/1711.02216},
eprinttype = {arXiv},
eprint = {1711.02216},
timestamp = {Tue, 27 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1711-02216.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1711-08569,
author = {Christopher J. Tralie and
Abraham D. Smith and
Nathan Borggren and
Jay Hineman and
Paul Bendich and
Peter Zulch and
John Harer},
title = {Geometric Cross-Modal Comparison of Heterogeneous Sensor Data},
journal = {CoRR},
volume = {abs/1711.08569},
year = {2017},
url = {http://arxiv.org/abs/1711.08569},
eprinttype = {arXiv},
eprint = {1711.08569},
timestamp = {Fri, 23 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1711-08569.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cca/AbrahamA0BBBCDE16,
author = {Erika {\'{A}}brah{\'{a}}m and
John Abbott and
Bernd Becker and
Anna Maria Bigatti and
Martin Brain and
Bruno Buchberger and
Alessandro Cimatti and
James H. Davenport and
Matthew England and
Pascal Fontaine and
Stephen Forrest and
Alberto Griggio and
Daniel Kroening and
Werner M. Seiler and
Thomas Sturm},
title = {Satisfiability checking and symbolic computation},
journal = {{ACM} Commun. Comput. Algebra},
volume = {50},
number = {4},
pages = {145--147},
year = {2016},
url = {https://doi.org/10.1145/3055282.3055285},
doi = {10.1145/3055282.3055285},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cca/AbrahamA0BBBCDE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dss/WinklerAGE16,
author = {Matt Winkler and
Alan S. Abrahams and
Richard Gruss and
Johnathan P. Ehsani},
title = {Toy safety surveillance from online reviews},
journal = {Decis. Support Syst.},
volume = {90},
pages = {23--32},
year = {2016},
url = {https://doi.org/10.1016/j.dss.2016.06.016},
doi = {10.1016/J.DSS.2016.06.016},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dss/WinklerAGE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/ColmenarGMD16,
author = {J. Manuel Colmenar and
Peter Greistorfer and
Rafael Mart{\'{\i}} and
Abraham Duarte},
title = {Advanced Greedy Randomized Adaptive Search Procedure for the Obnoxious
p-Median problem},
journal = {Eur. J. Oper. Res.},
volume = {252},
number = {2},
pages = {432--442},
year = {2016},
url = {https://doi.org/10.1016/j.ejor.2016.01.047},
doi = {10.1016/J.EJOR.2016.01.047},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/ColmenarGMD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icae/PrietoBTD16,
author = {Abraham Prieto and
Francisco Bellas and
Pedro Trueba and
Richard J. Duro},
title = {Real-time optimization of dynamic problems through distributed Embodied
Evolution},
journal = {Integr. Comput. Aided Eng.},
volume = {23},
number = {3},
pages = {237--253},
year = {2016},
url = {https://doi.org/10.3233/ICA-160522},
doi = {10.3233/ICA-160522},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/icae/PrietoBTD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhis/LorancaRVALZGD16,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Jorge A. Ruiz{-}Vanoye and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mart{\'{\i}}n Estrada Analco and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Alberto Ochoa{-}Zezzatti and
Gerardo {Mart{\'{\i}}nez Guzman} and
Mario Bustillo D{\'{\i}}az},
title = {An approximation method for the P-median problem: {A} bioinspired
tabu search and variable neighborhood search partitioning approach},
journal = {Int. J. Hybrid Intell. Syst.},
volume = {13},
number = {2},
pages = {87--98},
year = {2016},
url = {https://doi.org/10.3233/HIS-160227},
doi = {10.3233/HIS-160227},
timestamp = {Fri, 03 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhis/LorancaRVALZGD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/integration/Gonzalez-DiazSM16,
author = {Victor R. Gonzalez{-}Diaz and
Luis Abraham S{\'{a}}nchez{-}Gaspariano and
Carlos Mu{\~{n}}iz{-}Montero and
Jose J. Alvarado{-}Pulido},
title = {Improving linearity in {MOS} varactor based VCOs by means of the output
quiescent bias point},
journal = {Integr.},
volume = {55},
pages = {274--280},
year = {2016},
url = {https://doi.org/10.1016/j.vlsi.2016.08.003},
doi = {10.1016/J.VLSI.2016.08.003},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/integration/Gonzalez-DiazSM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isf/NellenDNAW16,
author = {Johanna Nellen and
Kai Driessen and
Martin R. Neuh{\"{a}}u{\ss}er and
Erika {\'{A}}brah{\'{a}}m and
Benedikt Wolters},
title = {Two CEGAR-based approaches for the safety verification of PLC-controlled
plants},
journal = {Inf. Syst. Frontiers},
volume = {18},
number = {5},
pages = {927--952},
year = {2016},
url = {https://doi.org/10.1007/s10796-016-9671-9},
doi = {10.1007/S10796-016-9671-9},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isf/NellenDNAW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/AbrahamKBLAPP16,
author = {Joanna Abraham and
Thomas George Kannampallil and
Corinne Brenner and
Karen Dunn Lopez and
Khalid F. Almoosa and
Bela Patel and
Vimla L. Patel},
title = {Characterizing the structure and content of nurse handoffs: {A} Sequential
Conversational Analysis approach},
journal = {J. Biomed. Informatics},
volume = {59},
pages = {76--88},
year = {2016},
url = {https://doi.org/10.1016/j.jbi.2015.11.009},
doi = {10.1016/J.JBI.2015.11.009},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/AbrahamKBLAPP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/KannampallilAP16,
author = {Thomas George Kannampallil and
Joanna Abraham and
Vimla L. Patel},
title = {Methodological framework for evaluating clinical processes: {A} cognitive
informatics perspective},
journal = {J. Biomed. Informatics},
volume = {64},
pages = {342--351},
year = {2016},
url = {https://doi.org/10.1016/j.jbi.2016.11.002},
doi = {10.1016/J.JBI.2016.11.002},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/KannampallilAP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jccee/MostafaviADSKQ16,
author = {Ali Mostafavi and
Dulcy M. Abraham and
Daniel DeLaurentis and
Joseph Sinfield and
Amr Kandil and
Cesar Queiroz},
title = {Agent-Based Simulation Model for Assessment of Financing Scenarios
in Highway Transportation Infrastructure Systems},
journal = {J. Comput. Civ. Eng.},
volume = {30},
number = {2},
year = {2016},
url = {https://doi.org/10.1061/(asce)cp.1943-5487.0000482},
doi = {10.1061/(ASCE)CP.1943-5487.0000482},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jccee/MostafaviADSKQ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmrr/PoortenTDGDSSFR16,
author = {Emmanuel B. Vander Poorten and
Phuong Toan Tran and
Alain Devreker and
Caspar Gruijthuijsen and
Sergio Portol{\'{e}}s Diez and
Gabrijel Smoljkic and
Vule Strbac and
Nele Famaey and
Dominiek Reynaerts and
Jos Vander Sloten and
Abraham Temesgen Tibebu and
Bingbin Yu and
Christian Rauch and
Felix Bernard and
Yohannes Kassahun and
Jan Hendrik Metzen and
Stamatia Giannarou and
Liang Zhao and
Su{-}Lin Lee and
Guang{-}Zhong Yang and
Evangelos B. Mazomenos and
Ping{-}Lin Chang and
Danail Stoyanov and
Maryna Kvasnytsia and
Joris Van Deun and
Eva Verhoelst and
Mauro M. Sette and
Anita Di Iasio and
Giovanni Leo and
Fabian Hertner and
Daniel Scherly and
Leandro Chelini and
Nicolai H{\"{a}}ni and
Dejan Seatovic and
Beno{\^{\i}}t Rosa and
Herbert De Praetere and
Paul Herijgers},
title = {Cognitive AutonomouS CAtheters Operating in Dynamic Environments},
journal = {J. Medical Robotics Res.},
volume = {1},
number = {3},
pages = {1640011:1--1640011:25},
year = {2016},
url = {https://doi.org/10.1142/S2424905X16400110},
doi = {10.1142/S2424905X16400110},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmrr/PoortenTDGDSSFR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/SimianuGJLEAAFF16,
author = {Vlad V. Simianu and
Margaret A. Grounds and
Susan L. Joslyn and
Jared E. LeClerc and
Anne P. Ehlers and
Nidhi Agrawal and
Rafael Alfonso{-}Cristancho and
Abraham D. Flaxman and
David R. Flum},
title = {Understanding clinical and non-clinical decisions under uncertainty:
a scenario-based survey},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {16},
pages = {153:1--153:9},
year = {2016},
url = {https://doi.org/10.1186/s12911-016-0391-3},
doi = {10.1186/S12911-016-0391-3},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/SimianuGJLEAAFF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ChisangaKPAKBMS16,
author = {David Chisanga and
Shivakumar Keerthikumar and
Mohashin Pathan and
Dinuka Ariyaratne and
Hina Kalra and
Stephanie Boukouris and
Nidhi Abraham Mathew and
Haidar Al Saffar and
Lahiru Gangoda and
Ching{-}Seng Ang and
Oliver M. Sieber and
John M. Mariadason and
Ramanuj Dasgupta and
Naveen K. Chilamkurti and
Suresh Mathivanan},
title = {Colorectal cancer atlas: An integrative resource for genomic and proteomic
annotations from colorectal cancer cell lines and tissues},
journal = {Nucleic Acids Res.},
volume = {44},
number = {Database-Issue},
pages = {969--974},
year = {2016},
url = {https://doi.org/10.1093/nar/gkv1097},
doi = {10.1093/NAR/GKV1097},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/ChisangaKPAKBMS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/KayserTAAASWBW16,
author = {J{\"{u}}rgen Kayser and
Craig E. Tenke and
Karen S. Abraham and
Daniel M. Alschuler and
Jorge E. Alvarenga and
Jamie Skipper and
Virginia Warner and
Gerard E. Bruder and
Myrna M. Weissman},
title = {Neuronal generator patterns at scalp elicited by lateralized aversive
pictures reveal consecutive stages of motivated attention},
journal = {NeuroImage},
volume = {142},
pages = {337--350},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2016.05.059},
doi = {10.1016/J.NEUROIMAGE.2016.05.059},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/KayserTAAASWBW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/LevyGZWSEF16,
author = {Jonathan Levy and
Abraham Goldstein and
Orna Zagoory{-}Sharon and
Omri Weisman and
Inna Schneiderman and
Moranne Eidelman{-}Rothman and
Ruth Feldman},
title = {Oxytocin selectively modulates brain response to stimuli probing social
synchrony},
journal = {NeuroImage},
volume = {124},
pages = {923--930},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2015.09.066},
doi = {10.1016/J.NEUROIMAGE.2015.09.066},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/LevyGZWSEF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/MilchenkoSLSBFM16,
author = {Mikhail Milchenko and
Abraham Z. Snyder and
Pamela LaMontagne and
Joshua S. Shimony and
Tammie L. S. Benzinger and
Sarah Jost Fouke and
Daniel S. Marcus},
title = {Heterogeneous Optimization Framework: Reproducible Preprocessing of
Multi-Spectral Clinical {MRI} for Neuro-Oncology Imaging Research},
journal = {Neuroinformatics},
volume = {14},
number = {3},
pages = {305--317},
year = {2016},
url = {https://doi.org/10.1007/s12021-016-9296-7},
doi = {10.1007/S12021-016-9296-7},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ni/MilchenkoSLSBFM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/TianLDJPKG16,
author = {Jianhui Tian and
Cesar A. L{\'{o}}pez and
Cynthia A. Derdeyn and
Morris S. Jones and
Abraham Pinter and
Bette T. Korber and
S. Gnanakaran},
title = {Effect of Glycosylation on an Immunodominant Region in the {V1V2}
Variable Domain of the {HIV-1} Envelope gp120 Protein},
journal = {PLoS Comput. Biol.},
volume = {12},
number = {10},
year = {2016},
url = {https://doi.org/10.1371/journal.pcbi.1005094},
doi = {10.1371/JOURNAL.PCBI.1005094},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/TianLDJPKG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/LopezMMM16,
author = {Abraham S{\'{a}}nchez L{\'{o}}pez and
Martin Garcia M. and
Miguel Angel Jara Maldonado and
Jos{\'{e}} Luis Estrada Mart{\'{\i}}nez},
title = {Un videojuego educativo basado en la optimizaci{\'{o}}n con colonia
de hormigas},
journal = {Res. Comput. Sci.},
volume = {116},
pages = {9--21},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_116/Un\%20videojuego\%20educativo\%20basado\%20en\%20la\%20optimizacion\%20con\%20colonia\%20de\%20hormigas.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/LopezMMM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/LorancaVDASSL16,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mario Bustillo D{\'{\i}}az and
Mart{\'{\i}}n Estrada Analco and
Jorge Cerezo S{\'{a}}nchez and
Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Abraham S{\'{a}}nchez L{\'{o}}pez},
title = {Methodology for Location-Allocation Problem},
journal = {Res. Comput. Sci.},
volume = {123},
pages = {91--98},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_123/Methodology\%20for\%20Location-Allocation\%20Problem.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/LorancaVDASSL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/MontoyaLVFSFS16,
author = {Mauricio Romero Montoya and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Jos{\'{e}} Luis Mart{\'{\i}}nez Flores and
Horacio Bautista Santos and
Abraham S{\'{a}}nchez Flores and
Francisco Macias Santiesteban},
title = {A Solution Proposal for the Capacitated P-Median Problem with Tabu
Search},
journal = {Res. Comput. Sci.},
volume = {121},
pages = {59--67},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_121/A\%20Solution\%20Proposal\%20for\%20the\%20Capacitated\%20P-Median\%20Problem\%20with\%20Tabu\%20Search.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/MontoyaLVFSFS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/re/HidalgaHJ16,
author = {Abraham Nieva de la Hidalga and
Alex R. Hardisty and
Andrew C. Jones},
title = {{SCRAM-CK:} applying a collaborative requirements engineering process
for designing a web based e-science toolkit},
journal = {Requir. Eng.},
volume = {21},
number = {1},
pages = {107--129},
year = {2016},
url = {https://doi.org/10.1007/s00766-014-0212-0},
doi = {10.1007/S00766-014-0212-0},
timestamp = {Tue, 04 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/re/HidalgaHJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sas/AbrahamMDLSD16,
author = {Vian Abraham and
Yasameen Al Mharib and
Brian Donnel and
Xiaobin Le and
Joseph Santacroce and
Douglas E. Dow},
title = {Automatic Regulator for Supplemental Oxygen Therapy},
journal = {{EAI} Endorsed Trans. Self Adapt. Syst.},
volume = {2},
number = {6},
pages = {e4},
year = {2016},
url = {https://doi.org/10.4108/eai.3-12-2015.2262526},
doi = {10.4108/EAI.3-12-2015.2262526},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sas/AbrahamMDLSD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simpra/JohnWBAV16,
author = {M. R. Stalin John and
A. Welsoon Wilson and
A. Prasad Bhardwaj and
Avinav Abraham and
B. K. Vinayagam},
title = {An investigation of ball burnishing process on {CNC} lathe using finite
element analysis},
journal = {Simul. Model. Pract. Theory},
volume = {62},
pages = {88--101},
year = {2016},
url = {https://doi.org/10.1016/j.simpat.2016.01.004},
doi = {10.1016/J.SIMPAT.2016.01.004},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/simpra/JohnWBAV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/winet/PonnuswamyFD16,
author = {Vijayalakshmi Ponnuswamy and
Sharmila Anand John Francis and
J. Abraham Dinakaran},
title = {A robust energy efficient ant colony optimization routing algorithm
for multi-hop ad hoc networks in MANETs},
journal = {Wirel. Networks},
volume = {22},
number = {6},
pages = {2081--2100},
year = {2016},
url = {https://doi.org/10.1007/s11276-015-1082-1},
doi = {10.1007/S11276-015-1082-1},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/winet/PonnuswamyFD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/alife/DuroBPT16,
author = {Richard J. Duro and
Francisco Bellas and
Abraham Prieto and
Pedro Trueba},
editor = {Tom Froese and
Jes{\'{u}}s Mario Siqueiros{-}Garc{\'{\i}}a and
Wendy Aguilar and
Eduardo J. Izquierdo and
Hiroki Sayama and
Carlos Gershenson},
title = {How Complexity Pervades Specialization in Canonical Embodied Evolution},
booktitle = {Fifteenth International Conference on the Simulation and Synthesis
of Living Systems, {ALIFE} 2016, Cancun, Mexico, July 4-6, 2016},
pages = {123--130},
publisher = {{MIT} Press},
year = {2016},
url = {https://doi.org/10.7551/978-0-262-33936-0-ch026},
doi = {10.7551/978-0-262-33936-0-CH026},
timestamp = {Thu, 20 Jun 2024 22:18:45 +0200},
biburl = {https://dblp.org/rec/conf/alife/DuroBPT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/SrinivasanKCA16,
author = {Vignesh Srinivasan and
Thomas George Kannampallil and
Trevor Cohen and
Joanna Abraham},
title = {Analyzing Similarities in Handoff Communication Content between Residents
and Nurses},
booktitle = {{AMIA} 2016, American Medical Informatics Association Annual Symposium,
Chicago, IL, USA, November 12-16, 2016},
publisher = {{AMIA}},
year = {2016},
url = {https://knowledge.amia.org/amia-63300-1.3360278/t005-1.3362920/f005-1.3362921/2495235-1.3363167/2499972-1.3363162},
timestamp = {Wed, 17 Apr 2024 11:47:32 +0200},
biburl = {https://dblp.org/rec/conf/amia/SrinivasanKCA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blizzard/LouwMG16,
author = {Johannes A. Louw and
Avashlin Moodley and
Avashna Govender},
title = {The Speect text-to-speech entry for the Blizzard Challenge 2016},
booktitle = {The Blizzard Challenge 2016, Cuppertino, CA, USA, September 16, 2016},
publisher = {{ISCA}},
year = {2016},
url = {https://doi.org/10.21437/Blizzard.2016-9},
doi = {10.21437/BLIZZARD.2016-9},
timestamp = {Wed, 25 Sep 2024 11:16:38 +0200},
biburl = {https://dblp.org/rec/conf/blizzard/LouwMG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/GleasonVOE16,
author = {Joseph D. Gleason and
Abraham P. Vinod and
Meeko M. K. Oishi and
Richard Scott Erwin},
title = {Viable set approximation for linear-Gaussian systems with unknown,
bounded variance},
booktitle = {55th {IEEE} Conference on Decision and Control, {CDC} 2016, Las Vegas,
NV, USA, December 12-14, 2016},
pages = {7049--7055},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/CDC.2016.7799355},
doi = {10.1109/CDC.2016.7799355},
timestamp = {Fri, 04 Mar 2022 13:29:43 +0100},
biburl = {https://dblp.org/rec/conf/cdc/GleasonVOE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/JosephEABC16,
author = {Ebenezer Joseph and
Veena Easvaradoss and
Suneera Abraham and
Michael Brazil and
David Chandran},
editor = {Anna Papafragou and
Daniel Grodner and
Daniel Mirman and
John C. Trueswell},
title = {Enhancing Creativity in Children by Imparting Chess Training},
booktitle = {Proceedings of the 38th Annual Meeting of the Cognitive Science Society,
Recognizing and Representing Events, CogSci 2016, Philadelphia, PA,
USA, August 10-13, 2016},
publisher = {cognitivesciencesociety.org},
year = {2016},
url = {https://mindmodeling.org/cogsci2016/papers/0688/index.html},
timestamp = {Thu, 18 Apr 2024 13:03:08 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/JosephEABC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Rodriguez-MotaE16,
author = {Abraham Rodriguez{-}Mota and
Ponciano Jorge Escamilla{-}Ambrosio and
Salvador Morales{-}Ortega and
Mois{\'{e}}s Salinas{-}Rosales and
Eleazar Aguirre Anaya},
title = {Towards a 2-hybrid Android malware detection test framework},
booktitle = {2016 International Conference on Electronics, Communications and Computers,
{CONIELECOMP} 2016, Cholula, Mexico, February 24-26, 2016},
pages = {54--61},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/CONIELECOMP.2016.7438552},
doi = {10.1109/CONIELECOMP.2016.7438552},
timestamp = {Thu, 20 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/conielecomp/Rodriguez-MotaE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/GordilloMA16,
author = {Christian Arcos Gordillo and
Jos{\'{e}} Roberto Boisson de Marca and
Abraham Alcaim},
title = {Median filtering the temporal probability distribution in histogram
mapping for robust continuous speech recognition},
booktitle = {24th European Signal Processing Conference, {EUSIPCO} 2016, Budapest,
Hungary, August 29 - September 2, 2016},
pages = {1198--1201},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/EUSIPCO.2016.7760438},
doi = {10.1109/EUSIPCO.2016.7760438},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/GordilloMA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/WolperA16,
author = {Joshuah Wolper and
George Abraham},
editor = {Tobias Friedrich and
Frank Neumann and
Andrew M. Sutton},
title = {Evolving Novel Cellular Automaton Seeds Using Compositional Pattern
Producing Networks {(CPPN)}},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver,
CO, USA, July 20-24, 2016, Companion Material Proceedings},
pages = {27--28},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2908961.2908964},
doi = {10.1145/2908961.2908964},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/WolperA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/healthcom/GraberMZBKSKD16,
author = {Felix Gr{\"{a}}{\ss}er and
Hagen Malberg and
Sebastian Zaunseder and
Stefanie Beckert and
Denise K{\"{u}}ster and
Jochen Schmitt and
Susanne Abraham},
title = {Application of recommender system methods for therapy decision support},
booktitle = {18th {IEEE} International Conference on e-Health Networking, Applications
and Services, Healthcom 2016, Munich, Germany, September 14-16, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/HealthCom.2016.7749495},
doi = {10.1109/HEALTHCOM.2016.7749495},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/healthcom/GraberMZBKSKD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/huc/FastnachtAMFZH16,
author = {Till Fastnacht and
Abraham Ornelas Aispuro and
Johannes Marschall and
Patrick Tobias Fischer and
Sabine Zierold and
Eva Hornecker},
editor = {Paul Lukowicz and
Antonio Kr{\"{u}}ger and
Andreas Bulling and
Youn{-}Kyung Lim and
Shwetak N. Patel},
title = {Sonnengarten: urban light installation with human-plant interaction},
booktitle = {Proceedings of the 2016 {ACM} International Joint Conference on Pervasive
and Ubiquitous Computing and Proceedings of the 2016 {ACM} International
Symposium on Wearable Computers, UbiComp/ISWC Adjunct 2016, Heidelberg,
Germany, September 12-16, 2016},
pages = {53--56},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2968219.2971423},
doi = {10.1145/2968219.2971423},
timestamp = {Tue, 26 Mar 2024 12:15:04 +0100},
biburl = {https://dblp.org/rec/conf/huc/FastnachtAMFZH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/VazquezC16,
author = {Eli Abraham Vazquez and
Joaquin Collado},
title = {Monodromy operator approximation of periodic delay differential equations
by Walsh functions},
booktitle = {13th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2016, Mexico City, Mexico, September
26-30, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICEEE.2016.7751222},
doi = {10.1109/ICEEE.2016.7751222},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/iceee/VazquezC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icost/ForchukRMBH16,
author = {Cheryl Forchuk and
Abraham Rudnick and
Josephine MacIntosh and
Fatima Bukair and
Jeffrey S. Hoch},
editor = {Carl K. Chang and
Lorenzo Chiari and
Yu Cao and
Hai Jin and
Mounir Mokhtari and
Hamdi Aloulou},
title = {Evaluation Framework for Smart Technology Mental Health Interventions},
booktitle = {Inclusive Smart Cities and Digital Health - 14th International Conference
on Smart Homes and Health Telematics, {ICOST} 2016, Wuhan, China,
May 25-27, 2016. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9677},
pages = {203--210},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-39601-9\_18},
doi = {10.1007/978-3-319-39601-9\_18},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icost/ForchukRMBH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/DeianaSMGA16,
author = {Federico Deiana and
Alessandro Serpi and
Ignazio Marongiu and
Gianluca Gatto and
Johan Abrahamsson},
title = {Efficiency assessment of permanent magnet synchronous machines for
High-Speed Flywheel Energy Storage Systems},
booktitle = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
Society, Florence, Italy, October 23-26, 2016},
pages = {4269--4274},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IECON.2016.7793981},
doi = {10.1109/IECON.2016.7793981},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/DeianaSMGA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MarquezLVF16,
author = {Abraham Marquez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Variable-angle interleaved {DC-DC} converters},
booktitle = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
Society, Florence, Italy, October 23-26, 2016},
pages = {3635--3639},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IECON.2016.7794028},
doi = {10.1109/IECON.2016.7794028},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/MarquezLVF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/NolandEPAL16,
author = {Jonas Kristiansen Noland and
Fredrik Evestedt and
J. Jose Perez{-}Loya and
Johan Abrahamsson and
Urban Lundin},
title = {Evaluation of different power electronic interfaces for control of
a rotating brushless {PM} exciter},
booktitle = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
Society, Florence, Italy, October 23-26, 2016},
pages = {1924--1929},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IECON.2016.7794011},
doi = {10.1109/IECON.2016.7794011},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/NolandEPAL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/AbrahamUJ16,
author = {Basil Abraham and
Srinivasan Umesh and
Neethu Mariam Joy},
editor = {Nelson Morgan},
title = {Articulatory Feature Extraction Using {CTC} to Build Articulatory
Classifiers Without Forced Frame Alignments for Speech Recognition},
booktitle = {17th Annual Conference of the International Speech Communication Association,
Interspeech 2016, San Francisco, CA, USA, September 8-12, 2016},
pages = {798--802},
publisher = {{ISCA}},
year = {2016},
url = {https://doi.org/10.21437/Interspeech.2016-925},
doi = {10.21437/INTERSPEECH.2016-925},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/AbrahamUJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/AbrahamUJ16a,
author = {Basil Abraham and
Srinivasan Umesh and
Neethu Mariam Joy},
editor = {Nelson Morgan},
title = {Overcoming Data Sparsity in Acoustic Modeling of Low-Resource Language
by Borrowing Data and Model Parameters from High-Resource Languages},
booktitle = {17th Annual Conference of the International Speech Communication Association,
Interspeech 2016, San Francisco, CA, USA, September 8-12, 2016},
pages = {3037--3041},
publisher = {{ISCA}},
year = {2016},
url = {https://doi.org/10.21437/Interspeech.2016-963},
doi = {10.21437/INTERSPEECH.2016-963},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/interspeech/AbrahamUJ16a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/JoyBUA16,
author = {Neethu Mariam Joy and
Murali Karthick Baskar and
Srinivasan Umesh and
Basil Abraham},
editor = {Nelson Morgan},
title = {DNNs for Unsupervised Extraction of Pseudo {FMLLR} Features Without
Explicit Adaptation Data},
booktitle = {17th Annual Conference of the International Speech Communication Association,
Interspeech 2016, San Francisco, CA, USA, September 8-12, 2016},
pages = {3479--3483},
publisher = {{ISCA}},
year = {2016},
url = {https://doi.org/10.21437/Interspeech.2016-904},
doi = {10.21437/INTERSPEECH.2016-904},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/interspeech/JoyBUA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WoubieLH16,
author = {Abraham Woubie and
Jordi Luque and
Javier Hernando},
editor = {Nelson Morgan},
title = {Improving i-Vector and {PLDA} Based Speaker Clustering with Long-Term
Features},
booktitle = {17th Annual Conference of the International Speech Communication Association,
Interspeech 2016, San Francisco, CA, USA, September 8-12, 2016},
pages = {372--376},
publisher = {{ISCA}},
year = {2016},
url = {https://doi.org/10.21437/Interspeech.2016-339},
doi = {10.21437/INTERSPEECH.2016-339},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/interspeech/WoubieLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/latincom/Coronado-De-Alba16,
author = {Lilian D. Coronado{-}De{-}Alba and
Abraham Rodriguez{-}Mota and
Ponciano Jorge Escamilla{-}Ambrosio},
title = {Feature selection and ensemble of classifiers for Android malware
detection},
booktitle = {8th {IEEE} Latin-American Conference on Communications, {LATINCOM}
2016, Medellin, Colombia, November 15-17, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/LATINCOM.2016.7811605},
doi = {10.1109/LATINCOM.2016.7811605},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/latincom/Coronado-De-Alba16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/latincom/Rodriguez-MotaE16,
author = {Abraham Rodriguez{-}Mota and
Ponciano Jorge Escamilla{-}Ambrosio and
Jassim Happa and
Jason R. C. Nurse},
title = {Towards IoT cybersecurity modeling: From malware analysis data to
IoT system representation},
booktitle = {8th {IEEE} Latin-American Conference on Communications, {LATINCOM}
2016, Medellin, Colombia, November 15-17, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/LATINCOM.2016.7811597},
doi = {10.1109/LATINCOM.2016.7811597},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/latincom/Rodriguez-MotaE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/malware/Morales-OrtegaE16,
author = {Salvador Morales{-}Ortega and
Ponciano Jorge Escamilla{-}Ambrosio and
Abraham Rodriguez{-}Mota and
Lilian D. Coronado{-}De{-}Alba},
title = {Native malware detection in smartphones with android {OS} using static
analysis, feature selection and ensemble classifiers},
booktitle = {11th International Conference on Malicious and Unwanted Software,
{MALWARE} 2016, Fajardo, PR, USA, October 18-21, 2016},
pages = {67--74},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/MALWARE.2016.7888731},
doi = {10.1109/MALWARE.2016.7888731},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/malware/Morales-OrtegaE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mbmv/DehnertJ0CVKAB16,
author = {Christian Dehnert and
Sebastian Junges and
Nils Jansen and
Florian Corzilius and
Matthias Volk and
Joost{-}Pieter Katoen and
Erika {\'{A}}brah{\'{a}}m and
Harold Bruintjes},
editor = {Ralf Wimmer},
title = {Parameter Synthesis for Probabilistic Systems},
booktitle = {19th {GI/ITG/GMM} Workshop Methoden und Beschreibungssprachen zur
Modellierung und Verifikation von Schaltungen und Systemen, {MBMV}
2016, Freiburg im Breisgau, Germany, March 1-2, 2016},
pages = {72--74},
publisher = {Albert-Ludwigs-Universit{\"{a}}t Freiburg},
year = {2016},
url = {https://doi.org/10.6094/UNIFR/10639},
doi = {10.6094/UNIFR/10639},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mbmv/DehnertJ0CVKAB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mkm/AbrahamABBBBCDE16,
author = {Erika {\'{A}}brah{\'{a}}m and
John Abbott and
Bernd Becker and
Anna Maria Bigatti and
Martin Brain and
Bruno Buchberger and
Alessandro Cimatti and
James H. Davenport and
Matthew England and
Pascal Fontaine and
Stephen Forrest and
Alberto Griggio and
Daniel Kroening and
Werner M. Seiler and
Thomas Sturm},
editor = {Michael Kohlhase and
Moa Johansson and
Bruce R. Miller and
Leonardo de Moura and
Frank Wm. Tompa},
title = {SC\({}^{\mbox{2}}\): Satisfiability Checking Meets Symbolic Computation
- (Project Paper)},
booktitle = {Intelligent Computer Mathematics - 9th International Conference, {CICM}
2016, Bialystok, Poland, July 25-29, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9791},
pages = {28--43},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-42547-4\_3},
doi = {10.1007/978-3-319-42547-4\_3},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mkm/AbrahamABBBBCDE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/odyssey/ZewoudieLH15,
author = {Abraham Woubie Zewoudie and
Jordi Luque and
Javier Hernando},
editor = {Luis Javier Rodr{\'{\i}}guez{-}Fuentes and
Eduardo Lleida},
title = {Short- and Long-Term Speech Features for Hybrid HMM-i-Vector based
Speaker Diarization System},
booktitle = {Odyssey 2016: The Speaker and Language Recognition Workshop, Bilbao,
Spain, June 21-24, 2016},
pages = {400--406},
publisher = {{ISCA}},
year = {2016},
url = {https://doi.org/10.21437/Odyssey.2016-58},
doi = {10.21437/ODYSSEY.2016-58},
timestamp = {Tue, 30 Jul 2024 09:34:38 +0200},
biburl = {https://dblp.org/rec/conf/odyssey/ZewoudieLH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/GoldbergKM16,
author = {Logan Goldberg and
Joel Katticaran and
Abraham Mhaidli},
editor = {Eelco Visser},
title = {Energy profiling with Alpaca},
booktitle = {Companion Proceedings of the 2016 {ACM} {SIGPLAN} International Conference
on Systems, Programming, Languages and Applications: Software for
Humanity, {SPLASH} 2016, Amsterdam, Netherlands, October 30 - November
4, 2016},
pages = {69--70},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2984043.2998548},
doi = {10.1145/2984043.2998548},
timestamp = {Tue, 06 Nov 2018 16:57:15 +0100},
biburl = {https://dblp.org/rec/conf/oopsla/GoldbergKM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/setta/AbrahamCJKM16,
author = {Erika {\'{A}}brah{\'{a}}m and
Florian Corzilius and
Einar Broch Johnsen and
Gereon Kremer and
Jacopo Mauro},
editor = {Martin Fr{\"{a}}nzle and
Deepak Kapur and
Naijun Zhan},
title = {Zephyrus2: On the Fly Deployment Optimization Using {SMT} and {CP}
Technologies},
booktitle = {Dependable Software Engineering: Theories, Tools, and Applications
- Second International Symposium, {SETTA} 2016, Beijing, China, November
9-11, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9984},
pages = {229--245},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-47677-3\_15},
doi = {10.1007/978-3-319-47677-3\_15},
timestamp = {Tue, 21 Mar 2023 20:59:17 +0100},
biburl = {https://dblp.org/rec/conf/setta/AbrahamCJKM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/KwanF16,
author = {Jonathan C. Kwan and
Abraham O. Fapojuwo},
title = {Measurement and Analysis of Available Ambient Radio Frequency Energy
for Wireless Energy Harvesting},
booktitle = {{IEEE} 84th Vehicular Technology Conference, {VTC} Fall 2016, Montreal,
QC, Canada, September 18-21, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/VTCFall.2016.7881084},
doi = {10.1109/VTCFALL.2016.7881084},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/vtc/KwanF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/birthday/2016deboer,
editor = {Erika {\'{A}}brah{\'{a}}m and
Marcello M. Bonsangue and
Einar Broch Johnsen},
title = {Theory and Practice of Formal Methods - Essays Dedicated to Frank
de Boer on the Occasion of His 60th Birthday},
series = {Lecture Notes in Computer Science},
volume = {9660},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-30734-3},
doi = {10.1007/978-3-319-30734-3},
isbn = {978-3-319-30733-6},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/birthday/2016deboer.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AbrahamABBBBCDE16,
author = {Erika {\'{A}}brah{\'{a}}m and
John Abbott and
Bernd Becker and
Anna Maria Bigatti and
Martin Brain and
Bruno Buchberger and
Alessandro Cimatti and
James H. Davenport and
Matthew England and
Pascal Fontaine and
Stephen Forrest and
Alberto Griggio and
Daniel Kroening and
Werner M. Seiler and
Thomas Sturm},
title = {Satisfiability Checking and Symbolic Computation},
journal = {CoRR},
volume = {abs/1607.06945},
year = {2016},
url = {http://arxiv.org/abs/1607.06945},
eprinttype = {arXiv},
eprint = {1607.06945},
timestamp = {Mon, 31 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/AbrahamABBBBCDE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AbrahamABBBBCDE16a,
author = {Erika {\'{A}}brah{\'{a}}m and
John Abbott and
Bernd Becker and
Anna Maria Bigatti and
Martin Brain and
Bruno Buchberger and
Alessandro Cimatti and
James H. Davenport and
Matthew England and
Pascal Fontaine and
Stephen Forrest and
Alberto Griggio and
Daniel Kroening and
Werner M. Seiler and
Thomas Sturm},
title = {Satisfiability Checking meets Symbolic Computation (Project Paper)},
journal = {CoRR},
volume = {abs/1607.08028},
year = {2016},
url = {http://arxiv.org/abs/1607.08028},
eprinttype = {arXiv},
eprint = {1607.08028},
timestamp = {Mon, 31 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/AbrahamABBBBCDE16a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JonesKTFF16,
author = {Corinne L. Jones and
Sham M. Kakade and
Lucas W. Thornblade and
David R. Flum and
Abraham D. Flaxman},
title = {Canonical Correlation Analysis for Analyzing Sequences of Medical
Billing Codes},
journal = {CoRR},
volume = {abs/1612.00516},
year = {2016},
url = {http://arxiv.org/abs/1612.00516},
eprinttype = {arXiv},
eprint = {1612.00516},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/JonesKTFF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1305-5055,
author = {Ralf Wimmer and
Nils Jansen and
Andreas Vorpahl and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen and
Bernd Becker},
title = {High-level Counterexamples for Probabilistic Automata},
journal = {Log. Methods Comput. Sci.},
volume = {11},
number = {1},
year = {2015},
url = {https://doi.org/10.2168/LMCS-11(1:15)2015},
doi = {10.2168/LMCS-11(1:15)2015},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1305-5055.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/PrietoBTD15,
author = {Abraham Prieto and
Francisco Bellas and
Pedro Trueba and
Richard J. Duro},
title = {Towards the standardization of distributed Embodied Evolution},
journal = {Inf. Sci.},
volume = {312},
pages = {55--77},
year = {2015},
url = {https://doi.org/10.1016/j.ins.2015.03.044},
doi = {10.1016/J.INS.2015.03.044},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/PrietoBTD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/japll/HerreroSAZBQCSC15,
author = {{\'{A}}lvaro Herrero and
V{\'{a}}clav Sn{\'{a}}sel and
Ajith Abraham and
Ivan Zelinka and
Bruno Baruque and
H{\'{e}}ctor Quinti{\'{a}}n and
Jos{\'{e}} Lu{\'{\i}}s Calvo{-}Rolle and
Javier Sedano and
Andr{\'{e}} C. P. L. F. de Carvalho and
Emilio Corchado},
title = {Special issue {SOCO12}},
journal = {J. Appl. Log.},
volume = {13},
number = {2},
pages = {91--93},
year = {2015},
url = {https://doi.org/10.1016/j.jal.2014.11.002},
doi = {10.1016/J.JAL.2014.11.002},
timestamp = {Fri, 12 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/japll/HerreroSAZBQCSC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgo/DuartePPM15,
author = {Abraham Duarte and
Juan Jos{\'{e}} Pantrigo and
Eduardo G. Pardo and
Nenad Mladenovic},
title = {Multi-objective variable neighborhood search: an application to combinatorial
optimization problems},
journal = {J. Glob. Optim.},
volume = {63},
number = {3},
pages = {515--536},
year = {2015},
url = {https://doi.org/10.1007/s10898-014-0213-z},
doi = {10.1007/S10898-014-0213-Z},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jgo/DuartePPM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jolpe/AbrahamJM15,
author = {Chikku Abraham and
Babita Roslind Jose and
Jimson Mathew},
title = {A Multiple Input Variable Output Switched Capacitor {DC-DC} Converter
for Harnessing Renewable Energy and Powering LEDs},
journal = {J. Low Power Electron.},
volume = {11},
number = {3},
pages = {444--454},
year = {2015},
url = {https://doi.org/10.1166/jolpe.2015.1392},
doi = {10.1166/JOLPE.2015.1392},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jolpe/AbrahamJM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BrierMMAS15,
author = {Matthew R. Brier and
Anish Mitra and
John E. McCarthy and
Beau M. Ances and
Abraham Z. Snyder},
title = {Partial covariance based functional connectivity computation using
Ledoit-Wolf covariance regularization},
journal = {NeuroImage},
volume = {121},
pages = {29--38},
year = {2015},
url = {https://doi.org/10.1016/j.neuroimage.2015.07.039},
doi = {10.1016/J.NEUROIMAGE.2015.07.039},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BrierMMAS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SuBSRMABCACCFHF15,
author = {Yi Su and
Tyler M. Blazey and
Abraham Z. Snyder and
Marcus E. Raichle and
Daniel S. Marcus and
Beau M. Ances and
Randall J. Bateman and
Nigel J. Cairns and
Patricia Aldea and
Lisa Cash and
Jon J. Christensen and
Karl Friedrichsen and
Russ C. Hornbeck and
Angela M. Farrar and
Christopher J. Owen and
Richard P. Mayeux and
Adam M. Brickman and
William E. Klunk and
Julie C. Price and
Paul M. Thompson and
Bernardino Ghetti and
Andrew J. Saykin and
Reisa A. Sperling and
Keith A. Johnson and
Peter R. Schofield and
Virginia Buckles and
John C. Morris and
Tammie L. S. Benzinger},
title = {Partial volume correction in quantitative amyloid imaging},
journal = {NeuroImage},
volume = {107},
pages = {55--64},
year = {2015},
url = {https://doi.org/10.1016/j.neuroimage.2014.11.058},
doi = {10.1016/J.NEUROIMAGE.2014.11.058},
timestamp = {Wed, 02 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/SuBSRMABCACCFHF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/LinNSAT15,
author = {Lexin Lin and
Anders Nilsson and
Johan Sj{\"{o}}lin and
Marcus Abrahamsson and
Henrik Tehler},
title = {On the perceived usefulness of risk descriptions for decision-making
in disaster risk management},
journal = {Reliab. Eng. Syst. Saf.},
volume = {142},
pages = {48--55},
year = {2015},
url = {https://doi.org/10.1016/j.ress.2015.04.012},
doi = {10.1016/J.RESS.2015.04.012},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/LinNSAT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/AldacoCS15,
author = {Abraham N. Aldaco and
Charles J. Colbourn and
Violet R. Syrotiuk},
title = {Locating Arrays: {A} New Experimental Design for Screening Complex
Engineered Systems},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {49},
number = {1},
pages = {31--40},
year = {2015},
url = {https://doi.org/10.1145/2723872.2723878},
doi = {10.1145/2723872.2723878},
timestamp = {Tue, 14 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigops/AldacoCS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/GeestPFVWT15,
author = {Martin van der Geest and
Henk Polinder and
Jan Abraham Ferreira and
Andr{\'{e}} Veltman and
Johan J. Wolmarans and
Nefeli Tsiara},
title = {Analysis and Neutral Voltage-Based Detection of Interturn Faults in
High-Speed Permanent-Magnet Machines With Parallel Strands},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {62},
number = {6},
pages = {3862--3873},
year = {2015},
url = {https://doi.org/10.1109/TIE.2015.2402641},
doi = {10.1109/TIE.2015.2402641},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/GeestPFVWT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/VazquezMAQLF15,
author = {Sergio Vazquez and
Abraham Marquez and
Ricardo P. Aguilera and
Daniel E. Quevedo and
Jose Ignacio Le{\'{o}}n Galv{\'{a}}n and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Predictive Optimal Switching Sequence Direct Power Control for Grid-Connected
Power Converters},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {62},
number = {4},
pages = {2010--2020},
year = {2015},
url = {https://doi.org/10.1109/TIE.2014.2351378},
doi = {10.1109/TIE.2014.2351378},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/VazquezMAQLF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/RothLRM15,
author = {Joseph Roth and
Xiaoming Liu and
Arun Ross and
Dimitris N. Metaxas},
title = {Investigating the Discriminative Power of Keystroke Sound},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {10},
number = {2},
pages = {333--345},
year = {2015},
url = {https://doi.org/10.1109/TIFS.2014.2374424},
doi = {10.1109/TIFS.2014.2374424},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/RothLRM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEcca/GeulenJNFNWAAU15,
author = {Sascha Geulen and
Martina Josevski and
Johanna Nellen and
Janosch Fuchs and
Lukas Netz and
Benedikt Wolters and
Dirk Abel and
Erika {\'{A}}brah{\'{a}}m and
Walter Unger},
title = {Learning-based control strategies for hybrid electric vehicles},
booktitle = {2015 {IEEE} Conference on Control Applications, {CCA} 2015, Sydney,
Australia, September 21-23, 2015},
pages = {1722--1728},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/CCA.2015.7320858},
doi = {10.1109/CCA.2015.7320858},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/IEEEcca/GeulenJNFNWAAU15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acmicn/LailariAAHYDPC15,
author = {Ze'ev Lailari and
Hila Ben Abraham and
Ben Aronberg and
Jackie Hudepohl and
Haowei Yuan and
John D. DeHart and
Jyoti Parwatikar and
Patrick Crowley},
editor = {Ignacio Solis and
Antonio Carzaniga and
K. K. Ramakrishnan},
title = {Experiments with the Emulated {NDN} Testbed in {ONL}},
booktitle = {Proceedings of the 2nd International Conference on Information-Centric
Networking, {ICN} '15, San Francisco, California, USA, September 30
- October 2, 2015},
pages = {219--220},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2810156.2812616},
doi = {10.1145/2810156.2812616},
timestamp = {Tue, 06 Nov 2018 16:58:41 +0100},
biburl = {https://dblp.org/rec/conf/acmicn/LailariAAHYDPC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/africon/NyeteAD15,
author = {Abraham M. Nyete and
Thomas J. Afullo and
Innocent E. Davidson},
title = {Statistical analysis and characterization of low voltage power line
noise for telecommunication applications},
booktitle = {{AFRICON} 2015, Addis Ababa, Ethiopia, September 14-17, 2015},
pages = {1--5},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/AFRCON.2015.7331930},
doi = {10.1109/AFRCON.2015.7331930},
timestamp = {Thu, 27 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/africon/NyeteAD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/GephartARPL15,
author = {Sheila M. Gephart and
Joanna Abraham and
Rebecca Raszewski and
Lauren Price and
Karen Dunn Lopez},
title = {An Integrative Review of Nursing Clinical Decision Support Systems:
Examining the Impact on Process, Usability and Patient Outcomes},
booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
San Francisco, CA, USA, November 14-18, 2015},
publisher = {{AMIA}},
year = {2015},
url = {https://knowledge.amia.org/59310-amia-1.2741865/t001-1.2745946/f001-1.2745947/2247101-1.2746158/2248853-1.2746155},
timestamp = {Wed, 17 Apr 2024 11:47:40 +0200},
biburl = {https://dblp.org/rec/conf/amia/GephartARPL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionetics/AbrahamMDLSD15,
author = {Vian Abraham and
Yasameen Al Mharib and
Brian Donnel and
Xiaobin Le and
Joseph Santacroce and
Douglas E. Dow},
editor = {Junichi Suzuki and
Tadashi Nakano and
Henry Hess},
title = {Automatic Regulator for Supplemental Oxygen Therapy},
booktitle = {{BICT} 2015, Proceedings of the 9th {EAI} International Conference
on Bio-inspired Information and Communications Technologies (formerly
BIONETICS), New York City, United States, December 3-5, 2015},
pages = {120--123},
publisher = {{ICST/ACM}},
year = {2015},
url = {http://dl.acm.org/citation.cfm?id=2954760},
timestamp = {Fri, 03 Feb 2017 18:36:35 +0100},
biburl = {https://dblp.org/rec/conf/bionetics/AbrahamMDLSD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cav/DehnertJJCVBKA15,
author = {Christian Dehnert and
Sebastian Junges and
Nils Jansen and
Florian Corzilius and
Matthias Volk and
Harold Bruintjes and
Joost{-}Pieter Katoen and
Erika {\'{A}}brah{\'{a}}m},
editor = {Daniel Kroening and
Corina S. Pasareanu},
title = {PROPhESY: {A} PRObabilistic ParamEter SYnthesis Tool},
booktitle = {Computer Aided Verification - 27th International Conference, {CAV}
2015, San Francisco, CA, USA, July 18-24, 2015, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {9206},
pages = {214--231},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-21690-4\_13},
doi = {10.1007/978-3-319-21690-4\_13},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cav/DehnertJJCVBKA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fm/QuatmannJDWAKB15,
author = {Tim Quatmann and
Nils Jansen and
Christian Dehnert and
Ralf Wimmer and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen and
Bernd Becker},
editor = {Nikolaj S. Bj{\o}rner and
Frank S. de Boer},
title = {Counterexamples for Expected Rewards},
booktitle = {{FM} 2015: Formal Methods - 20th International Symposium, Oslo, Norway,
June 24-26, 2015, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9109},
pages = {435--452},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-19249-9\_27},
doi = {10.1007/978-3-319-19249-9\_27},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fm/QuatmannJDWAKB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcai/NellenWNGA15,
author = {Johanna Nellen and
Benedikt Wolters and
Lukas Netz and
Sascha Geulen and
Erika {\'{A}}brah{\'{a}}m},
editor = {Georg Gottlob and
Geoff Sutcliffe and
Andrei Voronkov},
title = {A Genetic Algorithm based Control Strategy for the Energy Management
Problem in PHEVs},
booktitle = {Global Conference on Artificial Intelligence, {GCAI} 2015, Tbilisi,
Georgia, October 16-19, 2015},
series = {EPiC Series in Computing},
volume = {36},
pages = {196--214},
publisher = {EasyChair},
year = {2015},
url = {https://doi.org/10.29007/md3x},
doi = {10.29007/MD3X},
timestamp = {Sun, 15 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gcai/NellenWNGA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/TruebaPBD15,
author = {Pedro Trueba and
Abraham Prieto and
Francisco Bellas and
Richard J. Duro},
editor = {Sara Silva and
Anna Isabel Esparcia{-}Alc{\'{a}}zar},
title = {Embodied Evolution for Collective Indoor Surveillance and Location},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2015, Madrid,
Spain, July 11-15, 2015, Companion Material Proceedings},
pages = {1241--1242},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2739482.2768490},
doi = {10.1145/2739482.2768490},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/TruebaPBD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icacci/KarpateJDA15,
author = {Sarang Karpate and
Abhishek Joshi and
Javed Dosani and
Jibi Abraham},
editor = {Jaime Lloret Mauri and
Sabu M. Thampi and
Michal Wozniak and
Oge Marques and
Dilip Krishnaswamy and
Sartaj Sahni and
Christian Callegari and
Hideyuki Takagi and
Zoran S. Bojkovic and
Vinod M. and
Neeli R. Prasad and
Jos{\'{e}} M. Alcaraz Calero and
Joal Rodrigues and
Xinyu Que and
Natarajan Meghanathan and
Ravi S. Sandhu and
Edward Au},
title = {Cascket: {A} binary protocol based c client-driver for Apache Cassandra},
booktitle = {2015 International Conference on Advances in Computing, Communications
and Informatics, {ICACCI} 2015, Kochi, India, August 10-13, 2015},
pages = {387--393},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICACCI.2015.7275640},
doi = {10.1109/ICACCI.2015.7275640},
timestamp = {Wed, 24 Apr 2024 14:55:54 +0200},
biburl = {https://dblp.org/rec/conf/icacci/KarpateJDA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsa/AguilarCBMBO15,
author = {Jos{\'{e}} Alfonso Aguilar and
Anibal Zald{\'{\i}}var Colado and
Carolina Tripp Barba and
Sanjay Misra and
Roberto Bernal and
Abraham Ocegueda},
editor = {Osvaldo Gervasi and
Beniamino Murgante and
Sanjay Misra and
Marina L. Gavrilova and
Ana Maria Alves Coutinho Rocha and
Carmelo Maria Torre and
David Taniar and
Bernady O. Apduhan},
title = {An Analysis of Techniques and Tools for Requirements Elicitation in
Model-Driven Web Engineering Methods},
booktitle = {Computational Science and Its Applications - {ICCSA} 2015 - 15th International
Conference, Banff, AB, Canada, June 22-25, 2015, Proceedings, Part
{IV}},
series = {Lecture Notes in Computer Science},
volume = {9158},
pages = {518--527},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-21410-8\_40},
doi = {10.1007/978-3-319-21410-8\_40},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccsa/AguilarCBMBO15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/CelikovskyTRD15,
author = {Sergej Celikovsk{\'{y}} and
Jorge A. Torres{-}Mu{\~{n}}oz and
Abraham Efraim Rodriguez{-}Mata and
Alma Rosa Dominguez{-}Bocanegra},
title = {An adaptive extension to high gain observer with application to wastewater
monitoring},
booktitle = {12th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2015, Mexico City, Mexico, October
28-30, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICEEE.2015.7357956},
doi = {10.1109/ICEEE.2015.7357956},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/iceee/CelikovskyTRD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icit2/MarquezLVF15,
author = {Abraham Marquez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Communications scheme of a modular power conversion system},
booktitle = {{IEEE} International Conference on Industrial Technology, {ICIT} 2015,
Seville, Spain, March 17-19, 2015},
pages = {3034--3039},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICIT.2015.7125546},
doi = {10.1109/ICIT.2015.7125546},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icit2/MarquezLVF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icit2/VazquezMAQLF15,
author = {Sergio Vazquez and
Abraham Marquez and
Ricardo P. Aguilera and
Daniel E. Quevedo and
Jos{\'{e}} I. Leon and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Predictive direct power control for grid connected power converters
with dc-link voltage dynamic reference design},
booktitle = {{IEEE} International Conference on Industrial Technology, {ICIT} 2015,
Seville, Spain, March 17-19, 2015},
pages = {2327--2332},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICIT.2015.7125441},
doi = {10.1109/ICIT.2015.7125441},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icit2/VazquezMAQLF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MarquezLPVFK15,
author = {Abraham Marquez and
Jos{\'{e}} I. Leon and
Ram{\'{o}}n C. Portillo and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo and
Samir Kouro},
title = {Adaptive phase-shifted {PWM} for multilevel cascaded H-bridge converters
for balanced or unbalanced operation},
booktitle = {{IECON} 2015 - 41st Annual Conference of the {IEEE} Industrial Electronics
Society, Yokohama, Japan, November 9-12, 2015},
pages = {5124--5129},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IECON.2015.7392904},
doi = {10.1109/IECON.2015.7392904},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/MarquezLPVFK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/AbrahamMSPRRNVM15,
author = {Emerson Rodolfo Abraham and
Sivanilza Teixeira Machado and
Helton R. O. Silva and
Carla Caprara Parizi and
Jo{\~{a}}o Gilberto Mendes dos Reis and
H{\'{e}}lcio Raymundo and
Pedro Luiz de Oliveira Costa Neto and
Oduvaldo Vendrametto and
Marcos de Oliveira Morais and
Ant{\^{o}}nio S{\'{e}}rgio Brej{\~{a}}o and
Cleber W. Gomes},
editor = {Shigeki Umeda and
Masaru Nakano and
Hajime Mizuyama and
Hironori Hibino and
Dimitris Kiritsis and
Gregor von Cieminski},
title = {Evaluating the Implementation of a Fuzzy Logic System for Hybrid Vehicles
as Alternative to Combustion Engine Buses in Big Cities},
booktitle = {Advances in Production Management Systems: Innovative Production Management
Towards Sustainable Growth - {IFIP} {WG} 5.7 International Conference,
{APMS} 2015, Tokyo, Japan, September 7-9, 2015, Proceedings, Part
{I}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {459},
pages = {251--258},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-22756-6\_31},
doi = {10.1007/978-3-319-22756-6\_31},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-7/AbrahamMSPRRNVM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/MoraisBNRRVAPMS15,
author = {Marcos de Oliveira Morais and
Ant{\^{o}}nio S{\'{e}}rgio Brej{\~{a}}o and
Pedro Luiz de Oliveira Costa Neto and
H{\'{e}}lcio Raymundo and
Jo{\~{a}}o Gilberto Mendes dos Reis and
Oduvaldo Vendrametto and
Emerson Rodolfo Abraham and
Carla Caprara Parizi and
Sivanilza Teixeira Machado and
Helton R. O. Silva},
editor = {Shigeki Umeda and
Masaru Nakano and
Hajime Mizuyama and
Hironori Hibino and
Dimitris Kiritsis and
Gregor von Cieminski},
title = {Knowledge and Quality for Continuous Improvement of Production Processes},
booktitle = {Advances in Production Management Systems: Innovative Production Management
Towards Sustainable Growth - {IFIP} {WG} 5.7 International Conference,
{APMS} 2015, Tokyo, Japan, September 7-9, 2015, Proceedings, Part
{I}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {459},
pages = {194--201},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-22756-6\_24},
doi = {10.1007/978-3-319-22756-6\_24},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-7/MoraisBNRRVAPMS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-7/RaymundoRNVAMPM15,
author = {H{\'{e}}lcio Raymundo and
Jo{\~{a}}o Gilberto Mendes dos Reis and
Pedro Luiz de Oliveira Costa Neto and
Oduvaldo Vendrametto and
Emerson Rodolfo Abraham and
Marcos de Oliveira Morais and
Carla Caprara Parizi and
Sivanilza Teixeira Machado and
Helton R. O. Silva and
Ant{\^{o}}nio S{\'{e}}rgio Brej{\~{a}}o},
editor = {Shigeki Umeda and
Masaru Nakano and
Hajime Mizuyama and
Hironori Hibino and
Dimitris Kiritsis and
Gregor von Cieminski},
title = {Improving Service Quality in Public Transportation in Brazil: How
Bus Companies are Simplifying Quality Management Systems and Strategic
Planning to Increase Service Level?},
booktitle = {Advances in Production Management Systems: Innovative Production Management
Towards Sustainable Growth - {IFIP} {WG} 5.7 International Conference,
{APMS} 2015, Tokyo, Japan, September 7-9, 2015, Proceedings, Part
{I}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {459},
pages = {484--491},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-22756-6\_59},
doi = {10.1007/978-3-319-22756-6\_59},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-7/RaymundoRNVAMPM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/TruebaPBD15,
author = {Pedro Trueba and
Abraham Prieto and
Francisco Bellas and
Richard J. Duro},
title = {Applying the canonical distributed Embodied Evolution algorithm in
a collective indoor navigation task},
booktitle = {2015 International Joint Conference on Neural Networks, {IJCNN} 2015,
Killarney, Ireland, July 12-17, 2015},
pages = {1--8},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IJCNN.2015.7280807},
doi = {10.1109/IJCNN.2015.7280807},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/TruebaPBD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WoubieLH15,
author = {Abraham Woubie and
Jordi Luque and
Javier Hernando},
title = {Using voice-quality measurements with prosodic and spectral features
for speaker diarization},
booktitle = {16th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2015, Dresden, Germany, September 6-10, 2015},
pages = {3100--3104},
publisher = {{ISCA}},
year = {2015},
url = {https://doi.org/10.21437/Interspeech.2015-110},
doi = {10.21437/INTERSPEECH.2015-110},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/WoubieLH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwinac/TruebaPBD15,
author = {Pedro Trueba and
Abraham Prieto and
Francisco Bellas and
Richard J. Duro},
editor = {Jos{\'{e}} Manuel Ferr{\'{a}}ndez de Vicente and
Jos{\'{e}} Ram{\'{o}}n {\'{A}}lvarez S{\'{a}}nchez and
F{\'{e}}lix de la Paz L{\'{o}}pez and
F. Javier Toledo{-}Moreo and
Hojjat Adeli},
title = {Embodied Evolution for Collective Indoor Surveillance and Location},
booktitle = {Bioinspired Computation in Artificial Systems - International Work-Conference
on the Interplay Between Natural and Artificial Computation, {IWINAC}
2015, Elche, Spain, June 1-5, 2015, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9108},
pages = {138--147},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-18833-1\_15},
doi = {10.1007/978-3-319-18833-1\_15},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwinac/TruebaPBD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/MartinezLM15,
author = {Jos{\'{e}} Luis Estrada Mart{\'{\i}}nez and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Miguel Angel Jara Maldonado},
editor = {Grigori Sidorov and
Sof{\'{\i}}a N. Galicia{-}Haro},
title = {On the Use of Ant Colony Optimization for Video Games},
booktitle = {Advances in Artificial Intelligence and Soft Computing - 14th Mexican
International Conference on Artificial Intelligence, {MICAI} 2015,
Cuernavaca, Morelos, Mexico, October 25-31, 2015, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {9413},
pages = {238--247},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-27060-9\_19},
doi = {10.1007/978-3-319-27060-9\_19},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micai/MartinezLM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nabic/LorancaVARFL15,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mart{\'{\i}}n Estrada Analco and
Jorge A. Ruiz{-}Vanoye and
Alejandro Fuentes{-}Penna and
Abraham S{\'{a}}nchez L{\'{o}}pez},
editor = {Nelishia Pillay and
Andries P. Engelbrecht and
Ajith Abraham and
Mathys C. du Plessis and
V{\'{a}}clav Sn{\'{a}}sel and
Azah Kamilah Muda},
title = {Bioinspired Tabu Search for Geographic Partitioning},
booktitle = {Advances in Nature and Biologically Inspired Computing - Proceedings
of the 7th World Congress on Nature and Biologically Inspired Computing
(NaBIC 2015) in Pietermaritzburg, South Africa, held December 01-03,
2015},
series = {Advances in Intelligent Systems and Computing},
volume = {419},
pages = {189--199},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-27400-3\_17},
doi = {10.1007/978-3-319-27400-3\_17},
timestamp = {Sun, 02 Jun 2019 21:21:53 +0200},
biburl = {https://dblp.org/rec/conf/nabic/LorancaVARFL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nbis/AbrahamBBGJKPS15,
author = {Erika {\'{A}}brah{\'{a}}m and
Costas Bekas and
Ivona Brandic and
Samir Genaim and
Einar Broch Johnsen and
Ivan Kondov and
Sabri Pllana and
Achim Streit},
editor = {Leonard Barolli and
Makoto Takizawa and
Hui{-}Huang Hsu and
Tomoya Enokido and
Fatos Xhafa},
title = {Preparing {HPC} Applications for Exascale: Challenges and Recommendations},
booktitle = {18th International Conference on Network-Based Information Systems,
NBis 2015, Taipei, Taiwan, September 2-4, 2015},
pages = {401--406},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/NBiS.2015.61},
doi = {10.1109/NBIS.2015.61},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nbis/AbrahamBBGJKPS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nfm/PathakAJTK15,
author = {Shashank Pathak and
Erika {\'{A}}brah{\'{a}}m and
Nils Jansen and
Armando Tacchella and
Joost{-}Pieter Katoen},
editor = {Klaus Havelund and
Gerard J. Holzmann and
Rajeev Joshi},
title = {A Greedy Approach for the Efficient Repair of Stochastic Models},
booktitle = {{NASA} Formal Methods - 7th International Symposium, {NFM} 2015, Pasadena,
CA, USA, April 27-29, 2015, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9058},
pages = {295--309},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-17524-9\_21},
doi = {10.1007/978-3-319-17524-9\_21},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nfm/PathakAJTK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semweb/GaoSKB15,
author = {Shen Gao and
Thomas Scharrenbach and
J{\"{o}}rg{-}Uwe Kietz and
Abraham Bernstein},
editor = {Kostis Kyzirakos and
Cory A. Henson and
Matthew Perry and
Dalia Varanka and
Rolf Gr{\"{u}}tter and
Jean{-}Paul Calbimonte and
Irene Celino and
Emanuele Della Valle and
Daniele Dell'Aglio and
Markus Kr{\"{o}}tzsch and
Stefan Schlobach},
title = {Running out of Bindings? Integrating Facts and Events in Linked Data
Stream Processing},
booktitle = {Joint Proceedings of the 1st Joint International Workshop on Semantic
Sensor Networks and Terra Cognita {(SSN-TC} 2015) and the 4th International
Workshop on Ordering and Reasoning (OrdRing 2015) co-located with
the 14th International Semantic Web Conference {(ISWC} 2015), Bethlehem,
Pennsylvania, United States, October 11th - and - 12th, 2015},
series = {{CEUR} Workshop Proceedings},
volume = {1488},
pages = {63--74},
publisher = {CEUR-WS.org},
year = {2015},
url = {https://ceur-ws.org/Vol-1488/paper-07.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:04 +0100},
biburl = {https://dblp.org/rec/conf/semweb/GaoSKB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sii/SharmaJBSM15,
author = {Prayag Sharma and
Ravi Prakash Joshi and
Riby Abraham Boby and
Subir Kumar Saha and
Takafumi Matsumaru},
title = {Projectable interactive surface using microsoft kinect {V2:} Recovering
information from coarse data to detect touch},
booktitle = {2015 {IEEE/SICE} International Symposium on System Integration, {SII}
2015, Nagoya, Japan, December 11-13, 2015},
pages = {795--800},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/SII.2015.7405081},
doi = {10.1109/SII.2015.7405081},
timestamp = {Sat, 01 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sii/SharmaJBSM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/HaAPKWMCM15,
author = {Sohmyung Ha and
Abraham Akinin and
Jongkil Park and
Chul Kim and
Hui Wang and
Christoph Maier and
Gert Cauwenberghs and
Patrick P. Mercier},
title = {A 16-channel wireless neural interfacing SoC with RF-powered energy-replenishing
adiabatic stimulation},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {106},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231341},
doi = {10.1109/VLSIC.2015.7231341},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/HaAPKWMCM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/KimJTHALC15,
author = {Chul Kim and
Siddharth Joshi and
Chris M. Thomas and
Sohmyung Ha and
Abraham Akinin and
Lawrence E. Larson and
Gert Cauwenberghs},
title = {A {CMOS} 4-channel {MIMO} baseband receiver with 65dB harmonic rejection
over 48MHz and 50dB spatial signal separation over 3MHz at 1.3mW},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {304},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231300},
doi = {10.1109/VLSIC.2015.7231300},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/KimJTHALC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/asc/NellenAW15,
author = {Johanna Nellen and
Erika {\'{A}}brah{\'{a}}m and
Benedikt Wolters},
editor = {Thouraya Bouabana{-}Tebibel and
Stuart H. Rubin},
title = {A {CEGAR} Tool for the Reachability Analysis of PLC-Controlled Plants
Using Hybrid Automata},
booktitle = {Formalisms for Reuse and Systems Integration},
series = {Advances in Intelligent Systems and Computing},
volume = {346},
pages = {55--78},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-16577-6\_3},
doi = {10.1007/978-3-319-16577-6\_3},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/asc/NellenAW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/PaucaFRGT15,
author = {Victor Pa{\'{u}}l Pauca and
Kelly Smith Faddis and
Arun Ross and
Joseph van der Gracht and
Todd C. Torgersen},
editor = {Stan Z. Li and
Anil K. Jain},
title = {Wavefront Coded\({}^{\mbox{{\unicode{9415}}}}\) Iris Biometric Systems},
booktitle = {Encyclopedia of Biometrics, Second Edition},
pages = {1603--1608},
publisher = {Springer {US}},
year = {2015},
url = {https://doi.org/10.1007/978-1-4899-7488-4\_215},
doi = {10.1007/978-1-4899-7488-4\_215},
timestamp = {Fri, 27 Oct 2017 15:34:05 +0200},
biburl = {https://dblp.org/rec/reference/bio/PaucaFRGT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AbrahamBBGJKPS15,
author = {Erika {\'{A}}brah{\'{a}}m and
Costas Bekas and
Ivona Brandic and
Samir Genaim and
Einar Broch Johnsen and
Ivan Kondov and
Sabri Pllana and
Achim Streit},
title = {Preparing {HPC} Applications for Exascale: Challenges and Recommendations},
journal = {CoRR},
volume = {abs/1503.06974},
year = {2015},
url = {http://arxiv.org/abs/1503.06974},
eprinttype = {arXiv},
eprint = {1503.06974},
timestamp = {Sat, 23 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/AbrahamBBGJKPS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/CohenDB15,
author = {Joseph Paul Cohen and
Wei Ding and
Abraham Bagherjeiran},
title = {Semi-Supervised Web Wrapper Repair via Recursive Tree Matching},
journal = {CoRR},
volume = {abs/1505.01303},
year = {2015},
url = {http://arxiv.org/abs/1505.01303},
eprinttype = {arXiv},
eprint = {1505.01303},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/CohenDB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JohnMSNGKSPAMSS15,
author = {Wolfgang John and
Catalin Meirosu and
Pontus Sk{\"{o}}ldstr{\"{o}}m and
Felician N{\'{e}}meth and
Andr{\'{a}}s Guly{\'{a}}s and
Mario Kind and
Sachin Sharma and
Ioanna Papafili and
George Agapiou and
Guido Marchetto and
Riccardo Sisto and
Rebecca Steinert and
Per Kreuger and
Henrik Abrahamsson and
Antonio Manzalini and
Nadi Sarrar},
title = {Initial Service Provider DevOps concept, capabilities and proposed
tools},
journal = {CoRR},
volume = {abs/1510.02220},
year = {2015},
url = {http://arxiv.org/abs/1510.02220},
eprinttype = {arXiv},
eprint = {1510.02220},
timestamp = {Fri, 23 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/JohnMSNGKSPAMSS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/GotzAMRKPCL14,
author = {Lou G{\"{o}}tz and
Jodie L. Abrahams and
Julien Mariethoz and
Pauline M. Rudd and
Niclas G. Karlsson and
Nicolle H. Packer and
Matthew P. Campbell and
Fr{\'{e}}d{\'{e}}rique Lisacek},
title = {GlycoDigest: a tool for the targeted use of exoglycosidase digestions
in glycan structure determination},
journal = {Bioinform.},
volume = {30},
number = {21},
pages = {3131--3133},
year = {2014},
url = {https://doi.org/10.1093/bioinformatics/btu425},
doi = {10.1093/BIOINFORMATICS/BTU425},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/GotzAMRKPCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/VargheseBVP14,
author = {Abraham Varghese and
Kannan Balakrishnan and
Reji Rajan Varghese and
Joseph S. Paul},
title = {Content-Based Image Retrieval of Axial Brain Slices Using a Novel
{LBP} with a Ternary Encoding},
journal = {Comput. J.},
volume = {57},
number = {9},
pages = {1383--1394},
year = {2014},
url = {https://doi.org/10.1093/comjnl/bxu008},
doi = {10.1093/COMJNL/BXU008},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cj/VargheseBVP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/LarusicP14,
author = {John Larusic and
Abraham P. Punnen},
title = {The asymmetric bottleneck traveling salesman problem: Algorithms,
complexity and empirical analysis},
journal = {Comput. Oper. Res.},
volume = {43},
pages = {20--35},
year = {2014},
url = {https://doi.org/10.1016/j.cor.2013.08.005},
doi = {10.1016/J.COR.2013.08.005},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/LarusicP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/Sanchez-OroPD14,
author = {Jes{\'{u}}s S{\'{a}}nchez{-}Oro and
Juan Jos{\'{e}} Pantrigo and
Abraham Duarte},
title = {Combining intensification and diversification strategies in {VNS.}
An application to the Vertex Separation problem},
journal = {Comput. Oper. Res.},
volume = {52},
pages = {209--219},
year = {2014},
url = {https://doi.org/10.1016/j.cor.2013.11.008},
doi = {10.1016/J.COR.2013.11.008},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/Sanchez-OroPD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/SnirWAABBBBCCCCDDEEFGGJKLLMMSSH14,
author = {Marc Snir and
Robert W. Wisniewski and
Jacob A. Abraham and
Sarita V. Adve and
Saurabh Bagchi and
Pavan Balaji and
James F. Belak and
Pradip Bose and
Franck Cappello and
Bill Carlson and
Andrew A. Chien and
Paul Coteus and
Nathan DeBardeleben and
Pedro C. Diniz and
Christian Engelmann and
Mattan Erez and
Saverio Fazzari and
Al Geist and
Rinku Gupta and
Fred Johnson and
Sriram Krishnamoorthy and
Sven Leyffer and
Dean Liberty and
Subhasish Mitra and
Todd S. Munson and
Rob Schreiber and
Jon Stearley and
Eric Van Hensbergen},
title = {Addressing failures in exascale computing},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {28},
number = {2},
pages = {129--173},
year = {2014},
url = {https://doi.org/10.1177/1094342014522573},
doi = {10.1177/1094342014522573},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhpca/SnirWAABBBBCCCCDDEEFGGJKLLMMSSH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/CorchadoAGBV14,
author = {Emilio Corchado and
Ajith Abraham and
Pedro Antonio Guti{\'{e}}rrez and
Jos{\'{e}} Manuel Ben{\'{\i}}tez and
Sebasti{\'{a}}n Ventura},
title = {Special issue: Advances in learning schemes for function approximation},
journal = {Neurocomputing},
volume = {135},
pages = {1--2},
year = {2014},
url = {https://doi.org/10.1016/j.neucom.2013.12.003},
doi = {10.1016/J.NEUCOM.2013.12.003},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/CorchadoAGBV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AbrahamKP14,
author = {Joanna Abraham and
Thomas George Kannampallil and
Vimla L. Patel},
title = {A systematic review of the literature on the evaluation of handoff
tools: implications for research and practice},
journal = {J. Am. Medical Informatics Assoc.},
volume = {21},
number = {1},
pages = {154--162},
year = {2014},
url = {https://doi.org/10.1136/amiajnl-2012-001351},
doi = {10.1136/AMIAJNL-2012-001351},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/AbrahamKP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/ChandyJS14,
author = {D. Abraham Chandy and
J. Stanly Johnson and
S. Easter Selvan},
title = {Texture feature extraction using gray level statistical matrix for
content-based mammogram retrieval},
journal = {Multim. Tools Appl.},
volume = {72},
number = {2},
pages = {2011--2024},
year = {2014},
url = {https://doi.org/10.1007/s11042-013-1511-z},
doi = {10.1007/S11042-013-1511-Z},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mta/ChandyJS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WattamADDDGGGHKMMNOOPSSSSVWWWYZZS14,
author = {Alice R. Wattam and
David Abraham and
Oral Dalay and
Terry Disz and
Timothy Driscoll and
Joseph L. Gabbard and
Joseph J. Gillespie and
Roger Gough and
Deborah Hix and
Ronald W. Kenyon and
Dustin Machi and
Chunhong Mao and
Eric K. Nordberg and
Robert Olson and
Ross A. Overbeek and
Gordon D. Pusch and
Maulik Shukla and
Julie Schulman and
Rick L. Stevens and
Daniel E. Sullivan and
Veronika Vonstein and
Andrew S. Warren and
Rebecca Will and
Meredith J. C. Wilson and
Hyun Seung Yoo and
Chengdong Zhang and
Yan Zhang and
Bruno W. S. Sobral},
title = {PATRIC, the bacterial bioinformatics database and analysis resource},
journal = {Nucleic Acids Res.},
volume = {42},
number = {Database-Issue},
pages = {581--591},
year = {2014},
url = {https://doi.org/10.1093/nar/gkt1099},
doi = {10.1093/NAR/GKT1099},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WattamADDDGGGHKMMNOOPSSSSVWWWYZZS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BauerKWSLC14,
author = {Adam Q. Bauer and
Andrew W. Kraft and
Patrick W. Wright and
Abraham Z. Snyder and
Jin{-}Moo Lee and
Joseph P. Culver},
title = {Optical imaging of disrupted functional connectivity following ischemic
stroke in mice},
journal = {NeuroImage},
volume = {99},
pages = {388--401},
year = {2014},
url = {https://doi.org/10.1016/j.neuroimage.2014.05.051},
doi = {10.1016/J.NEUROIMAGE.2014.05.051},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BauerKWSLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/FerradalEHSC14,
author = {Silvina L. Ferradal and
Adam T. Eggebrecht and
Mahlega S. Hassanpour and
Abraham Z. Snyder and
Joseph P. Culver},
title = {Atlas-based head modeling and spatial normalization for high-density
diffuse optical tomography: In vivo validation against fMRI},
journal = {NeuroImage},
volume = {85},
pages = {117--126},
year = {2014},
url = {https://doi.org/10.1016/j.neuroimage.2013.03.069},
doi = {10.1016/J.NEUROIMAGE.2013.03.069},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/FerradalEHSC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HassanpourWEFSC14,
author = {Mahlega S. Hassanpour and
Brian R. White and
Adam T. Eggebrecht and
Silvina L. Ferradal and
Abraham Z. Snyder and
Joseph P. Culver},
title = {Statistical analysis of high density diffuse optical tomography},
journal = {NeuroImage},
volume = {85},
pages = {104--116},
year = {2014},
url = {https://doi.org/10.1016/j.neuroimage.2013.05.105},
doi = {10.1016/J.NEUROIMAGE.2013.05.105},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/HassanpourWEFSC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PowerMLSSP14,
author = {Jonathan D. Power and
Anish Mitra and
Timothy O. Laumann and
Abraham Z. Snyder and
Bradley L. Schlaggar and
Steven E. Petersen},
title = {Methods to detect, characterize, and remove motion artifact in resting
state fMRI},
journal = {NeuroImage},
volume = {84},
pages = {320--341},
year = {2014},
url = {https://doi.org/10.1016/j.neuroimage.2013.08.048},
doi = {10.1016/J.NEUROIMAGE.2013.08.048},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/PowerMLSSP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/DentonLTSWH14,
author = {James F. Denton and
Jose Lugo{-}Martinez and
Abraham E. Tucker and
Daniel R. Schrider and
Wesley C. Warren and
Matthew W. Hahn},
title = {Extensive Error in the Number of Genes Inferred from Draft Genome
Assemblies},
journal = {PLoS Comput. Biol.},
volume = {10},
number = {12},
year = {2014},
url = {https://doi.org/10.1371/journal.pcbi.1003998},
doi = {10.1371/JOURNAL.PCBI.1003998},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/DentonLTSWH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/PohRLK14,
author = {Norman Poh and
Arun Ross and
Weifeng Li and
Josef Kittler},
title = {Corrigendum to "A user-specific and selective multimodal biometric
fusion strategy by ranking subjects" [Pattern Recognition 46 {(2013)}
3341-3357]},
journal = {Pattern Recognit.},
volume = {47},
number = {1},
pages = {493},
year = {2014},
url = {https://doi.org/10.1016/j.patcog.2013.08.001},
doi = {10.1016/J.PATCOG.2013.08.001},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/PohRLK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Camarillo-Ramirez14,
author = {Pablo Camarillo{-}Ram{\'{\i}}rez and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Luis Josue Calva Rosales and
Ivan Per{\'{e}}z{-}V{\'{a}}zquez},
title = {An{\'{a}}lisis de datos de calidad del aire de la Zona Metropolitana
del Valle de M{\'{e}}xico mediante t{\'{e}}cnicas de agrupamiento},
journal = {Res. Comput. Sci.},
volume = {72},
pages = {137--150},
year = {2014},
url = {https://rcs.cic.ipn.mx/2014\_72/Analisis\%20de\%20datos\%20de\%20calidad\%20del\%20aire\%20de\%20la\%20Zona\%20Metropolitana\%20del\%20Valle\%20de\%20Mexico.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Camarillo-Ramirez14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/RosalesLCR14,
author = {Luis Josue Calva Rosales and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Pablo Camarillo{-}Ram{\'{\i}}rez and
Juan Carlos Conde Ram{\'{\i}}rez},
title = {Una herramienta de prop{\'{o}}sito general para el plegado de
prote{\'{\i}}nas con t{\'{e}}cnicas probabil{\'{\i}}sticas},
journal = {Res. Comput. Sci.},
volume = {72},
pages = {167--176},
year = {2014},
url = {https://rcs.cic.ipn.mx/2014\_72/Una\%20herramienta\%20de\%20proposito\%20general\%20para\%20el\%20plegado\%20de\%20proteinas\%20con\%20tecnicas\%20probabilisticas.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/RosalesLCR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/JansenWAZKBS14,
author = {Nils Jansen and
Ralf Wimmer and
Erika {\'{A}}brah{\'{a}}m and
Barna Zajzon and
Joost{-}Pieter Katoen and
Bernd Becker and
Johann Schuster},
title = {Symbolic counterexample generation for large discrete-time Markov
chains},
journal = {Sci. Comput. Program.},
volume = {91},
pages = {90--114},
year = {2014},
url = {https://doi.org/10.1016/j.scico.2014.02.001},
doi = {10.1016/J.SCICO.2014.02.001},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scp/JansenWAZKBS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/WimmerJAKB14,
author = {Ralf Wimmer and
Nils Jansen and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen and
Bernd Becker},
title = {Minimal counterexamples for linear-time probabilistic verification},
journal = {Theor. Comput. Sci.},
volume = {549},
pages = {61--100},
year = {2014},
url = {https://doi.org/10.1016/j.tcs.2014.06.020},
doi = {10.1016/J.TCS.2014.06.020},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcs/WimmerJAKB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/AbrahamssonHKB14,
author = {Johan Abrahamsson and
Magnus Hedlund and
Tobias Kamf and
Hans Bernhoff},
title = {High-Speed Kinetic Energy Buffer: Optimization of Composite Shell
and Magnetic Bearings},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {61},
number = {6},
pages = {3012--3021},
year = {2014},
url = {https://doi.org/10.1109/TIE.2013.2259782},
doi = {10.1109/TIE.2013.2259782},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/AbrahamssonHKB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vr/CampbellSHO14,
author = {Abraham G. Campbell and
John W. Stafford and
Thomas Holz and
Gregory M. P. O'Hare},
title = {Why, when and how to use augmented reality agents (AuRAs)},
journal = {Virtual Real.},
volume = {18},
number = {2},
pages = {139--159},
year = {2014},
url = {https://doi.org/10.1007/s10055-013-0239-4},
doi = {10.1007/S10055-013-0239-4},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vr/CampbellSHO14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/LeeBLGKSLAKL14,
author = {Young Ji Lee and
Andrew D. Boyd and
Jianrong Li and
Vincent Gardeux and
Colleen Kenost and
Donald Saner and
Haiquan Li and
Ivo L. Abraham and
Jerry A. Krishnan and
Yves A. Lussier},
title = {{COPD} Hospitalization Risk Increased with Distinct Patterns of Multiple
Systems Comorbidities Unveiled by Network Modeling},
booktitle = {{AMIA} 2014, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 15-19, 2014},
publisher = {{AMIA}},
year = {2014},
url = {https://knowledge.amia.org/56638-amia-1.1540970/t-004-1.1544972/f-004-1.1544973/a-183-1.1545124/a-184-1.1545121},
timestamp = {Wed, 17 Apr 2024 11:47:48 +0200},
biburl = {https://dblp.org/rec/conf/amia/LeeBLGKSLAKL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atva/DehnertJWAK14,
author = {Christian Dehnert and
Nils Jansen and
Ralf Wimmer and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen},
editor = {Franck Cassez and
Jean{-}Fran{\c{c}}ois Raskin},
title = {Fast Debugging of {PRISM} Models},
booktitle = {Automated Technology for Verification and Analysis - 12th International
Symposium, {ATVA} 2014, Sydney, NSW, Australia, November 3-7, 2014,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8837},
pages = {146--162},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-11936-6\_11},
doi = {10.1007/978-3-319-11936-6\_11},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/atva/DehnertJWAK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biocas/AkininYWLPFC14,
author = {Abraham Akinin and
Joshua Yang and
Alexander Williams and
Andrew Lee and
Pedram Pourhoseini and
Arnost Fronek and
Gert Cauwenberghs},
title = {Continuous wave ultrasonic doppler tonometry},
booktitle = {{IEEE} Biomedical Circuits and Systems Conference, BioCAS 2014, Proceedings,
Lausanne, Switzerland, October 22-24, 2014},
pages = {328--331},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/BioCAS.2014.6981729},
doi = {10.1109/BIOCAS.2014.6981729},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biocas/AkininYWLPFC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/EspirituLR14,
author = {Fernando Bartolo Espiritu and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Luis Josue Calva Rosales},
title = {Towards an improvement of software development process based on software
architecture, model driven architecture and ontologies},
booktitle = {24th International Conference on Electronics, Communications and Computing,
{CONIELECOMP} 2014, Cholula, Puebla, Mexico, February 26-28, 2014},
pages = {118--126},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CONIELECOMP.2014.6808578},
doi = {10.1109/CONIELECOMP.2014.6808578},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/conielecomp/EspirituLR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/KietzSFB14,
author = {J{\"{o}}rg{-}Uwe Kietz and
Floarea Serban and
Simon Fischer and
Abraham Bernstein},
editor = {Valentina Presutti and
Claudia d'Amato and
Fabien Gandon and
Mathieu d'Aquin and
Steffen Staab and
Anna Tordai},
title = {"Semantics Inside!" But Let's Not Tell the Data Miners: Intelligent
Support for Data Mining},
booktitle = {The Semantic Web: Trends and Challenges - 11th International Conference,
{ESWC} 2014, Anissaras, Crete, Greece, May 25-29, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8465},
pages = {706--720},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-07443-6\_47},
doi = {10.1007/978-3-319-07443-6\_47},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esws/KietzSFB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/his/MadureiraCPGPSA14,
author = {Ana Madureira and
Bruno Cunha and
Jo{\~{a}}o Paulo Pereira and
S. Gomes and
Ivo Pereira and
J. M. Santos and
Ajith Abraham},
title = {Using personas for supporting user modeling on scheduling systems},
booktitle = {14th International Conference on Hybrid Intelligent Systems, {HIS}
2014, Kuwait, December 14-16, 2014},
pages = {279--284},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/HIS.2014.7086212},
doi = {10.1109/HIS.2014.7086212},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/his/MadureiraCPGPSA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdcn/PonnuswamyFD14,
author = {Vijayalakshmi Ponnuswamy and
Sharmila Anand John Francis and
J. Abraham Dinakaran},
editor = {Mainak Chatterjee and
Jiannong Cao and
Kishore Kothapalli and
Sergio Rajsbaum},
title = {Max-Min-Path Energy-Efficient Routing Algorithm - {A} Novel Approach
to Enhance Network Lifetime of MANETs},
booktitle = {Distributed Computing and Networking - 15th International Conference,
{ICDCN} 2014, Coimbatore, India, January 4-7, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8314},
pages = {512--518},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-642-45249-9\_35},
doi = {10.1007/978-3-642-45249-9\_35},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icdcn/PonnuswamyFD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MarquezLVF14,
author = {Abraham Marquez and
Jos{\'{e}} I. Leon and
Sergio Vazquez and
Leopoldo Garc{\'{\i}}a Franquelo},
title = {Advanced control of a multilevel cascaded H-bridge converter for {PV}
applications},
booktitle = {{IECON} 2014 - 40th Annual Conference of the {IEEE} Industrial Electronics
Society, Dallas, TX, USA, October 29 - November 1, 2014},
pages = {4548--4553},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/IECON.2014.7049188},
doi = {10.1109/IECON.2014.7049188},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/MarquezLVF14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iri/NellenA14,
author = {Johanna Nellen and
Erika {\'{A}}brah{\'{a}}m},
editor = {James Joshi and
Elisa Bertino and
Bhavani Thuraisingham and
Ling Liu},
title = {A {CEGAR} approach for the reachability analysis of PLC-controlled
chemical plants},
booktitle = {Proceedings of the 15th {IEEE} International Conference on Information
Reuse and Integration, {IRI} 2014, Redwood City, CA, USA, August 13-15,
2014},
pages = {500--507},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/IRI.2014.7051930},
doi = {10.1109/IRI.2014.7051930},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iri/NellenA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ised/AbrahamRJ14,
author = {Chikku Abraham and
R. Rakhee and
Babita Roslind Jose},
title = {A Multiple Input Multiple Output Switched Capacitor {DC-DC} Converter
with Reduced Switch Count},
booktitle = {2014 Fifth International Symposium on Electronic System Design, Surathkal,
Mangalore, India, December 15-17, 2014},
pages = {104--108},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ISED.2014.29},
doi = {10.1109/ISED.2014.29},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/ised/AbrahamRJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ncc/JoyANU14,
author = {Neethu Mariam Joy and
Basil Abraham and
K. Navneeth and
Srinivasan Umesh},
title = {Cross-lingual acoustic modeling for Indian languages based on Subspace
Gaussian Mixture Models},
booktitle = {Twentieth National Conference on Communications, {NCC} 2014, Kanpur,
India, February 28 - March 2, 2014},
pages = {1--5},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/NCC.2014.6811282},
doi = {10.1109/NCC.2014.6811282},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/ncc/JoyANU14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qest/JansenCVWAKB14,
author = {Nils Jansen and
Florian Corzilius and
Matthias Volk and
Ralf Wimmer and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen and
Bernd Becker},
editor = {Gethin Norman and
William H. Sanders},
title = {Accelerating Parametric Probabilistic Verification},
booktitle = {Quantitative Evaluation of Systems - 11th International Conference,
{QEST} 2014, Florence, Italy, September 8-10, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8657},
pages = {404--420},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-10696-0\_31},
doi = {10.1007/978-3-319-10696-0\_31},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qest/JansenCVWAKB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sfm/AbrahamBDJKW14,
author = {Erika {\'{A}}brah{\'{a}}m and
Bernd Becker and
Christian Dehnert and
Nils Jansen and
Joost{-}Pieter Katoen and
Ralf Wimmer},
editor = {Marco Bernardo and
Ferruccio Damiani and
Reiner H{\"{a}}hnle and
Einar Broch Johnsen and
Ina Schaefer},
title = {Counterexample Generation for Discrete-Time Markov Models: An Introductory
Survey},
booktitle = {Formal Methods for Executable Software Models - 14th International
School on Formal Methods for the Design of Computer, Communication,
and Software Systems, {SFM} 2014, Bertinoro, Italy, June 16-20, 2014,
Advanced Lectures},
series = {Lecture Notes in Computer Science},
volume = {8483},
pages = {65--121},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-07317-0\_3},
doi = {10.1007/978-3-319-07317-0\_3},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sfm/AbrahamBDJKW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slt/AbrahamJU14,
author = {Basil Abraham and
Neethu Mariam Joy and
Navneeth K. S. Umesh},
title = {A data-driven phoneme mapping technique using interpolation vectors
of phone-cluster adaptive training},
booktitle = {2014 {IEEE} Spoken Language Technology Workshop, {SLT} 2014, South
Lake Tahoe, NV, USA, December 7-10, 2014},
pages = {36--41},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/SLT.2014.7078546},
doi = {10.1109/SLT.2014.7078546},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/slt/AbrahamJU14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/ios/p/TappoletKB14,
author = {Jonas Tappolet and
Christoph Kiefer and
Abraham Bernstein},
editor = {Jeff Z. Pan and
Yuting Zhao},
title = {Semantic Web Enabled Software Analysis},
booktitle = {Semantic Web Enabled Software Engineering},
series = {Studies on the Semantic Web},
volume = {17},
pages = {109--137},
publisher = {{IOS} Press},
year = {2014},
url = {https://doi.org/10.3233/978-1-61499-370-4-109},
doi = {10.3233/978-1-61499-370-4-109},
timestamp = {Tue, 16 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/ios/p/TappoletKB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/softcomp/2014,
editor = {Jos{\'{e}} Gaviria de la Puerta and
Iv{\'{a}}n Garc{\'{\i}}a{-}Ferreira and
Pablo Garc{\'{\i}}a Bringas and
Fanny Klett and
Ajith Abraham and
Andr{\'{e}} C. P. L. F. de Carvalho and
{\'{A}}lvaro Herrero and
Bruno Baruque and
H{\'{e}}ctor Quinti{\'{a}}n and
Emilio Corchado},
title = {International Joint Conference SOCO'14-CISIS'14-ICEUTE'14 - Bilbao,
Spain, June 25th-27th, 2014, Proceedings},
series = {Advances in Intelligent Systems and Computing},
volume = {299},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-07995-0},
doi = {10.1007/978-3-319-07995-0},
isbn = {978-3-319-07994-3},
timestamp = {Fri, 12 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/softcomp/2014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/PardoMPD13,
author = {Eduardo G. Pardo and
Nenad Mladenovic and
Juan Jos{\'{e}} Pantrigo and
Abraham Duarte},
title = {Variable Formulation Search for the Cutwidth Minimization Problem},
journal = {Appl. Soft Comput.},
volume = {13},
number = {5},
pages = {2242--2252},
year = {2013},
url = {https://doi.org/10.1016/j.asoc.2013.01.016},
doi = {10.1016/J.ASOC.2013.01.016},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asc/PardoMPD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/MartiPDP13,
author = {Rafael Mart{\'{\i}} and
Juan Jos{\'{e}} Pantrigo and
Abraham Duarte and
Eduardo G. Pardo},
title = {Branch and bound for the cutwidth minimization problem},
journal = {Comput. Oper. Res.},
volume = {40},
number = {1},
pages = {137--149},
year = {2013},
url = {https://doi.org/10.1016/j.cor.2012.05.016},
doi = {10.1016/J.COR.2012.05.016},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/MartiPDP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssp/Sanchez-Gaspariano13,
author = {Luis Abraham S{\'{a}}nchez{-}Gaspariano and
Clara Iliana Mart{\'{\i}}nez G{\'{o}}mez and
Jos{\'{e}} Miguel Rocha{-}P{\'{e}}rez and
Jes{\'{u}}s Ezequiel Molinar{-}Sol{\'{\i}}s and
Jes{\'{u}}s M. Mu{\~{n}}oz{-}Pacheco and
Carlos Mu{\~{n}}iz{-}Montero and
Alejandro D{\'{\i}}az{-}S{\'{a}}nchez},
title = {An 8-Bit Digitally Controlled Programmable Phase Shifter Circuit for
Sinusoidal Signals with 252\({}^{\mbox{{\(\circ\)}}}\) Phase Control
Range},
journal = {Circuits Syst. Signal Process.},
volume = {32},
number = {2},
pages = {415--431},
year = {2013},
url = {https://doi.org/10.1007/s00034-012-9466-2},
doi = {10.1007/S00034-012-9466-2},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cssp/Sanchez-Gaspariano13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/SerbanVKB13,
author = {Floarea Serban and
Joaquin Vanschoren and
J{\"{o}}rg{-}Uwe Kietz and
Abraham Bernstein},
title = {A survey of intelligent assistants for data analysis},
journal = {{ACM} Comput. Surv.},
volume = {45},
number = {3},
pages = {31:1--31:35},
year = {2013},
url = {https://doi.org/10.1145/2480741.2480748},
doi = {10.1145/2480741.2480748},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csur/SerbanVKB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/Molinar-SolisMGHSRDS13,
author = {Jes{\'{u}}s Ezequiel Molinar{-}Sol{\'{\i}}s and
Carlos Mu{\~{n}}iz{-}Montero and
Rodolfo Zol{\'{a}} Garc{\'{\i}}a{-}Lozano and
Cuauht{\'{e}}moc Hidalgo{-}Cort{\'{e}}s and
Luis Abraham S{\'{a}}nchez{-}Gaspariano and
Jos{\'{e}} Miguel Rocha{-}P{\'{e}}rez and
Alejandro D{\'{\i}}az{-}S{\'{a}}nchez and
Jes{\'{u}}s Efra{\'{\i}}n Gaxiola Sosa},
title = {A low-voltage {CMOS} {MIN} circuit with 3\emph{N}+1 complexity and
10mV/10ns corner error},
journal = {{IEICE} Electron. Express},
volume = {10},
number = {22},
pages = {20130755},
year = {2013},
url = {https://doi.org/10.1587/elex.10.20130755},
doi = {10.1587/ELEX.10.20130755},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieiceee/Molinar-SolisMGHSRDS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/OrtegaSBG13,
author = {Fernando Ortega and
Jos{\'{e}} Luis S{\'{a}}nchez and
Jes{\'{u}}s Bobadilla and
Abraham Guti{\'{e}}rrez},
title = {Improving collaborative filtering-based recommender systems results
using Pareto dominance},
journal = {Inf. Sci.},
volume = {239},
pages = {50--61},
year = {2013},
url = {https://doi.org/10.1016/j.ins.2013.03.011},
doi = {10.1016/J.INS.2013.03.011},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/OrtegaSBG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itpro/FrankeMCAB13,
author = {Craig Franke and
Samuel Morin and
Artem Chebotko and
John Abraham and
Pearl Brazier},
title = {Efficient Processing of Semantic Web Queries in HBase and MySQL Cluster},
journal = {{IT} Prof.},
volume = {15},
number = {3},
pages = {36--43},
year = {2013},
url = {https://doi.org/10.1109/MITP.2012.42},
doi = {10.1109/MITP.2012.42},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/itpro/FrankeMCAB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jnca/Martin-CampilloCYM13,
author = {Abraham Mart{\'{\i}}n{-}Campillo and
Jon Crowcroft and
Eiko Yoneki and
Ramon Mart{\'{\i}}},
title = {Evaluating opportunistic networks in disaster scenarios},
journal = {J. Netw. Comput. Appl.},
volume = {36},
number = {2},
pages = {870--880},
year = {2013},
url = {https://doi.org/10.1016/j.jnca.2012.11.001},
doi = {10.1016/J.JNCA.2012.11.001},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jnca/Martin-CampilloCYM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/Muniz-MonteroSCVLM13,
author = {Carlos Mu{\~{n}}iz{-}Montero and
Luis Abraham S{\'{a}}nchez{-}Gaspariano and
Jose Jaime Camacho{-}Escoto and
Luis A. Villa Vargas and
Her{\'{o}}n Molina Lozano and
Jes{\'{u}}s Ezequiel Molinar{-}Sol{\'{\i}}s},
title = {A 90{\(\mathrm{\mu}\)}m {\texttimes} 64{\(\mathrm{\mu}\)}m 225{\(\mathrm{\mu}\)}W
class-AB {CMOS} differential flipped voltage follower with output
driving capability up to 100 pF},
journal = {Microelectron. J.},
volume = {44},
number = {10},
pages = {930--940},
year = {2013},
url = {https://doi.org/10.1016/j.mejo.2013.03.002},
doi = {10.1016/J.MEJO.2013.03.002},
timestamp = {Sat, 19 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/Muniz-MonteroSCVLM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13,
author = {Deanna M. Barch and
Gregory C. Burgess and
Michael P. Harms and
Steven E. Petersen and
Bradley L. Schlaggar and
Maurizio Corbetta and
Matthew F. Glasser and
Sandra W. Curtiss and
Sachin Dixit and
Cindy Feldt and
Dan Nolan and
Edward Bryant and
Tucker Hartley and
Owen Footer and
James M. Bjork and
Russell A. Poldrack and
Steve M. Smith and
Heidi Johansen{-}Berg and
Abraham Z. Snyder and
David C. Van Essen},
title = {Function in the human connectome: Task-fMRI and individual differences
in behavior},
journal = {NeuroImage},
volume = {80},
pages = {169--189},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2013.05.033},
doi = {10.1016/J.NEUROIMAGE.2013.05.033},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/MarcusHSJWGBABRHHHOMHHRHCSECE13,
author = {Daniel S. Marcus and
Michael P. Harms and
Abraham Z. Snyder and
Mark Jenkinson and
J. Anthony Wilson and
Matthew F. Glasser and
Deanna M. Barch and
Kevin A. Archie and
Gregory C. Burgess and
Mohana Ramaratnam and
Michael R. Hodge and
William Horton and
Rick Herrick and
Timothy R. Olsen and
Michael McKay and
Matthew House and
Michael Hileman and
Erin Reid and
John W. Harwell and
Timothy S. Coalson and
Jon Schindler and
Jennifer Stine Elam and
Sandra W. Curtiss and
David C. Van Essen},
title = {Human Connectome Project informatics: Quality control, database services,
and data visualization},
journal = {NeuroImage},
volume = {80},
pages = {202--219},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2013.05.077},
doi = {10.1016/J.NEUROIMAGE.2013.05.077},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/MarcusHSJWGBABRHHHOMHHRHCSECE13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PowerBSSP13,
author = {Jonathan D. Power and
Kelly Anne Barnes and
Abraham Z. Snyder and
Bradley L. Schlaggar and
Steven E. Petersen},
title = {Steps toward optimizing motion artifact removal in functional connectivity
MRI; a reply to Carp},
journal = {NeuroImage},
volume = {76},
pages = {439--441},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2012.03.017},
doi = {10.1016/J.NEUROIMAGE.2012.03.017},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/PowerBSSP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SmithBAABDDFGHKLMMPPKSVWXhYUEG13,
author = {Stephen M. Smith and
Christian F. Beckmann and
Jesper L. R. Andersson and
Edward J. Auerbach and
Janine D. Bijsterbosch and
Gwena{\"{e}}lle Douaud and
Eugene P. Duff and
David A. Feinberg and
Ludovica Griffanti and
Michael P. Harms and
Michael Kelly and
Timothy O. Laumann and
Karla L. Miller and
Steen Moeller and
Steven E. Petersen and
Jonathan D. Power and
Gholamreza Salimi Khorshidi and
Abraham Z. Snyder and
An T. Vu and
Mark William Woolrich and
Junqian Xu and
Essa Yacoub and
K{\^{a}}mil Ugurbil and
David C. Van Essen and
Matthew F. Glasser},
title = {Resting-state fMRI in the Human Connectome Project},
journal = {NeuroImage},
volume = {80},
pages = {144--168},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2013.05.039},
doi = {10.1016/J.NEUROIMAGE.2013.05.039},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/SmithBAABDDFGHKLMMPPKSVWXhYUEG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/XuSKSTNBCS13,
author = {Junqian Xu and
Joshua S. Shimony and
Eric C. Klawiter and
Abraham Z. Snyder and
Kathryn Trinkaus and
Robert T. Naismith and
Tammie L. S. Benzinger and
Anne H. Cross and
Sheng{-}Kwei Song},
title = {Improved in vivo diffusion tensor imaging of human cervical spinal
cord},
journal = {NeuroImage},
volume = {67},
pages = {64--76},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2012.11.014},
doi = {10.1016/J.NEUROIMAGE.2012.11.014},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/XuSKSTNBCS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/or/MendozaV13,
author = {Abraham Mendoza and
Jos{\'{e}} A. Ventura},
title = {Modeling actual transportation costs in supplier selection and order
quantity allocation decisions},
journal = {Oper. Res.},
volume = {13},
number = {1},
pages = {5--25},
year = {2013},
url = {https://doi.org/10.1007/s12351-011-0109-3},
doi = {10.1007/S12351-011-0109-3},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/or/MendozaV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/PohRLK13,
author = {Norman Poh and
Arun Ross and
Weifeng Lee and
Josef Kittler},
title = {A user-specific and selective multimodal biometric fusion strategy
by ranking subjects},
journal = {Pattern Recognit.},
volume = {46},
number = {12},
pages = {3341--3357},
year = {2013},
url = {https://doi.org/10.1016/j.patcog.2013.03.018},
doi = {10.1016/J.PATCOG.2013.03.018},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/PohRLK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/SarithaJM13,
author = {M. Saritha and
Paul K. Joseph and
Abraham T. Mathew},
title = {Classification of {MRI} brain images using combined wavelet entropy
based spider web plots and probabilistic neural network},
journal = {Pattern Recognit. Lett.},
volume = {34},
number = {16},
pages = {2151--2156},
year = {2013},
url = {https://doi.org/10.1016/j.patrec.2013.08.017},
doi = {10.1016/J.PATREC.2013.08.017},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/prl/SarithaJM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/AbrahamABBCGMMRSWZ13,
author = {Lior Abraham and
John Allen and
Oleksandr Barykin and
Vinayak R. Borkar and
Bhuwan Chopra and
Ciprian Gerea and
Daniel Merl and
Josh Metzler and
David Reiss and
Subbu Subramanian and
Janet L. Wiener and
Okay Zed},
title = {Scuba: Diving into Data at Facebook},
journal = {Proc. {VLDB} Endow.},
volume = {6},
number = {11},
pages = {1057--1067},
year = {2013},
url = {http://www.vldb.org/pvldb/vol6/p1057-wiener.pdf},
doi = {10.14778/2536222.2536231},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pvldb/AbrahamABBCGMMRSWZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ras/TruebaPBCD13,
author = {Pedro Trueba and
Abraham Prieto and
Francisco Bellas and
Pilar Caama{\~{n}}o and
Richard J. Duro},
title = {Specialization analysis of embodied evolution for robotic collective
tasks},
journal = {Robotics Auton. Syst.},
volume = {61},
number = {7},
pages = {682--693},
year = {2013},
url = {https://doi.org/10.1016/j.robot.2012.08.005},
doi = {10.1016/J.ROBOT.2012.08.005},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ras/TruebaPBCD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcos/PereiraMOA13,
author = {Ivo Pereira and
Ana Madureira and
Paulo B. de Moura Oliveira and
Ajith Abraham},
title = {Tuning Meta-Heuristics Using Multi-agent Learning in a Scheduling
System},
journal = {Trans. Comput. Sci.},
volume = {21},
pages = {190--210},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-45318-2\_8},
doi = {10.1007/978-3-642-45318-2\_8},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcos/PereiraMOA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/ChungPA13,
author = {Jaeyong Chung and
Joonsung Park and
Jacob A. Abraham},
title = {A Built-In Repair Analyzer With Optimal Repair Rate for Word-Oriented
Memories},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {21},
number = {2},
pages = {281--291},
year = {2013},
url = {https://doi.org/10.1109/TVLSI.2011.2182217},
doi = {10.1109/TVLSI.2011.2182217},
timestamp = {Wed, 11 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/ChungPA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/africon/NyeteA13,
author = {Abraham M. Nyete and
Thomas Joachim Odhiambo Afullo},
title = {Interpolation and mapping of the median k-factor for terrestrial link
applications in South Africa},
booktitle = {{AFRICON} 2013, Pointe aux Piments, Mauritius, September 9-12, 2013},
pages = {1--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/AFRCON.2013.6757759},
doi = {10.1109/AFRCON.2013.6757759},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/africon/NyeteA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/NicolasRPRA13,
author = {Fl{\'{a}}via P. Nicolas and
Amanda R. Reis and
Ivan Torres Pisa and
Evandro Eduardo Seron Ruiz and
Joseph K. Abraham},
title = {Comparison of Portuguese controlled vocabularies for named entity
recognition in renal biopsy reports},
booktitle = {{AMIA} 2013, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 16-20, 2013},
publisher = {{AMIA}},
year = {2013},
url = {https://knowledge.amia.org/amia-55142-a2013e-1.580047/t-06-1.582200/f-006-1.582201/a-385-1.582836/a-386-1.582833},
timestamp = {Wed, 17 Apr 2024 11:47:55 +0200},
biburl = {https://dblp.org/rec/conf/amia/NicolasRPRA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blizzard/LouwSWWP13,
author = {Johannes A. Louw and
Georg I. Schl{\"{u}}nz and
Willem van der Walt and
Febe de Wet and
Laurette Pretorius},
title = {The Speect text-to-speech system entry for the Blizzard Challenge
2013},
booktitle = {The Blizzard Challenge 2013, Barcelona, Spain, September 3, 2013},
publisher = {{ISCA}},
year = {2013},
url = {https://doi.org/10.21437/Blizzard.2013-8},
doi = {10.21437/BLIZZARD.2013-8},
timestamp = {Wed, 25 Sep 2024 11:16:25 +0200},
biburl = {https://dblp.org/rec/conf/blizzard/LouwSWWP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/Sanchez-OroMMPDFM13,
author = {Jes{\'{u}}s S{\'{a}}nchez{-}Oro and
Soto Montalvo and
Antonio S. Montemayor and
Juan Jos{\'{e}} Pantrigo and
Abraham Duarte and
V{\'{\i}}ctor Fresno and
Raquel Mart{\'{\i}}nez{-}Unanue},
editor = {Pamela Forner and
Roberto Navigli and
Dan Tufis and
Nicola Ferro},
title = {URJC{\&}UNED at ImageCLEF 2013 Photo Annotation Task},
booktitle = {Working Notes for {CLEF} 2013 Conference , Valencia, Spain, September
23-26, 2013},
series = {{CEUR} Workshop Proceedings},
volume = {1179},
publisher = {CEUR-WS.org},
year = {2013},
url = {https://ceur-ws.org/Vol-1179/CLEF2013wn-ImageCLEF-SanchezOroEt2013.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:37 +0100},
biburl = {https://dblp.org/rec/conf/clef/Sanchez-OroMMPDFM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/AbrahamR13,
author = {Joanna Abraham and
Madhu C. Reddy},
editor = {Amy S. Bruckman and
Scott Counts and
Cliff Lampe and
Loren G. Terveen},
title = {Re-coordinating activities: an investigation of articulation work
in patient transfers},
booktitle = {Computer Supported Cooperative Work, {CSCW} 2013, San Antonio, TX,
USA, February 23-27, 2013},
pages = {67--78},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2441776.2441787},
doi = {10.1145/2441776.2441787},
timestamp = {Tue, 15 Sep 2020 08:36:55 +0200},
biburl = {https://dblp.org/rec/conf/cscw/AbrahamR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eewc/AbrahamTW13,
author = {Ralf Abraham and
Jos{\'{e}} Tribolet and
Robert Winter},
editor = {Henderik Alex Proper and
David Aveiro and
Khaled Gaaloul},
title = {Transformation of Multi-level Systems - Theoretical Grounding and
Consequences for Enterprise Architecture Management},
booktitle = {Advances in Enterprise Engineering {VII} - Third Enterprise Engineering
Working Conference, {EEWC} 2013, Luxembourg, May 13-14, 2013. Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {146},
pages = {73--87},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38117-1\_6},
doi = {10.1007/978-3-642-38117-1\_6},
timestamp = {Fri, 09 Apr 2021 18:44:45 +0200},
biburl = {https://dblp.org/rec/conf/eewc/AbrahamTW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/GovilAWSPCP13,
author = {Nikhil Govil and
Abraham Akinin and
Samuel Ward and
Joseph Snider and
Markus Plank and
Gert Cauwenberghs and
Howard Poizner},
title = {The role of proprioceptive feedback in Parkinsonian resting tremor},
booktitle = {35th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2013, Osaka, Japan, July 3-7,
2013},
pages = {4969--4972},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/EMBC.2013.6610663},
doi = {10.1109/EMBC.2013.6610663},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/GovilAWSPCP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurospi/LaantiSA13,
author = {Maarit Laanti and
Jouni Simil{\"{a}} and
Pekka Abrahamsson},
editor = {Fergal McCaffery and
Rory V. O'Connor and
Richard Messnarz},
title = {Definitions of Agile Software Development and Agility},
booktitle = {Systems, Software and Services Process Improvement - 20th European
Conference, EuroSPI 2013, Dundalk, Ireland, June 25-27, 2013. Proceedings},
series = {Communications in Computer and Information Science},
volume = {364},
pages = {247--258},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39179-8\_22},
doi = {10.1007/978-3-642-39179-8\_22},
timestamp = {Thu, 14 Oct 2021 10:01:50 +0200},
biburl = {https://dblp.org/rec/conf/eurospi/LaantiSA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ftscs/NellenA0C13,
author = {Johanna Nellen and
Erika {\'{A}}brah{\'{a}}m and
Xin Chen and
Pieter Collins},
editor = {Cyrille Artho and
Peter Csaba {\"{O}}lveczky},
title = {Counterexample Generation for Hybrid Automata},
booktitle = {Formal Techniques for Safety-Critical Systems - Second International
Workshop, {FTSCS} 2013, Queenstown, New Zealand, October 29-30, 2013.
Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {419},
pages = {88--106},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-05416-2\_7},
doi = {10.1007/978-3-319-05416-2\_7},
timestamp = {Fri, 02 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ftscs/NellenA0C13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/TruebaPB13,
author = {Pedro Trueba and
Abraham Prieto and
Francisco Bellas},
editor = {Christian Blum and
Enrique Alba},
title = {Distributed embodied evolution for collective tasks: parametric analysis
of a canonical algorithm},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} '13, Amsterdam,
The Netherlands, July 6-10, 2013, Companion Material Proceedings},
pages = {37--38},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2464576.2464595},
doi = {10.1145/2464576.2464595},
timestamp = {Wed, 13 Jul 2022 16:15:15 +0200},
biburl = {https://dblp.org/rec/conf/gecco/TruebaPB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/RothLRM13,
author = {Joseph Roth and
Xiaoming Liu and
Arun Ross and
Dimitris N. Metaxas},
editor = {Julian Fi{\'{e}}rrez and
Ajay Kumar and
Mayank Vatsa and
Raymond N. J. Veldhuis and
Javier Ortega{-}Garcia},
title = {Biometric authentication via keystroke sound},
booktitle = {International Conference on Biometrics, {ICB} 2013, 4-7 June, 2013,
Madrid, Spain},
pages = {1--8},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICB.2013.6613015},
doi = {10.1109/ICB.2013.6613015},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icb/RothLRM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccve/Valdez-Resendiz13,
author = {Jesus Elias Valdez{-}Resendiz and
Abraham Claudio{-}Sanchez and
Gerardo Vicente Guerrero{-}Ram{\'{\i}}rez and
Carlos Aguilar{-}Castillo and
Alejandro Tapia{-}Hern{\'{a}}ndez and
Josefa Gordillo{-}Estrada},
title = {Interleaved high-gain boost converter with low input-current ripple
for fuel cell electric vehicle applications},
booktitle = {International Conference on Connected Vehicles and Expo, {ICCVE} 2012,
Las Vegas, NV, USA, December 2-6, 2013},
pages = {812--817},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICCVE.2013.6799904},
doi = {10.1109/ICCVE.2013.6799904},
timestamp = {Thu, 09 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccve/Valdez-Resendiz13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/PriegoVCAPD13,
author = {Blanca Maria Priego Torres and
Miguel Angel Veganzones and
Jocelyn Chanussot and
Carole Amiot and
Abraham Prieto and
Richard J. Duro},
title = {Spatio-temporal cellular automata-based filtering for image sequence
denoising: Application to fluoroscopic sequences},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2013,
Melbourne, Australia, September 15-18, 2013},
pages = {548--552},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICIP.2013.6738113},
doi = {10.1109/ICIP.2013.6738113},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/PriegoVCAPD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/Vega-BrownBBKR13,
author = {William Vega{-}Brown and
Abraham Bachrach and
Adam Bry and
Jonathan Kelly and
Nicholas Roy},
title = {{CELLO:} {A} fast algorithm for Covariance Estimation},
booktitle = {2013 {IEEE} International Conference on Robotics and Automation, Karlsruhe,
Germany, May 6-10, 2013},
pages = {3160--3167},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICRA.2013.6631017},
doi = {10.1109/ICRA.2013.6631017},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/Vega-BrownBBKR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isgt/AbdollahyMCEJ13,
author = {Shahin Abdollahy and
Andrea Mammoli and
Feng Cheng and
Abraham Ellis and
Jay Johnson},
title = {Distributed compensation of a large intermittent energy resource in
a distribution feeder},
booktitle = {{IEEE} {PES} Innovative Smart Grid Technologies Conference, {ISGT}
2013, Washington, DC, USA, February 24-27, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISGT.2013.6497911},
doi = {10.1109/ISGT.2013.6497911},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isgt/AbdollahyMCEJ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/Sanchez-LopezMM13,
author = {Carlos S{\'{a}}nchez{-}L{\'{o}}pez and
Jorge Mendoza{-}Lopez and
Carlos Mu{\~{n}}iz{-}Montero and
Luis Abraham S{\'{a}}nchez{-}Gaspariano and
Jes{\'{u}}s M. Mu{\~{n}}oz{-}Pacheco},
title = {Accuracy vs simulation speed trade-off enhancements in the generation
of chaotic attractors},
booktitle = {4th {IEEE} Latin American Symposium on Circuits and Systems, {LASCAS}
2013, Cusco, Peru, February 27 - March 1, 2013},
pages = {1--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/LASCAS.2013.6518988},
doi = {10.1109/LASCAS.2013.6518988},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lascas/Sanchez-LopezMM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pods/AbouziedAPHS13,
author = {Azza Abouzied and
Dana Angluin and
Christos H. Papadimitriou and
Joseph M. Hellerstein and
Avi Silberschatz},
editor = {Richard Hull and
Wenfei Fan},
title = {Learning and verifying quantified boolean queries by example},
booktitle = {Proceedings of the 32nd {ACM} {SIGMOD-SIGACT-SIGART} Symposium on
Principles of Database Systems, {PODS} 2013, New York, NY, {USA} -
June 22 - 27, 2013},
pages = {49--60},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2463664.2465220},
doi = {10.1145/2463664.2465220},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pods/AbouziedAPHS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/premi/VargheseBVP13,
author = {Abraham Varghese and
Kannan Balakrishnan and
Reji Rajan Varghese and
Joseph S. Paul},
editor = {Pradipta Maji and
Ashish Ghosh and
M. Narasimha Murty and
Kuntal Ghosh and
Sankar K. Pal},
title = {Content Based Image Retrieval of {T2} Weighted Brain {MR} Images Similar
to {T1} Weighted Images},
booktitle = {Pattern Recognition and Machine Intelligence - 5th International Conference,
PReMI 2013, Kolkata, India, December 10-14, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8251},
pages = {474--481},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-45062-4\_65},
doi = {10.1007/978-3-642-45062-4\_65},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/premi/VargheseBVP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qest/WimmerJVAKB13,
author = {Ralf Wimmer and
Nils Jansen and
Andreas Vorpahl and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen and
Bernd Becker},
editor = {Kaustubh R. Joshi and
Markus Siegle and
Mari{\"{e}}lle Stoelinga and
Pedro R. D'Argenio},
title = {High-Level Counterexamples for Probabilistic Automata},
booktitle = {Quantitative Evaluation of Systems - 10th International Conference,
{QEST} 2013, Buenos Aires, Argentina, August 27-30, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8054},
pages = {39--54},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40196-1\_4},
doi = {10.1007/978-3-642-40196-1\_4},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qest/WimmerJVAKB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/services/ChebotkoABPKL13,
author = {Artem Chebotko and
John Abraham and
Pearl Brazier and
Anthony Piazza and
Andrey Kashlev and
Shiyong Lu},
title = {Storing, Indexing and Querying Large Provenance Data Sets as {RDF}
Graphs in Apache HBase},
booktitle = {{IEEE} Ninth World Congress on Services, {SERVICES} 2013, Santa Clara,
CA, USA, June 28 - July 3, 2013},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/SERVICES.2013.32},
doi = {10.1109/SERVICES.2013.32},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/services/ChebotkoABPKL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socpar/JoteBKA13,
author = {Netsanet Jote and
Birhanu Beshah and
Daniel Kitaw and
Ajith Abraham},
title = {AHP-based micro and small enterprises' cluster identification},
booktitle = {2013 International Conference on Soft Computing and Pattern Recognition,
SoCPaR 2013, Hanoi, Vietnam, December 15-18, 2013},
pages = {225--231},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/SOCPAR.2013.7054132},
doi = {10.1109/SOCPAR.2013.7054132},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/socpar/JoteBKA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsid/HanYA13,
author = {Kihyuk Han and
Joon{-}Sung Yang and
Jacob A. Abraham},
title = {Dynamic Trace Signal Selection for Post-Silicon Validation},
booktitle = {26th International Conference on {VLSI} Design and 12th International
Conference on Embedded Systems, Pune, India, January 5-10, 2013},
pages = {302--307},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/VLSID.2013.205},
doi = {10.1109/VLSID.2013.205},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsid/HanYA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/HanYA13,
author = {Kihyuk Han and
Joon{-}Sung Yang and
Jacob A. Abraham},
title = {Enhanced algorithm of combining trace and scan signals in post-silicon
validation},
booktitle = {31st {IEEE} {VLSI} Test Symposium, {VTS} 2013, Berkeley, CA, USA,
April 29 - May 2, 2013},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/VTS.2013.6548915},
doi = {10.1109/VTS.2013.6548915},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vts/HanYA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wdag/AbrahamDH13,
author = {Ittai Abraham and
Danny Dolev and
Joseph Y. Halpern},
editor = {Yehuda Afek},
title = {Distributed Protocols for Leader Election: {A} Game-Theoretic Perspective},
booktitle = {Distributed Computing - 27th International Symposium, {DISC} 2013,
Jerusalem, Israel, October 14-18, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8205},
pages = {61--75},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-41527-2\_5},
doi = {10.1007/978-3-642-41527-2\_5},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/wdag/AbrahamDH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/PantrigoD13,
author = {Juan Jos{\'{e}} Pantrigo and
Abraham Duarte},
editor = {Enrique Alba and
Amir Nakib and
Patrick Siarry},
title = {Low-Level Hybridization of Scatter Search and Particle Filter for
Dynamic {TSP} Solving},
booktitle = {Metaheuristics for Dynamic Optimization},
series = {Studies in Computational Intelligence},
volume = {433},
pages = {291--308},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-30665-5\_13},
doi = {10.1007/978-3-642-30665-5\_13},
timestamp = {Wed, 13 Jul 2022 16:15:19 +0200},
biburl = {https://dblp.org/rec/series/sci/PantrigoD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/softcomp/2012s,
editor = {{\'{A}}lvaro Herrero and
V{\'{a}}clav Sn{\'{a}}sel and
Ajith Abraham and
Ivan Zelinka and
Bruno Baruque and
H{\'{e}}ctor Quinti{\'{a}}n{-}Pardo and
Jos{\'{e}} Lu{\'{\i}}s Calvo{-}Rolle and
Javier Sedano and
Emilio Corchado},
title = {International Joint Conference CISIS'12-ICEUTE'12-SOCO'12 Special
Sessions, Ostrava, Czech Republic, September 5th-7th, 2012},
series = {Advances in Intelligent Systems and Computing},
volume = {189},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-33018-6},
doi = {10.1007/978-3-642-33018-6},
isbn = {978-3-642-33017-9},
timestamp = {Fri, 12 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/softcomp/2012s.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AbrahamssonKSL13,
author = {Pekka Abrahamsson and
Karlheinz Kautz and
Heikki Sieppi and
Jouni Lappalainen},
title = {Improving Software Developer's Competence: Is the Personal Software
Process Working?},
journal = {CoRR},
volume = {abs/1311.0228},
year = {2013},
url = {http://arxiv.org/abs/1311.0228},
eprinttype = {arXiv},
eprint = {1311.0228},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/AbrahamssonKSL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JansenCVWAKB13,
author = {Nils Jansen and
Florian Corzilius and
Matthias Volk and
Ralf Wimmer and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen and
Bernd Becker},
title = {Accelerating Parametric Probabilistic Verification},
journal = {CoRR},
volume = {abs/1312.3979},
year = {2013},
url = {http://arxiv.org/abs/1312.3979},
eprinttype = {arXiv},
eprint = {1312.3979},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/JansenCVWAKB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1304-4303,
author = {Azza Abouzied and
Dana Angluin and
Christos H. Papadimitriou and
Joseph M. Hellerstein and
Avi Silberschatz},
title = {Learning and Verifying Quantified Boolean Queries by Example},
journal = {CoRR},
volume = {abs/1304.4303},
year = {2013},
url = {http://arxiv.org/abs/1304.4303},
eprinttype = {arXiv},
eprint = {1304.4303},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1304-4303.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/anor/PantrigoMDP12,
author = {Juan Jos{\'{e}} Pantrigo and
Rafael Mart{\'{\i}} and
Abraham Duarte and
Eduardo G. Pardo},
title = {Scatter search for the cutwidth minimization problem},
journal = {Ann. Oper. Res.},
volume = {199},
number = {1},
pages = {285--304},
year = {2012},
url = {https://doi.org/10.1007/s10479-011-0907-2},
doi = {10.1007/S10479-011-0907-2},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/anor/PantrigoMDP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/LadoMLOV12,
author = {Mar{\'{\i}}a J. Lado and
Arturo J. M{\'{e}}ndez and
Leandro Rodr{\'{\i}}guez Li{\~{n}}ares and
Abraham Otero and
Xos{\'{e}} Ant{\'{o}}n Vila{-}Sobrino},
title = {Nocturnal evolution of heart rate variability indices in sleep apnea},
journal = {Comput. Biol. Medicine},
volume = {42},
number = {12},
pages = {1179--1185},
year = {2012},
url = {https://doi.org/10.1016/j.compbiomed.2012.09.009},
doi = {10.1016/J.COMPBIOMED.2012.09.009},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/LadoMLOV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/DuarteEMMPS12,
author = {Abraham Duarte and
Laureano F. Escudero and
Rafael Mart{\'{\i}} and
Nenad Mladenovic and
Juan Jos{\'{e}} Pantrigo and
Jes{\'{u}}s S{\'{a}}nchez{-}Oro},
title = {Variable neighborhood search for the Vertex Separation Problem},
journal = {Comput. Oper. Res.},
volume = {39},
number = {12},
pages = {3247--3255},
year = {2012},
url = {https://doi.org/10.1016/j.cor.2012.04.017},
doi = {10.1016/J.COR.2012.04.017},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/DuarteEMMPS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/endm/PardoMPD12,
author = {Eduardo G. Pardo and
Nenad Mladenovic and
Juan Jos{\'{e}} Pantrigo and
Abraham Duarte},
title = {A Variable Neighbourhood Search approach to the Cutwidth Minimization
Problem},
journal = {Electron. Notes Discret. Math.},
volume = {39},
pages = {67--74},
year = {2012},
url = {https://doi.org/10.1016/j.endm.2012.10.010},
doi = {10.1016/J.ENDM.2012.10.010},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/endm/PardoMPD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ese/EkanayakeTGB12,
author = {Jayalath Ekanayake and
Jonas Tappolet and
Harald C. Gall and
Abraham Bernstein},
title = {Time variance and defect prediction in software projects - Towards
an exploitation of periods of stability and change as well as a notion
of concept drift in software projects},
journal = {Empir. Softw. Eng.},
volume = {17},
number = {4-5},
pages = {348--389},
year = {2012},
url = {https://doi.org/10.1007/s10664-011-9180-x},
doi = {10.1007/S10664-011-9180-X},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ese/EkanayakeTGB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/heuristics/LarusicPA12,
author = {John Larusic and
Abraham P. Punnen and
Eric Aubanel},
title = {Experimental analysis of heuristics for the bottleneck traveling salesman
problem},
journal = {J. Heuristics},
volume = {18},
number = {3},
pages = {473--503},
year = {2012},
url = {https://doi.org/10.1007/s10732-012-9194-6},
doi = {10.1007/S10732-012-9194-6},
timestamp = {Thu, 18 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/heuristics/LarusicPA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/japll/CorchadoASSCG12,
author = {Emilio Corchado and
Ajith Abraham and
V{\'{a}}clav Sn{\'{a}}sel and
Javier Sedano and
Jos{\'{e}} Lu{\'{\i}}s Calvo{-}Rolle and
Laura Garc{\'{\i}}a{-}Hernandez},
title = {Selected papers from the 6th International Conference on Soft Computing
Models in Industrial and Environmental Applications},
journal = {J. Appl. Log.},
volume = {10},
number = {4},
pages = {275--276},
year = {2012},
url = {https://doi.org/10.1016/j.jal.2012.04.004},
doi = {10.1016/J.JAL.2012.04.004},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/japll/CorchadoASSCG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/AbrahamKP12,
author = {Joanna Abraham and
Thomas George Kannampallil and
Vimla L. Patel},
title = {Bridging gaps in handoffs: {A} continuity of care based approach},
journal = {J. Biomed. Informatics},
volume = {45},
number = {2},
pages = {240--254},
year = {2012},
url = {https://doi.org/10.1016/j.jbi.2011.10.011},
doi = {10.1016/J.JBI.2011.10.011},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/AbrahamKP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/EggebrechtWFCZSDC12,
author = {Adam T. Eggebrecht and
Brian R. White and
Silvina L. Ferradal and
Chunxiao Chen and
Yuxuan Zhan and
Abraham Z. Snyder and
Hamid Dehghani and
Joseph P. Culver},
title = {A quantitative spatial comparison of high-density diffuse optical
tomography and fMRI cortical mapping},
journal = {NeuroImage},
volume = {61},
number = {4},
pages = {1120--1128},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.01.124},
doi = {10.1016/J.NEUROIMAGE.2012.01.124},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/EggebrechtWFCZSDC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/EssenUABBBCCCCPFGHHLMMMOPPSSSXY12,
author = {David C. Van Essen and
K{\^{a}}mil Ugurbil and
Edward J. Auerbach and
Deanna M. Barch and
T. E. J. Behrens and
R. Bucholz and
Acer Chang and
Liyong Chen and
Maurizio Corbetta and
Sandra W. Curtiss and
Stefania Della Penna and
David A. Feinberg and
Matthew F. Glasser and
Noam Harel and
A. C. Heath and
Linda J. Larson{-}Prior and
Daniel S. Marcus and
Georgios Michalareas and
Steen Moeller and
Robert Oostenveld and
Steven E. Petersen and
Fred W. Prior and
Bradley L. Schlaggar and
Stephen M. Smith and
Abraham Z. Snyder and
Junqian Xu and
Essa Yacoub},
title = {The Human Connectome Project: {A} data acquisition perspective},
journal = {NeuroImage},
volume = {62},
number = {4},
pages = {2222--2231},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.02.018},
doi = {10.1016/J.NEUROIMAGE.2012.02.018},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/EssenUABBBCCCCPFGHHLMMMOPPSSSXY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/MettenburgBSSS12,
author = {Joseph M. Mettenburg and
Tammie L. S. Benzinger and
Joshua S. Shimony and
Abraham Z. Snyder and
Yvette I. Sheline},
title = {Diminished performance on neuropsychological testing in late life
depression is correlated with microstructural white matter abnormalities},
journal = {NeuroImage},
volume = {60},
number = {4},
pages = {2182--2190},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.02.044},
doi = {10.1016/J.NEUROIMAGE.2012.02.044},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/MettenburgBSSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PowerBSSP12,
author = {Jonathan D. Power and
Kelly Anne Barnes and
Abraham Z. Snyder and
Bradley L. Schlaggar and
Steven E. Petersen},
title = {Spurious but systematic correlations in functional connectivity {MRI}
networks arise from subject motion},
journal = {NeuroImage},
volume = {59},
number = {3},
pages = {2142--2154},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2011.10.018},
doi = {10.1016/J.NEUROIMAGE.2011.10.018},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/PowerBSSP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PowerBSSP12a,
author = {Jonathan D. Power and
Kelly Anne Barnes and
Abraham Z. Snyder and
Bradley L. Schlaggar and
Steven E. Petersen},
title = {Corrigendum to "Spurious but systematic correlations in functional
connectivity {MRI} networks arise from subject motion" [NeuroImage
59 {(3)} {(2012)} 2142-2154]},
journal = {NeuroImage},
volume = {63},
number = {2},
pages = {999},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.01.069},
doi = {10.1016/J.NEUROIMAGE.2012.01.069},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/PowerBSSP12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/VerdejoMCMTMDPBRFGCVM12,
author = {Felisa Verdejo and
Raquel Mart{\'{\i}}nez{-}Unanue and
Pablo Castells and
Antonio Moreno{-}Sandoval and
Doroteo T. Toledano and
Paloma Mart{\'{\i}}nez and
Abraham Duarte and
Jos{\'{e}} Manuel Pardo and
Manuel Buenaga and
Juan Cigarr{\'{a}}n and
V{\'{\i}}ctor Fresno{-}Fern{\'{a}}ndez and
Ana Garc{\'{\i}}a{-}Serrano and
Iv{\'{a}}n Cantador and
David Vallet and
A. Mart{\'{\i}}nez},
title = {Mejorando el acceso, el an{\'{a}}lisis y la visibilidad de la
Informaci{\'{o}}n y los contenidos Multilingues y Multimedia
en Red para la Comunidad de Madrid},
journal = {Proces. del Leng. Natural},
volume = {49},
pages = {189--192},
year = {2012},
url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/4573},
timestamp = {Mon, 20 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pdln/VerdejoMCMTMDPBRFGCVM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/AbouziedHS12,
author = {Azza Abouzied and
Joseph M. Hellerstein and
Avi Silberschatz},
title = {Playful Query Specification with DataPlay},
journal = {Proc. {VLDB} Endow.},
volume = {5},
number = {12},
pages = {1938--1941},
year = {2012},
url = {http://vldb.org/pvldb/vol5/p1938\_azzaabouzied\_vldb2012.pdf},
doi = {10.14778/2367502.2367542},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pvldb/AbouziedHS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tem/FrishammarKAL12,
author = {Johan Frishammar and
Monika Kurkkio and
Lena Abrahamsson and
Ulrich Lichtenthaler},
title = {Antecedents and Consequences of Firms' Process Innovation Capability:
{A} Literature Review and a Conceptual Framework},
journal = {{IEEE} Trans. Engineering Management},
volume = {59},
number = {4},
pages = {519--529},
year = {2012},
url = {https://doi.org/10.1109/TEM.2012.2187660},
doi = {10.1109/TEM.2012.2187660},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tem/FrishammarKAL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkl/AbrahamsonGCNB12,
author = {Dor Abrahamson and
Jose Guti{\'{e}}rrez and
Timothy Charoenying and
Andrea Negrete and
Engin Bumbacher},
title = {Fostering Hooks and Shifts: Tutorial Tactics for Guided Mathematical
Discovery},
journal = {Technol. Knowl. Learn.},
volume = {17},
number = {1-2},
pages = {61--86},
year = {2012},
url = {https://doi.org/10.1007/s10758-012-9192-7},
doi = {10.1007/S10758-012-9192-7},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tkl/AbrahamsonGCNB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acity/VargheseVBP12,
author = {Abraham Varghese and
Reji Rajan Varghese and
Kannan Balakrishnan and
Joseph S. Paul},
editor = {Natarajan Meghanathan and
Dhinaharan Nagamalai and
Nabendu Chaki},
title = {Axial {T2} Weighted {MR} Brain Image Retrieval Using Moment Features},
booktitle = {Advances in Computing and Information Technology - Proceedings of
the Second International Conference on Advances in Computing and Information
Technology {(ACITY)} July 13-15, 2012, Chennai, India - Volume 2},
series = {Advances in Intelligent Systems and Computing},
volume = {177},
pages = {355--363},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-31552-7\_37},
doi = {10.1007/978-3-642-31552-7\_37},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acity/VargheseVBP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/AbrahamKPAP12,
author = {Joanna Abraham and
Thomas George Kannampallil and
Bela Patel and
Khalid F. Almoosa and
Vimla L. Patel},
title = {Ensuring Patient Safety in Care Transitions: An Empirical Evaluation
of a Handoff Intervention Tool},
booktitle = {{AMIA} 2012, American Medical Informatics Association Annual Symposium,
Chicago, Illinois, USA, November 3-7, 2012},
publisher = {{AMIA}},
year = {2012},
url = {https://knowledge.amia.org/amia-55142-a2012a-1.636547/t-003-1.640625/f-001-1.640626/a-007-1.641221},
timestamp = {Wed, 17 Apr 2024 11:48:03 +0200},
biburl = {https://dblp.org/rec/conf/amia/AbrahamKPAP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atva/JansenAVWKB12,
author = {Nils Jansen and
Erika {\'{A}}brah{\'{a}}m and
Matthias Volk and
Ralf Wimmer and
Joost{-}Pieter Katoen and
Bernd Becker},
editor = {Supratik Chakraborty and
Madhavan Mukund},
title = {The {COMICS} Tool - Computing Minimal Counterexamples for DTMCs},
booktitle = {Automated Technology for Verification and Analysis - 10th International
Symposium, {ATVA} 2012, Thiruvananthapuram, India, October 3-6, 2012.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7561},
pages = {349--353},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-33386-6\_27},
doi = {10.1007/978-3-642-33386-6\_27},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/atva/JansenAVWKB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/GarciaOVL12,
author = {Constantino A. Garc{\'{\i}}a and
Abraham Otero and
Xos{\'{e}} Ant{\'{o}}n Vila{-}Sobrino and
Mar{\'{\i}}a J. Lado},
editor = {Sabine Van Huffel and
Carlos Manuel B. A. Correia and
Ana L. N. Fred and
Hugo Gamboa},
title = {An Open Source Tool for Heart Rate Variability Wavelet-based Spectral
Analysis},
booktitle = {{BIOSIGNALS} 2012 - Proceedings of the International Conference on
Bio-inspired Systems and Signal Processing, Vilamoura, Algarve, Portugal,
1-4 February, 2012},
pages = {206--211},
publisher = {SciTePress},
year = {2012},
timestamp = {Thu, 07 Jul 2016 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biostec/GarciaOVL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/VilaMOLL12,
author = {Xos{\'{e}} Ant{\'{o}}n Vila{-}Sobrino and
Arturo J. M{\'{e}}ndez and
Abraham Otero and
Leandro Rodr{\'{\i}}guez Li{\~{n}}ares and
Mar{\'{\i}}a J. Lado},
editor = {Sabine Van Huffel and
Carlos Manuel B. A. Correia and
Ana L. N. Fred and
Hugo Gamboa},
title = {Heart Rate Variability in Siesta Polysomnograms - {A} Preliminary
Study},
booktitle = {{BIOSIGNALS} 2012 - Proceedings of the International Conference on
Bio-inspired Systems and Signal Processing, Vilamoura, Algarve, Portugal,
1-4 February, 2012},
pages = {334--337},
publisher = {SciTePress},
year = {2012},
timestamp = {Thu, 07 Jul 2016 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biostec/VilaMOLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/Sanchez-OroMMCMPDFM12,
author = {Jes{\'{u}}s S{\'{a}}nchez{-}Oro and
Soto Montalvo and
Antonio S. Montemayor and
Ra{\'{u}}l Cabido and
Juan Jos{\'{e}} Pantrigo and
Abraham Duarte and
V{\'{\i}}ctor Fresno and
Raquel Mart{\'{\i}}nez{-}Unanue},
editor = {Pamela Forner and
Jussi Karlgren and
Christa Womser{-}Hacker},
title = {URJCyUNED at ImageCLEF 2012 Photo Annotation Task},
booktitle = {{CLEF} 2012 Evaluation Labs and Workshop, Online Working Notes, Rome,
Italy, September 17-20, 2012},
series = {{CEUR} Workshop Proceedings},
volume = {1178},
publisher = {CEUR-WS.org},
year = {2012},
url = {https://ceur-ws.org/Vol-1178/CLEF2012wn-ImageCLEF-SanchezOroEt2012.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:42 +0100},
biburl = {https://dblp.org/rec/conf/clef/Sanchez-OroMMCMPDFM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clei/DavilaBGMASP12,
author = {Abraham D{\'{a}}vila and
Carla Basurto and
Luis Alberto Flores Garc{\'{\i}}a and
Rita Manrique and
Robert Arisaca and
Jorge Sanchez and
Marcelo Schneck de Paula Pess{\^{o}}a},
title = {The peruvian component of Competisoft project: Lesson learned from
academic perspective},
booktitle = {2012 {XXXVIII} Conferencia Latinoamericana En Informatica (CLEI),
Medellin, Colombia, October 1-5, 2012},
pages = {1--7},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/CLEI.2012.6427139},
doi = {10.1109/CLEI.2012.6427139},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/clei/DavilaBGMASP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecai/KietzSBF12,
author = {J{\"{o}}rg{-}Uwe Kietz and
Floarea Serban and
Abraham Bernstein and
Simon Fischer},
editor = {Luc De Raedt and
Christian Bessiere and
Didier Dubois and
Patrick Doherty and
Paolo Frasconi and
Fredrik Heintz and
Peter J. F. Lucas},
title = {Designing KDD-Workflows via HTN-Planning},
booktitle = {{ECAI} 2012 - 20th European Conference on Artificial Intelligence.
Including Prestigious Applications of Artificial Intelligence {(PAIS-2012)}
System Demonstrations Track, Montpellier, France, August 27-31 , 2012},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {242},
pages = {1011--1012},
publisher = {{IOS} Press},
year = {2012},
url = {https://doi.org/10.3233/978-1-61499-098-7-1011},
doi = {10.3233/978-1-61499-098-7-1011},
timestamp = {Mon, 19 Jun 2023 16:36:09 +0200},
biburl = {https://dblp.org/rec/conf/ecai/KietzSBF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euroitv/MurrayGACCDK12,
author = {Janet H. Murray and
Sergio Goldenberg and
Kartik Agarwal and
Tarun Chakravorty and
Jonathan Cutrell and
Abraham Doris{-}Down and
Harish Kothandaraman},
editor = {Stefan Arbanowski and
Stephan Steglich and
Hendrik Knoche and
Jan He{\ss}},
title = {Story-map: iPad companion for long form {TV} narratives},
booktitle = {10th European Conference on Interactive {TV} and Video, EuroITV '12,
Berlin, Germany, July 4-6, 2012},
pages = {223--226},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2325616.2325659},
doi = {10.1145/2325616.2325659},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euroitv/MurrayGACCDK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/TruebaPBCD12,
author = {Pedro Trueba and
Abraham Prieto and
Francisco Bellas and
Pilar Caama{\~{n}}o and
Richard J. Duro},
editor = {Cecilia Di Chio and
Alexandros Agapitos and
Stefano Cagnoni and
Carlos Cotta and
Francisco Fern{\'{a}}ndez de Vega and
Gianni A. Di Caro and
Rolf Drechsler and
Anik{\'{o}} Ek{\'{a}}rt and
Anna Isabel Esparcia{-}Alc{\'{a}}zar and
Muddassar Farooq and
William B. Langdon and
Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Mike Preuss and
Hendrik Richter and
Sara Silva and
Anabela Sim{\~{o}}es and
Giovanni Squillero and
Ernesto Tarantino and
Andrea Tettamanzi and
Julian Togelius and
Neil Urquhart and
Sima Uyar and
Georgios N. Yannakakis},
title = {Self-organization and Specialization in Multiagent Systems through
Open-Ended Natural Evolution},
booktitle = {Applications of Evolutionary Computation - EvoApplications 2012: EvoCOMNET,
EvoCOMPLEX, EvoFIN, EvoGAMES, EvoHOT, EvoIASP, EvoNUM, EvoPAR, EvoRISK,
EvoSTIM, and EvoSTOC, M{\'{a}}laga, Spain, April 11-13, 2012,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7248},
pages = {93--102},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-29178-4\_10},
doi = {10.1007/978-3-642-29178-4\_10},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/evoW/TruebaPBCD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/facs2/JansenAZWSKB12,
author = {Nils Jansen and
Erika {\'{A}}brah{\'{a}}m and
Barna Zajzon and
Ralf Wimmer and
Johann Schuster and
Joost{-}Pieter Katoen and
Bernd Becker},
editor = {Corina S. Pasareanu and
Gwen Sala{\"{u}}n},
title = {Symbolic Counterexample Generation for Discrete-Time Markov Chains},
booktitle = {Formal Aspects of Component Software, 9th International Symposium,
{FACS} 2012, Mountain View, CA, USA, September 12-14, 2012. Revised
Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {7684},
pages = {134--151},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-35861-6\_9},
doi = {10.1007/978-3-642-35861-6\_9},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/facs2/JansenAZWSKB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/RossJSBKBHPP12,
author = {Arun Ross and
Raghavender R. Jillela and
Jonathon M. Smereka and
Vishnu Naresh Boddeti and
B. V. K. Vijaya Kumar and
Ryan Barnard and
Xiaofei Hu and
Victor Pa{\'{u}}l Pauca and
Robert J. Plemmons},
editor = {Anil K. Jain and
Arun Ross and
Salil Prabhakar and
Jaihie Kim},
title = {Matching highly non-ideal ocular images: An information fusion approach},
booktitle = {5th {IAPR} International Conference on Biometrics, {ICB} 2012, New
Delhi, India, March 29 - April 1, 2012},
pages = {446--453},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICB.2012.6199791},
doi = {10.1109/ICB.2012.6199791},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/RossJSBKBHPP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/AuradkarBDMFGGGGHKKKLNNPPQQRSSSSSSSSTTVWWZZ12,
author = {Aditya Auradkar and
Chavdar Botev and
Shirshanka Das and
Dave De Maagd and
Alex Feinberg and
Phanindra Ganti and
Lei Gao and
Bhaskar Ghosh and
Kishore Gopalakrishna and
Brendan Harris and
Joel Koshy and
Kevin Krawez and
Jay Kreps and
Shi Lu and
Sunil Nagaraj and
Neha Narkhede and
Sasha Pachev and
Igor Perisic and
Lin Qiao and
Tom Quiggle and
Jun Rao and
Bob Schulman and
Abraham Sebastian and
Oliver Seeliger and
Adam Silberstein and
Boris Shkolnik and
Chinmay Soman and
Roshan Sumbaly and
Kapil Surlaker and
Sajid Topiwala and
Cuong Tran and
Balaji Varadarajan and
Jemiah Westerman and
Zach White and
David Zhang and
Jason Zhang},
editor = {Anastasios Kementsietsidis and
Marcos Antonio Vaz Salles},
title = {Data Infrastructure at LinkedIn},
booktitle = {{IEEE} 28th International Conference on Data Engineering {(ICDE} 2012),
Washington, DC, {USA} (Arlington, Virginia), 1-5 April, 2012},
pages = {1370--1381},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICDE.2012.147},
doi = {10.1109/ICDE.2012.147},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icde/AuradkarBDMFGGGGHKKKLNNPPQQRSSSSSSSSTTVWWZZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icinco/PezeshkianNH12,
author = {Narek Pezeshkian and
Joseph D. Neff and
Abraham Hart},
editor = {Jean{-}Louis Ferrier and
Alain Bernard and
Oleg Yu. Gusikhin and
Kurosh Madani},
title = {Link Quality Estimator for a Mobile Robot},
booktitle = {{ICINCO} 2012 - Proceedings of the 9th International Conference on
Informatics in Control, Automation and Robotics, Volume 2, Rome, Italy,
28 - 31 July, 2012},
pages = {87--94},
publisher = {SciTePress},
year = {2012},
timestamp = {Sun, 02 Sep 2012 19:28:24 +0200},
biburl = {https://dblp.org/rec/conf/icinco/PezeshkianNH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icls/AbrahamsonPDJBK12,
author = {Dor Abrahamson and
Carmen Petrick and
David DeLiema and
Mina C. Johnson{-}Glenberg and
David Birchfield and
Tatyana Koziupa and
Caroline Savio{-}Ramos and
Julie Cruse and
Robb Lindgren and
Cameron L. Fadjo and
John B. Black and
Michael Eisenberg},
editor = {Michael J. Jacobson and
Peter Reimann},
title = {You're It! Body, Action, and Object in {STEM} Learning},
booktitle = {The Future of Learning: Proceedings of the 10th International Conference
of the Learning Sciences, {ICLS} 2012, Sydney, Australia, July 2-6,
2012},
publisher = {International Society of the Learning Sciences},
year = {2012},
url = {https://repository.isls.org/handle/1/2391},
timestamp = {Wed, 28 Apr 2021 17:11:51 +0200},
biburl = {https://dblp.org/rec/conf/icls/AbrahamsonPDJBK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itaero/IshiharaNLBK12,
author = {Abraham K. Ishihara and
Nhan Nguyen and
Yi Luo and
Jose Benavides and
John Kaneshige},
title = {A Robust Initialization Scheme for a Lateral Trajectory Optimization
Problem with Guaranteed Arrival Time Windows},
booktitle = {Infotech@Aerospace 2012, Garden Grove, California, USA, June 19-21,
2012},
year = {2012},
url = {https://doi.org/10.2514/6.2012-2515},
doi = {10.2514/6.2012-2515},
timestamp = {Fri, 05 May 2017 13:12:21 +0200},
biburl = {https://dblp.org/rec/conf/itaero/IshiharaNLBK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mbmv/NellenA12,
author = {Johanna Nellen and
Erika {\'{A}}brah{\'{a}}m},
editor = {Jens Brandt and
Klaus Schneider},
title = {Hybrid Sequential Function Charts},
booktitle = {Methoden und Beschreibungssprachen zur Modellierung und Verifikation
von Schaltungen und Systemen (MBMV), Kaiserslautern, Germany, March
5-7, 2012},
series = {Forschungsergebnisse zur Informatik},
volume = {68},
pages = {109--120},
publisher = {Verlag Dr. Kovac},
year = {2012},
timestamp = {Tue, 19 May 2020 12:57:43 +0200},
biburl = {https://dblp.org/rec/conf/mbmv/NellenA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mbmv/WimmerBJAK12,
author = {Ralf Wimmer and
Bernd Becker and
Nils Jansen and
Erika {\'{A}}brah{\'{a}}m and
Joost{-}Pieter Katoen},
editor = {Jens Brandt and
Klaus Schneider},
title = {Minimal Critical Subsystems as Counterexamples for omega-Regular {DTMC}
Properties},
booktitle = {Methoden und Beschreibungssprachen zur Modellierung und Verifikation
von Schaltungen und Systemen (MBMV), Kaiserslautern, Germany, March
5-7, 2012},
series = {Forschungsergebnisse zur Informatik},
volume = {68},
pages = {169--180},
publisher = {Verlag Dr. Kovac},
year = {2012},
timestamp = {Fri, 26 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mbmv/WimmerBJAK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/seke/PittoliSN12,
author = {F{\'{a}}bio Pittoli and
Abraham L. R. de Sousa and
Daltro J. Nunes},
title = {Investigating the Use of Bayesian Networks as a Support Tool for Monitoring
Software Projects},
booktitle = {Proceedings of the 24th International Conference on Software Engineering
{\&} Knowledge Engineering (SEKE'2012), Hotel Sofitel, Redwood
City, San Francisco Bay, {USA} July 1-3, 2012},
pages = {570--573},
publisher = {Knowledge Systems Institute Graduate School},
year = {2012},
timestamp = {Thu, 12 Mar 2020 11:30:50 +0100},
biburl = {https://dblp.org/rec/conf/seke/PittoliSN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/simutools/AbrahamR12,
author = {John Abraham and
George F. Riley},
editor = {George F. Riley and
Francesco Quaglia and
Jan Himmelspach},
title = {Simulator-agnostic ns-3 applications},
booktitle = {International {ICST} Conference on Simulation Tools and Techniques,
{SIMUTOOLS} '12, Sirmione-Desenzano, Italy, March 19-23, 2012},
pages = {391--396},
publisher = {{ICST/ACM}},
year = {2012},
url = {https://doi.org/10.4108/icst.simutools.2012.247744},
doi = {10.4108/ICST.SIMUTOOLS.2012.247744},
timestamp = {Fri, 28 Feb 2020 13:12:27 +0100},
biburl = {https://dblp.org/rec/conf/simutools/AbrahamR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/snds/JobinV12,
author = {Abraham Jobin and
Paul Varghese},
editor = {Sabu M. Thampi and
Albert Y. Zomaya and
Thorsten Strufe and
Jos{\'{e}} M. Alcaraz Calero and
Tony Thomas},
title = {Imperceptible Image Indexing Using Digital Watermarking},
booktitle = {Recent Trends in Computer Networks and Distributed Systems Security
- International Conference, {SNDS} 2012, Trivandrum, India, October
11-12, 2012. Proceedings},
series = {Communications in Computer and Information Science},
volume = {335},
pages = {110--116},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-34135-9\_11},
doi = {10.1007/978-3-642-34135-9\_11},
timestamp = {Wed, 24 Apr 2024 14:55:54 +0200},
biburl = {https://dblp.org/rec/conf/snds/JobinV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tacas/WimmerJABK12,
author = {Ralf Wimmer and
Nils Jansen and
Erika {\'{A}}brah{\'{a}}m and
Bernd Becker and
Joost{-}Pieter Katoen},
editor = {Cormac Flanagan and
Barbara K{\"{o}}nig},
title = {Minimal Critical Subsystems for Discrete-Time Markov Models},
booktitle = {Tools and Algorithms for the Construction and Analysis of Systems
- 18th International Conference, {TACAS} 2012, Held as Part of the
European Joint Conferences on Theory and Practice of Software, {ETAPS}
2012, Tallinn, Estonia, March 24 - April 1, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7214},
pages = {299--314},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-28756-5\_21},
doi = {10.1007/978-3-642-28756-5\_21},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tacas/WimmerJABK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/AbouziedHS12,
author = {Azza Abouzied and
Joseph M. Hellerstein and
Avi Silberschatz},
editor = {Rob Miller and
Hrvoje Benko and
Celine Latulipe},
title = {DataPlay: interactive tweaking and example-driven correction of graphical
database queries},
booktitle = {The 25th Annual {ACM} Symposium on User Interface Software and Technology,
{UIST} '12, Cambridge, MA, USA, October 7-10, 2012},
pages = {207--218},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2380116.2380144},
doi = {10.1145/2380116.2380144},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uist/AbouziedHS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/semweb/2012-1,
editor = {Philippe Cudr{\'{e}}{-}Mauroux and
Jeff Heflin and
Evren Sirin and
Tania Tudorache and
J{\'{e}}r{\^{o}}me Euzenat and
Manfred Hauswirth and
Josiane Xavier Parreira and
Jim Hendler and
Guus Schreiber and
Abraham Bernstein and
Eva Blomqvist},
title = {The Semantic Web - {ISWC} 2012 - 11th International Semantic Web Conference,
Boston, MA, USA, November 11-15, 2012, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {7649},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-35176-1},
doi = {10.1007/978-3-642-35176-1},
isbn = {978-3-642-35175-4},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/semweb/2012-1.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/semweb/2012-2,
editor = {Philippe Cudr{\'{e}}{-}Mauroux and
Jeff Heflin and
Evren Sirin and
Tania Tudorache and
J{\'{e}}r{\^{o}}me Euzenat and
Manfred Hauswirth and
Josiane Xavier Parreira and
Jim Hendler and
Guus Schreiber and
Abraham Bernstein and
Eva Blomqvist},
title = {The Semantic Web - {ISWC} 2012 - 11th International Semantic Web Conference,
Boston, MA, USA, November 11-15, 2012, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {7650},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-35173-0},
doi = {10.1007/978-3-642-35173-0},
isbn = {978-3-642-35172-3},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/semweb/2012-2.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1206-0603,
author = {Nils Jansen and
Erika {\'{A}}brah{\'{a}}m and
Maik Scheffler and
Matthias Volk and
Andreas Vorpahl and
Ralf Wimmer and
Joost{-}Pieter Katoen and
Bernd Becker},
title = {The {COMICS} Tool - Computing Minimal Counterexamples for Discrete-time
Markov Chains},
journal = {CoRR},
volume = {abs/1206.0603},
year = {2012},
url = {http://arxiv.org/abs/1206.0603},
eprinttype = {arXiv},
eprint = {1206.0603},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1206-0603.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/GoudeyWRZKMMASIHK11,
author = {Benjamin Goudey and
Qiao Wang and
Dave Rawlinson and
Armita Zarnegar and
Eder Kikianty and
John Markham and
Geoff MacIntyre and
Gad Abraham and
Linda Stern and
Michael Inouye and
Izhak Haviv and
Adam Kowalczyk},
title = {Replication of epistatic {DNA} loci in two case-control {GWAS} studies
using {OPE} algorithm},
journal = {{BMC} Bioinform.},
volume = {12},
number = {{S-11}},
pages = {A5},
year = {2011},
url = {https://doi.org/10.1186/1471-2105-12-S11-A5},
doi = {10.1186/1471-2105-12-S11-A5},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/GoudeyWRZKMMASIHK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/TouchBDFFJMMPRR11,
author = {Joseph D. Touch and
Ilia Baldine and
Rudra Dutta and
Gregory G. Finn and
Bryan Ford and
Scott Jordan and
Daniel Massey and
Abraham Matta and
Christos Papadopoulos and
Peter L. Reiher and
George N. Rouskas},
title = {A Dynamic Recursive Unified Internet Design {(DRUID)}},
journal = {Comput. Networks},
volume = {55},
number = {4},
pages = {919--935},
year = {2011},
url = {https://doi.org/10.1016/j.comnet.2010.12.016},
doi = {10.1016/J.COMNET.2010.12.016},
timestamp = {Sat, 25 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cn/TouchBDFFJMMPRR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/LarusicP11,
author = {John Larusic and
Abraham P. Punnen},
title = {The balanced traveling salesmanproblem},
journal = {Comput. Oper. Res.},
volume = {38},
number = {5},
pages = {868--875},
year = {2011},
url = {https://doi.org/10.1016/j.cor.2010.09.016},
doi = {10.1016/J.COR.2010.09.016},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/LarusicP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/KoABBBESLLMRRSW11,
author = {Amy J. Ko and
Robin Abraham and
Laura Beckwith and
Alan F. Blackwell and
Margaret M. Burnett and
Martin Erwig and
Christopher Scaffidi and
Joseph Lawrance and
Henry Lieberman and
Brad A. Myers and
Mary Beth Rosson and
Gregg Rothermel and
Mary Shaw and
Susan Wiedenbeck},
title = {The state of the art in end-user software engineering},
journal = {{ACM} Comput. Surv.},
volume = {43},
number = {3},
pages = {21:1--21:44},
year = {2011},
url = {https://doi.org/10.1145/1922649.1922658},
doi = {10.1145/1922649.1922658},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csur/KoABBBESLLMRRSW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/et/HanPLCBWOA11,
author = {Kihyuk Han and
Joonsung Park and
Jae Wook Lee and
Jaeyong Chung and
Eonjo Byun and
Cheol{-}Jong Woo and
Sejang Oh and
Jacob A. Abraham},
title = {Off-Chip Skew Measurement and Compensation Module {(SMCM)} Design
for Built-Off Test Chip},
journal = {J. Electron. Test.},
volume = {27},
number = {4},
pages = {429--439},
year = {2011},
url = {https://doi.org/10.1007/s10836-011-5213-z},
doi = {10.1007/S10836-011-5213-Z},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/et/HanPLCBWOA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/et/ParkSA11,
author = {Joonsung Park and
Hongjoong Shin and
Jacob A. Abraham},
title = {Pseudorandom Test of Nonlinear Analog and Mixed-Signal Circuits Based
on a Volterra Series Model},
journal = {J. Electron. Test.},
volume = {27},
number = {3},
pages = {321--334},
year = {2011},
url = {https://doi.org/10.1007/s10836-011-5227-6},
doi = {10.1007/S10836-011-5227-6},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/et/ParkSA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iee/Duran-LimonSBLL11,
author = {Hector A. Duran{-}Limon and
Mario Siller and
Gordon S. Blair and
Abraham Lopez and
Jos{\'{e}} F. Lombera{-}Landa},
title = {Using lightweight virtual machines to achieve resource adaptation
in middleware},
journal = {{IET} Softw.},
volume = {5},
number = {2},
pages = {229--237},
year = {2011},
url = {https://doi.org/10.1049/iet-sen.2009.0091},
doi = {10.1049/IET-SEN.2009.0091},
timestamp = {Fri, 02 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iee/Duran-LimonSBLL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijamc-igi/GloverLPDMLR11,
author = {Fred W. Glover and
Leon S. Lasdon and
John C. Plummer and
Abraham Duarte and
Rafael Mart{\'{\i}} and
Manuel Laguna and
C{\'{e}}sar Rego},
title = {Pseudo-Cut Strategies for Global Optimization},
journal = {Int. J. Appl. Metaheuristic Comput.},
volume = {2},
number = {4},
pages = {1--12},
year = {2011},
url = {https://doi.org/10.4018/jamc.2011100101},
doi = {10.4018/JAMC.2011100101},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijamc-igi/GloverLPDMLR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmms/HolzCOSMD11,
author = {Thomas Holz and
Abraham G. Campbell and
Gregory M. P. O'Hare and
John W. Stafford and
Alan N. Martin and
Mauro Dragone},
title = {MiRA - Mixed Reality Agents},
journal = {Int. J. Hum. Comput. Stud.},
volume = {69},
number = {4},
pages = {251--268},
year = {2011},
url = {https://doi.org/10.1016/j.ijhcs.2010.10.001},
doi = {10.1016/J.IJHCS.2010.10.001},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmms/HolzCOSMD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsir/MartiPDCG11,
author = {Rafael Mart{\'{\i}} and
Juan Jos{\'{e}} Pantrigo and
Abraham Duarte and
Vicente Campos and
Fred W. Glover},
title = {Scatter Search and Path Relinking : {A} Tutorial on the Linear Arrangement
Problem},
journal = {Int. J. Swarm Intell. Res.},
volume = {2},
number = {2},
pages = {1--21},
year = {2011},
url = {https://doi.org/10.4018/jsir.2011040101},
doi = {10.4018/JSIR.2011040101},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsir/MartiPDCG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ires/BruceWJVJ11,
author = {Harry Bruce and
Abraham Wenning and
Elisabeth A. Jones and
Julia Vinson and
William Jones},
title = {Seeking an ideal solution to the management of personal information
collections},
journal = {Inf. Res.},
volume = {16},
number = {1},
year = {2011},
url = {http://www.informationr.net/ir/16-1/paper462.html},
timestamp = {Wed, 22 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ires/BruceWJVJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/HaseenaJM11,
author = {Hassan Hamsa Haseena and
Paul K. Joseph and
Abraham T. Mathew},
title = {Classification of Arrhythmia Using Hybrid Networks},
journal = {J. Medical Syst.},
volume = {35},
number = {6},
pages = {1617--1630},
year = {2011},
url = {https://doi.org/10.1007/s10916-010-9439-6},
doi = {10.1007/S10916-010-9439-6},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/HaseenaJM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/HaseenaMP11,
author = {Hassan Hamsa Haseena and
Abraham T. Mathew and
Paul K. Joseph},
title = {Fuzzy Clustered Probabilistic and Multi Layered Feed Forward Neural
Networks for Electrocardiogram Arrhythmia Classification},
journal = {J. Medical Syst.},
volume = {35},
number = {2},
pages = {179--188},
year = {2011},
url = {https://doi.org/10.1007/s10916-009-9355-9},
doi = {10.1007/S10916-009-9355-9},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/HaseenaMP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/AndersonBFAPQ11,
author = {John R. Anderson and
Daniel Bothell and
Jon M. Fincham and
Abraham R. Anderson and
Ben Poole and
Yulin Qin},
title = {Brain Regions Engaged by Part- and Whole-task Performance in a Video
Game: {A} Model-based Test of the Decomposition Hypothesis},
journal = {J. Cogn. Neurosci.},
volume = {23},
number = {12},
pages = {3983--3997},
year = {2011},
url = {https://doi.org/10.1162/jocn\_a\_00033},
doi = {10.1162/JOCN\_A\_00033},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/AndersonBFAPQ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/SuomalainenSAS11,
author = {Tanja Suomalainen and
Outi Salo and
Pekka Abrahamsson and
Jouni Simil{\"{a}}},
title = {Software product roadmapping in a volatile business environment},
journal = {J. Syst. Softw.},
volume = {84},
number = {6},
pages = {958--975},
year = {2011},
url = {https://doi.org/10.1016/j.jss.2011.01.031},
doi = {10.1016/J.JSS.2011.01.031},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jss/SuomalainenSAS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BarthPNHFSMKRNC11,
author = {John Barth and
Don Plass and
Erik Nelson and
Charlie Hwang and
Gregory Fredeman and
Michael A. Sperling and
Abraham Mathews and
Toshiaki Kirihata and
William R. Reohr and
Kavita Nair and
Nianzheng Cao},
title = {A 45 nm {SOI} Embedded {DRAM} Macro for the POWER{\texttrademark}
Processor 32 MByte On-Chip {L3} Cache},
journal = {{IEEE} J. Solid State Circuits},
volume = {46},
number = {1},
pages = {64--75},
year = {2011},
url = {https://doi.org/10.1109/JSSC.2010.2084470},
doi = {10.1109/JSSC.2010.2084470},
timestamp = {Thu, 19 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/BarthPNHFSMKRNC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11,
author = {Tim D. Williams and
Nil Turan and
Amer M. Diab and
Huifeng Wu and
Carolynn Mackenzie and
Katie L. Bartie and
Olga Hrydziuszko and
Brett P. Lyons and
Grant D. Stentiford and
John M. Herbert and
Joseph K. Abraham and
Ioanna Katsiadaki and
Michael J. Leaver and
John B. Taggart and
Stephen G. George and
Mark R. Viant and
Kevin J. Chipman and
Francesco Falciani},
title = {Towards a System Level Understanding of Non-Model Organisms Sampled
from the Environment: {A} Network Biology Approach},
journal = {PLoS Comput. Biol.},
volume = {7},
number = {8},
year = {2011},
url = {https://doi.org/10.1371/journal.pcbi.1002126},
doi = {10.1371/JOURNAL.PCBI.1002126},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TrenberthFA11,
author = {Kevin E. Trenberth and
John T. Fasullo and
John P. Abraham},
title = {Issues in Establishing Climate Sensitivity in Recent Studies},
journal = {Remote. Sens.},
volume = {3},
number = {9},
pages = {2051--2056},
year = {2011},
url = {https://doi.org/10.3390/rs3092051},
doi = {10.3390/RS3092051},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/TrenberthFA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigact/AbrahamAH11,
author = {Ittai Abraham and
Lorenzo Alvisi and
Joseph Y. Halpern},
title = {Distributed computing meets game theory: combining insights from two
fields},
journal = {{SIGACT} News},
volume = {42},
number = {2},
pages = {69--76},
year = {2011},
url = {https://doi.org/10.1145/1998037.1998055},
doi = {10.1145/1998037.1998055},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigact/AbrahamAH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sj/MostafaviADS11,
author = {Ali Mostafavi and
Dulcy M. Abraham and
Daniel A. DeLaurentis and
Joseph Sinfield},
title = {Exploring the Dimensions of Systems of Innovation Analysis: {A} System
of Systems Framework},
journal = {{IEEE} Syst. J.},
volume = {5},
number = {2},
pages = {256--265},
year = {2011},
url = {https://doi.org/10.1109/JSYST.2011.2131050},
doi = {10.1109/JSYST.2011.2131050},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sj/MostafaviADS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/BenitezSA11,
author = {Jos{\'{e}} Manuel Ben{\'{\i}}tez and
Sabrina Senatore and
Ajith Abraham},
title = {Guest editorial: special issue on "Intelligent Systems, Design and
Applications (ISDA'2009)"},
journal = {Soft Comput.},
volume = {15},
number = {10},
pages = {1879--1880},
year = {2011},
url = {https://doi.org/10.1007/s00500-010-0622-y},
doi = {10.1007/S00500-010-0622-Y},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/soco/BenitezSA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkl/AbrahamsonTGHL11,
author = {Dor Abrahamson and
Dragan Trninic and
Jose F. Guti{\'{e}}rrez and
Jacob Huth and
Rosa G. Lee},
title = {Hooks and Shifts: {A} Dialectical Study of Mediated Discovery},
journal = {Technol. Knowl. Learn.},
volume = {16},
number = {1},
pages = {55--85},
year = {2011},
url = {https://doi.org/10.1007/s10758-011-9177-y},
doi = {10.1007/S10758-011-9177-Y},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tkl/AbrahamsonTGHL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEcloud/FrankeMCAB11,
author = {Craig Franke and
Samuel Morin and
Artem Chebotko and
John Abraham and
Pearl Brazier},
editor = {Ling Liu and
Manish Parashar},
title = {Distributed Semantic Web Data Management in HBase and MySQL Cluster},
booktitle = {{IEEE} International Conference on Cloud Computing, {CLOUD} 2011,
Washington, DC, USA, 4-9 July, 2011},
pages = {105--112},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/CLOUD.2011.19},
doi = {10.1109/CLOUD.2011.19},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEcloud/FrankeMCAB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acc/ShajanMA11,
author = {P. X. Shajan and
N. J. R. Muniraj and
John T. Abraham},
editor = {Ajith Abraham and
Jaime Lloret Mauri and
John F. Buford and
Junichi Suzuki and
Sabu M. Thampi},
title = {Design and Implementation of 3D {DWT} for 4D Image Based Noninvasive
Surgery},
booktitle = {Advances in Computing and Communications - First International Conference,
{ACC} 2011, Kochi, India, July 22-24, 2011, Proceedings, Part {III}},
series = {Communications in Computer and Information Science},
volume = {192},
pages = {168--177},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22720-2\_16},
doi = {10.1007/978-3-642-22720-2\_16},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acc/ShajanMA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aspdac/KimLA11,
author = {Joonsoo Kim and
Joonsoo Lee and
Jacob A. Abraham},
title = {System accuracy estimation of SRAM-based device authentication},
booktitle = {Proceedings of the 16th Asia South Pacific Design Automation Conference,
{ASP-DAC} 2011, Yokohama, Japan, January 25-27, 2011},
pages = {37--42},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ASPDAC.2011.5722216},
doi = {10.1109/ASPDAC.2011.5722216},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/aspdac/KimLA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atva/JansenAKWKB11,
author = {Nils Jansen and
Erika {\'{A}}brah{\'{a}}m and
Jens Katelaan and
Ralf Wimmer and
Joost{-}Pieter Katoen and
Bernd Becker},
editor = {Tevfik Bultan and
Pao{-}Ann Hsiung},
title = {Hierarchical Counterexamples for Discrete-Time Markov Chains},
booktitle = {Automated Technology for Verification and Analysis, 9th International
Symposium, {ATVA} 2011, Taipei, Taiwan, October 11-14, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6996},
pages = {443--452},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-24372-1\_33},
doi = {10.1007/978-3-642-24372-1\_33},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/atva/JansenAKWKB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/LeeABA11,
author = {Hee Seung Lee and
Abraham R. Anderson and
Shawn A. Betts and
John R. Anderson},
editor = {Laura A. Carlson and
Christoph H{\"{o}}lscher and
Thomas F. Shipley},
title = {When does provision of instruction promote learning?},
booktitle = {Proceedings of the 33th Annual Meeting of the Cognitive Science Society,
CogSci 2011, Boston, Massachusetts, USA, July 20-23, 2011},
publisher = {cognitivesciencesociety.org},
year = {2011},
url = {https://mindmodeling.org/cogsci2011/papers/0835/index.html},
timestamp = {Wed, 17 Apr 2024 12:44:29 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/LeeABA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conext/Martin-Campillo11,
author = {Abraham Mart{\'{\i}}n{-}Campillo and
Ramon Mart{\'{\i}} and
Eiko Yoneki and
Jon Crowcroft},
title = {Electronic triage tag and opportunistic networks in disasters},
booktitle = {Proceedings of the Special Workshop on Internet and Disasters, SWID@CoNEXT
2011, Tokyo, Japan, December 6-9, 2011},
pages = {6:1--6:10},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2079360.2079366},
doi = {10.1145/2079360.2079366},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/conext/Martin-Campillo11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscl/TrninicGA11,
author = {Dragan Trninic and
Jose Guti{\'{e}}rrez and
Dor Abrahamson},
title = {Virtual Mathematical Inquiry: Problem Solving at the Gestural - Symbolic
Interface of Remote-Control Embodied-Interaction Design},
booktitle = {Proceedings of the 9th International Conference on Computer Supported
Collaborative Learning, {CSCL} 2011, Hong Kong, July 4-8, 2011},
publisher = {International Society of the Learning Sciences},
year = {2011},
url = {https://repository.isls.org/handle/1/2458},
timestamp = {Wed, 28 Apr 2021 17:11:51 +0200},
biburl = {https://dblp.org/rec/conf/cscl/TrninicGA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/AbrahamSR11,
author = {Jose K. Abraham and
Shawn Sullivan and
Sridhar Ranganathan},
title = {Low-cost and disposable pressure sensor mat for non-invasive sleep
and movement monitoring applications},
booktitle = {33rd Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2011, Boston, MA, USA, August
30 - Sept. 3, 2011},
pages = {4745--4748},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IEMBS.2011.6091175},
doi = {10.1109/IEMBS.2011.6091175},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/AbrahamSR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/PalladinoZMN11,
author = {Joseph L. Palladino and
Ryan L. Zukus and
Andrei Marchidan and
Abraham Noordergraaf},
title = {Left ventricular model parameters and cardiac rate variability},
booktitle = {33rd Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2011, Boston, MA, USA, August
30 - Sept. 3, 2011},
pages = {6817--6820},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IEMBS.2011.6091681},
doi = {10.1109/IEMBS.2011.6091681},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/PalladinoZMN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurocast/Rodriguez-RodriguezGQ11,
author = {Abraham Rodr{\'{\i}}guez{-}Rodr{\'{\i}}guez and
Nicol{\'{a}}s Iglesias Garc{\'{\i}}a and
Jos{\'{e}} Mar{\'{\i}}a Quinteiro{-}Gonz{\'{a}}lez},
editor = {Roberto Moreno{-}D{\'{\i}}az and
Franz Pichler and
Alexis Quesada{-}Arencibia},
title = {Modelling the Psychographic Behaviour of Users Using Ontologies in
Web Marketing Services},
booktitle = {Computer Aided Systems Theory - {EUROCAST} 2011 - 13th International
Conference, Las Palmas de Gran Canaria, Spain, February 6-11, 2011,
Revised Selected Papers, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {6927},
pages = {121--128},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-27549-4\_16},
doi = {10.1007/978-3-642-27549-4\_16},
timestamp = {Wed, 07 Dec 2022 23:13:53 +0100},
biburl = {https://dblp.org/rec/conf/eurocast/Rodriguez-RodriguezGQ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hais/CaamanoBBPD11,
author = {Pilar Caama{\~{n}}o and
Jos{\'{e}} Antonio Becerra and
Francisco Bellas and
Abraham Prieto and
Richard J. Duro},
editor = {Emilio Corchado and
Marek Kurzynski and
Michal Wozniak},
title = {Evolutionary Procedure for the Progressive Design of Controllers for
Collective Behaviors},
booktitle = {Hybrid Artificial Intelligent Systems - 6th International Conference,
{HAIS} 2011, Wroclaw, Poland, May 23-25, 2011, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {6679},
pages = {471--478},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-21222-2\_57},
doi = {10.1007/978-3-642-21222-2\_57},
timestamp = {Tue, 10 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hais/CaamanoBBPD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icail/AbrahamsCZ11,
author = {Brooke Abrahams and
Peter Condliffe and
John Zeleznikow},
editor = {Kevin D. Ashley and
Tom M. van Engers},
title = {Using an {OWL} ontology to support legal negotiation about owners
corporation disputes},
booktitle = {The 13th International Conference on Artificial Intelligence and Law,
Proceedings of the Conference, June 6-10, 2011, Pittsburgh, PA, {USA}},
pages = {194--198},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2018358.2018386},
doi = {10.1145/2018358.2018386},
timestamp = {Tue, 06 Nov 2018 16:58:12 +0100},
biburl = {https://dblp.org/rec/conf/icail/AbrahamsCZ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwinac/TruebaPCBD11,
author = {Pedro Trueba and
Abraham Prieto and
Pilar Caama{\~{n}}o and
Francisco Bellas and
Richard J. Duro},
editor = {Jos{\'{e}} Manuel Ferr{\'{a}}ndez and
Jos{\'{e}} Ram{\'{o}}n {\'{A}}lvarez S{\'{a}}nchez and
F{\'{e}}lix de la Paz and
F. Javier Toledo},
title = {Task-Driven Species in Evolutionary Robotic Teams},
booktitle = {Foundations on Natural and Artificial Computation - 4th International
Work-Conference on the Interplay Between Natural and Artificial Computation,
{IWINAC} 2011, La Palma, Canary Islands, Spain, May 30 - June 3, 2011.
Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {6686},
pages = {138--147},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-21344-1\_15},
doi = {10.1007/978-3-642-21344-1\_15},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwinac/TruebaPCBD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kolicalling/AbrahamBBCJLLNS11,
author = {Erika {\'{A}}brah{\'{a}}m and
Nadine Bergner and
Philipp Brauner and
Florian Corzilius and
Nils Jansen and
Thiemo Leonhardt and
Ulrich Loup and
Johanna Nellen and
Ulrik Schroeder},
editor = {Ari Korhonen and
Robert McCartney},
title = {On collaboratively conveying computer science to pupils},
booktitle = {11th Koli Calling International Conference on Computing Education
Research, Koli Calling '11, Koli, Finland, November 17-20, 2011},
pages = {132--137},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2094131.2094162},
doi = {10.1145/2094131.2094162},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kolicalling/AbrahamBBCJLLNS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/weit/DertzbacherSN11,
author = {Juliano Dertzbacher and
Abraham Lincoln Rabelo de Sousa and
Daltro J. Nunes},
title = {A Simulation Model for Process-Centered Software Engineering Environments
Using Sensitivity Analysis},
booktitle = {2011 Workshop-School on Theoretical Computer Science, {WEIT} 2011,
Pelotas, Brazil, August 24-26, 2011},
pages = {74--80},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/WEIT.2011.21},
doi = {10.1109/WEIT.2011.21},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/weit/DertzbacherSN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acc/2011-1,
editor = {Ajith Abraham and
Jaime Lloret Mauri and
John F. Buford and
Junichi Suzuki and
Sabu M. Thampi},
title = {Advances in Computing and Communications - First International Conference,
{ACC} 2011, Kochi, India, July 22-24, 2011. Proceedings, Part {I}},
series = {Communications in Computer and Information Science},
volume = {190},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22709-7},
doi = {10.1007/978-3-642-22709-7},
isbn = {978-3-642-22708-0},
timestamp = {Mon, 29 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acc/2011-1.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acc/2011-2,
editor = {Ajith Abraham and
Jaime Lloret Mauri and
John F. Buford and
Junichi Suzuki and
Sabu M. Thampi},
title = {Advances in Computing and Communications - First International Conference,
{ACC} 2011, Kochi, India, July 22-24, 2011. Proceedings},
series = {Communications in Computer and Information Science},
volume = {191},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22714-1},
doi = {10.1007/978-3-642-22714-1},
isbn = {978-3-642-22713-4},
timestamp = {Mon, 29 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acc/2011-2.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acc/2011-3,
editor = {Ajith Abraham and
Jaime Lloret Mauri and
John F. Buford and
Junichi Suzuki and
Sabu M. Thampi},
title = {Advances in Computing and Communications - First International Conference,
{ACC} 2011, Kochi, India, July 22-24, 2011, Proceedings, Part {III}},
series = {Communications in Computer and Information Science},
volume = {192},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22720-2},
doi = {10.1007/978-3-642-22720-2},
isbn = {978-3-642-22719-6},
timestamp = {Mon, 29 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acc/2011-3.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acc/2011-4,
editor = {Ajith Abraham and
Jaime Lloret Mauri and
John F. Buford and
Junichi Suzuki and
Sabu M. Thampi},
title = {Advances in Computing and Communications - First International Conference,
{ACC} 2011, Kochi, India, July 22-24, 2011, Proceedings, Part {IV}},
series = {Communications in Computer and Information Science},
volume = {193},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22726-4},
doi = {10.1007/978-3-642-22726-4},
isbn = {978-3-642-22725-7},
timestamp = {Mon, 29 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acc/2011-4.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isda/2011,
editor = {Sebasti{\'{a}}n Ventura and
Ajith Abraham and
Krzysztof J. Cios and
Crist{\'{o}}bal Romero and
Francesco Marcelloni and
Jos{\'{e}} Manuel Ben{\'{\i}}tez and
Eva Lucrecia Gibaja Galindo},
title = {11th International Conference on Intelligent Systems Design and Applications,
{ISDA} 2011, C{\'{o}}rdoba, Spain, November 22-24, 2011},
publisher = {{IEEE}},
year = {2011},
url = {https://ieeexplore.ieee.org/xpl/conhome/6112291/proceeding},
isbn = {978-1-4577-1676-8},
timestamp = {Tue, 23 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isda/2011.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/uksim/2011,
editor = {David Al{-}Dabass and
Alessandra Orsoni and
Richard J. Cant and
Ajith Abraham},
title = {Proceedings of the 13th UKSim-AMSS International Conference on Computer
Modelling and Simulation, Cambridge University, Emmanuel College,
Cambridge, UK, 30 March - 1 April 2011},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://ieeexplore.ieee.org/xpl/conhome/5752641/proceeding},
isbn = {978-0-7695-4376-5},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uksim/2011.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1105-2264,
author = {Craig Franke and
Samuel Morin and
Artem Chebotko and
John Abraham and
Pearl Brazier},
title = {Distributed Semantic Web Data Management in HBase and MySQL Cluster},
journal = {CoRR},
volume = {abs/1105.2264},
year = {2011},
url = {http://arxiv.org/abs/1105.2264},
eprinttype = {arXiv},
eprint = {1105.2264},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1105-2264.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1111-3010,
author = {Ayu Tiwari and
Sudip Sanyal and
Ajith Abraham and
Svein Johan Knapskog and
Sugata Sanyal},
title = {A Multi-Factor Security Protocol for Wireless Payment - Secure Web
Authentication using Mobile Devices},
journal = {CoRR},
volume = {abs/1111.3010},
year = {2011},
url = {http://arxiv.org/abs/1111.3010},
eprinttype = {arXiv},
eprint = {1111.3010},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1111-3010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cgf/AdamsBD10,
author = {Andrew Adams and
Jongmin Baek and
Myers Abraham Davis},
title = {Fast High-Dimensional Filtering Using the Permutohedral Lattice},
journal = {Comput. Graph. Forum},
volume = {29},
number = {2},
pages = {753--762},
year = {2010},
url = {https://doi.org/10.1111/j.1467-8659.2009.01645.x},
doi = {10.1111/J.1467-8659.2009.01645.X},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cgf/AdamsBD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/MendozaV10,
author = {Abraham Mendoza and
Jos{\'{e}} A. Ventura},
title = {A serial inventory system with supplier selection and order quantity
allocation},
journal = {Eur. J. Oper. Res.},
volume = {207},
number = {3},
pages = {1304--1315},
year = {2010},
url = {https://doi.org/10.1016/j.ejor.2010.06.034},
doi = {10.1016/J.EJOR.2010.06.034},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/MendozaV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/et/ShinPA10,
author = {Hongjoong Shin and
Joonsung Park and
Jacob A. Abraham},
title = {Spectral Prediction for Specification-Based Loopback Test of Embedded
Mixed-Signal Circuits},
journal = {J. Electron. Test.},
volume = {26},
number = {1},
pages = {73--86},
year = {2010},
url = {https://doi.org/10.1007/s10836-009-5136-0},
doi = {10.1007/S10836-009-5136-0},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/et/ShinPA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/geb/NeymanS10,
author = {Abraham Neyman and
Joel Spencer},
title = {Complexity and effective prediction},
journal = {Games Econ. Behav.},
volume = {69},
number = {1},
pages = {165--168},
year = {2010},
url = {https://doi.org/10.1016/j.geb.2009.05.007},
doi = {10.1016/J.GEB.2009.05.007},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/geb/NeymanS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/AbrahamR10,
author = {Joanna Abraham and
Madhu C. Reddy},
title = {Challenges to inter-departmental coordination of patient transfers:
{A} workflow perspective},
journal = {Int. J. Medical Informatics},
volume = {79},
number = {2},
pages = {112--122},
year = {2010},
url = {https://doi.org/10.1016/j.ijmedinf.2009.11.001},
doi = {10.1016/J.IJMEDINF.2009.11.001},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/AbrahamR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/interfaces/SimaoGPGND10,
author = {Hugo P. Sim{\~{a}}o and
Abraham P. George and
Warren B. Powell and
Ted Gifford and
John Nienow and
Jeff Day},
title = {Approximate Dynamic Programming Captures Fleet Operations for Schneider
National},
journal = {Interfaces},
volume = {40},
number = {5},
pages = {342--352},
year = {2010},
url = {https://doi.org/10.1287/inte.1100.0510},
doi = {10.1287/INTE.1100.0510},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/interfaces/SimaoGPGND10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jco/ChenFA10,
author = {Zhixiang Chen and
Bin Fu and
John Abraham},
title = {A quadratic lower bound for Rocchio's similarity-based relevance feedback
algorithm with a fixed query updating factor},
journal = {J. Comb. Optim.},
volume = {19},
number = {2},
pages = {134--157},
year = {2010},
url = {https://doi.org/10.1007/s10878-008-9169-6},
doi = {10.1007/S10878-008-9169-6},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jco/ChenFA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mcs/ArenasGJ10,
author = {Abraham J. Arenas and
Gilberto Gonz{\'{a}}lez{-}Parra and
Lucas J{\'{o}}dar},
title = {Randomness in a mathematical model for the transmission of respiratory
syncytial virus {(RSV)}},
journal = {Math. Comput. Simul.},
volume = {80},
number = {5},
pages = {971--981},
year = {2010},
url = {https://doi.org/10.1016/j.matcom.2009.12.001},
doi = {10.1016/J.MATCOM.2009.12.001},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mcs/ArenasGJ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ras/PrietoBBD10,
author = {Abraham Prieto and
Jos{\'{e}} Antonio Becerra and
Francisco Bellas and
Richard J. Duro},
title = {Open-ended evolution as a means to self-organize heterogeneous multi-robot
systems in real time},
journal = {Robotics Auton. Syst.},
volume = {58},
number = {12},
pages = {1282--1291},
year = {2010},
url = {https://doi.org/10.1016/j.robot.2010.08.004},
doi = {10.1016/J.ROBOT.2010.08.004},
timestamp = {Tue, 10 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ras/PrietoBBD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ws/TappoletKB10,
author = {Jonas Tappolet and
Christoph Kiefer and
Abraham Bernstein},
title = {Semantic web enabled software analysis},
journal = {J. Web Semant.},
volume = {8},
number = {2-3},
pages = {225--240},
year = {2010},
url = {https://doi.org/10.1016/j.websem.2010.04.009},
doi = {10.1016/J.WEBSEM.2010.04.009},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ws/TappoletKB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEias/ThomasATA10,
author = {Johnson P. Thomas and
Vinay Abburi and
Mathews Thomas and
Ajith Abraham},
title = {Secure protocol for ad hoc transportation system},
booktitle = {Sixth International Conference on Information Assurance and Security,
{IAS} 2010, Atlanta, GA, USA, August 23-25, 2010},
pages = {288--293},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISIAS.2010.5604180},
doi = {10.1109/ISIAS.2010.5604180},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/IEEEias/ThomasATA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEscc/AbrahamBCNP10,
author = {John Abraham and
Pearl Brazier and
Artem Chebotko and
Jaime Navarro and
Anthony Piazza},
title = {Distributed Storage and Querying Techniques for a Semantic Web of
Scientific Workflow Provenance},
booktitle = {2010 {IEEE} International Conference on Services Computing, {SCC}
2010, Miami, Florida, USA, July 5-10, 2010},
pages = {178--185},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/SCC.2010.14},
doi = {10.1109/SCC.2010.14},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEscc/AbrahamBCNP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ats/ParkLCHABWO10,
author = {Joonsung Park and
Jae Wook Lee and
Jaeyong Chung and
Kihyuk Han and
Jacob A. Abraham and
Eonjo Byun and
Cheol{-}Jong Woo and
Sejang Oh},
title = {At-speed Test of High-Speed {DUT} Using Built-Off Test Interface},
booktitle = {Proceedings of the 19th {IEEE} Asian Test Symposium, {ATS} 2010, 1-4
December 2010, Shanghai, China},
pages = {269--274},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ATS.2010.54},
doi = {10.1109/ATS.2010.54},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ats/ParkLCHABWO10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blizzard/LouwNS10,
author = {Johannes A. Louw and
Daniel R. van Niekerk and
Georg I. Schl{\"{u}}nz},
title = {Introducing the Speect speech synthesis platform},
booktitle = {The Blizzard Challenge 2010, Kansai Science City, Japan, September
25, 2010},
publisher = {{ISCA}},
year = {2010},
url = {https://doi.org/10.21437/Blizzard.2010-4},
doi = {10.21437/BLIZZARD.2010-4},
timestamp = {Fri, 20 Sep 2024 10:07:57 +0200},
biburl = {https://dblp.org/rec/conf/blizzard/LouwNS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/JainBRBHBDBMAHKHSTLS10,
author = {Viren Jain and
Benjamin Bollmann and
Mark Richardson and
Daniel R. Berger and
Moritz Helmstaedter and
Kevin L. Briggman and
Winfried Denk and
Jared B. Bowden and
John M. Mendenhall and
Wickliffe C. Abraham and
Kristen M. Harris and
Narayanan Kasthuri and
Ken J. Hayworth and
Richard Schalek and
Juan Carlos Tapia and
Jeff W. Lichtman and
H. Sebastian Seung},
title = {Boundary Learning by Optimization with Topological Constraints},
booktitle = {The Twenty-Third {IEEE} Conference on Computer Vision and Pattern
Recognition, {CVPR} 2010, San Francisco, CA, USA, 13-18 June 2010},
pages = {2488--2495},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/CVPR.2010.5539950},
doi = {10.1109/CVPR.2010.5539950},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/JainBRBHBDBMAHKHSTLS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fcs/VelankanniL10,
author = {Thomas Abraham Joseph Velankanni and
Sherley Mary Lourdusawmy},
editor = {Hamid R. Arabnia and
George A. Gravvanis and
Ashu M. G. Solo},
title = {Ontology for Accounting},
booktitle = {Proceedings of the 2010 International Conference on Foundations of
Computer Science, {FCS} 2010, July 12-15, 2010, Las Vegas, Nevada,
{USA}},
pages = {212--218},
publisher = {{CSREA} Press},
year = {2010},
timestamp = {Wed, 08 Dec 2010 08:03:41 +0100},
biburl = {https://dblp.org/rec/conf/fcs/VelankanniL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/MelendezCGS10,
author = {Abraham Melendez and
Oscar Castillo and
Arnulfo Alanis Garza and
Jose Soria},
title = {Reactive and tracking control of a mobile robot in a distributed environment
using fuzzy logic},
booktitle = {{FUZZ-IEEE} 2010, {IEEE} International Conference on Fuzzy Systems,
Barcelona, Spain, 18-23 July, 2010, Proceedings},
pages = {1--5},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/FUZZY.2010.5583955},
doi = {10.1109/FUZZY.2010.5583955},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/MelendezCGS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/ParkerHK10,
author = {Jonathon K. Parker and
Lawrence O. Hall and
Abraham Kandel},
title = {Scalable fuzzy neighborhood {DBSCAN}},
booktitle = {{FUZZ-IEEE} 2010, {IEEE} International Conference on Fuzzy Systems,
Barcelona, Spain, 18-23 July, 2010, Proceedings},
pages = {1--8},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/FUZZY.2010.5584527},
doi = {10.1109/FUZZY.2010.5584527},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/ParkerHK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/KimLA10,
author = {Joonsoo Kim and
Joonsoo Lee and
Jacob A. Abraham},
title = {Toward reliable SRAM-based device identification},
booktitle = {28th International Conference on Computer Design, {ICCD} 2010, 3-6
October 2010, Amsterdam, The Netherlands, Proceedings},
pages = {313--320},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ICCD.2010.5647724},
doi = {10.1109/ICCD.2010.5647724},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/KimLA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/BarreraAAACEHPS10,
author = {Renato Barrera and
Abraham Alc{\'{a}}ntara and
Carlos Alegr{\'{\i}}a and
Ana L. {\'{A}}vila and
Carlos R. Cruz and
David Esparza and
Augusta D. Hern{\'{a}}ndez and
Jose L. Plata and
Luis F. Sanabra},
title = {A Mediator for biospatial information systems},
booktitle = {Proceedings of the 7th International Conference on Electrical Engineering,
Computing Science and Automatic Control, {CCE} 2010 (Formerly known
as ICEEE), September 8-10, 2010, Tuxtla Gutierrez, Mexico},
pages = {363--368},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICEEE.2010.5608561},
doi = {10.1109/ICEEE.2010.5608561},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/iceee/BarreraAAACEHPS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icetet/BanerjeeRDA10,
author = {Tribeni Prasad Banerjee and
Joydeb Roychoudhury and
Swagatam Das and
Ajith Abraham},
title = {Hybrid Intelligent Predictive Control System for High Speed {BLDC}
Motor in Aerospace Application},
booktitle = {3rd International Conference on Emerging Trends in Engineering and
Technology, {ICETET} 2010, Goa, India, November 19-21, 2010},
pages = {258--262},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ICETET.2010.48},
doi = {10.1109/ICETET.2010.48},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icetet/BanerjeeRDA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/CaamanoPBBD10,
author = {Pilar Caama{\~{n}}o and
Abraham Prieto and
Jos{\'{e}} Antonio Becerra and
Francisco Bellas and
Richard J. Duro},
editor = {Kok Wai Wong and
B. Sumudu U. Mendis and
Abdesselam Bouzerdoum},
title = {Real-Valued Multimodal Fitness Landscape Characterization for Evolution},
booktitle = {Neural Information Processing. Theory and Algorithms - 17th International
Conference, {ICONIP} 2010, Sydney, Australia, November 22-25, 2010,
Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {6443},
pages = {567--574},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-17537-4\_69},
doi = {10.1007/978-3-642-17537-4\_69},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iconip/CaamanoPBBD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/KimKFLBRT10,
author = {Been Kim and
Michael Kaess and
Luke Fletcher and
John J. Leonard and
Abraham Bachrach and
Nicholas Roy and
Seth J. Teller},
title = {Multiple relative pose graphs for robust cooperative mapping},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2010, Anchorage, Alaska, USA, 3-7 May 2010},
pages = {3185--3192},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ROBOT.2010.5509154},
doi = {10.1109/ROBOT.2010.5509154},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/KimKFLBRT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/NeubertCCKEL10,
author = {Jonas Neubert and
Abraham P. Cantwell and
Stephane Constantin and
Michael Kalontarov and
David Erickson and
Hod Lipson},
title = {A robotic module for stochastic fluidic assembly of 3D self-reconfiguring
structures},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2010, Anchorage, Alaska, USA, 3-7 May 2010},
pages = {2479--2484},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ROBOT.2010.5509455},
doi = {10.1109/ROBOT.2010.5509455},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/NeubertCCKEL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip8-3/AbrahamsZ10,
author = {Brooke Abrahams and
John Zeleznikow},
editor = {Ana Resp{\'{\i}}cio and
Fr{\'{e}}d{\'{e}}ric Adam and
Gloria E. Phillips{-}Wren and
Carlos Teixeira and
Jo{\~{a}}o Telhada},
title = {A Multi-agent Negotiation Decision Support System for Australian Family
Law},
booktitle = {Bridging the Socio-technical Gap in Decision Support Systems - Challenges
for the Next Decade, {DSS} 2010, the 15th {IFIP} {WG8.3} International
Conference on Decision Support Systems, July 7-10, 2010, Faculty of
Sciences, University of Lisbon, Portugal},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {212},
pages = {297--308},
publisher = {{IOS} Press},
year = {2010},
url = {https://doi.org/10.3233/978-1-60750-577-8-297},
doi = {10.3233/978-1-60750-577-8-297},
timestamp = {Thu, 15 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip8-3/AbrahamsZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipcai/BurlinaSDJJCAYM10,
author = {Philippe Burlina and
Chad Sprouse and
Daniel DeMenthon and
Anne Jorstad and
Radford Juang and
Francisco Contijoch and
Theodore Abraham and
David D. Yuh and
Elliot R. McVeigh},
editor = {Nassir Navab and
Pierre Jannin},
title = {Patient-Specific Modeling and Analysis of the Mitral Valve Using 3D-TEE},
booktitle = {Information Processing in Computer-Assisted Interventions, First International
Conference, {IPCAI} 2010, Geneva, Switzerland, June 23, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6135},
pages = {135--146},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-13711-2\_13},
doi = {10.1007/978-3-642-13711-2\_13},
timestamp = {Tue, 14 May 2019 10:00:39 +0200},
biburl = {https://dblp.org/rec/conf/ipcai/BurlinaSDJJCAYM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BarthPNHFSMRNC10,
author = {John Barth and
Don Plass and
Erik Nelson and
Charlie Hwang and
Gregory Fredeman and
Michael A. Sperling and
Abraham Mathews and
William R. Reohr and
Kavita Nair and
Nianzheng Cao},
title = {A 45nm {SOI} embedded {DRAM} macro for {POWER7TM} 32MB on-chip {L3}
cache},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2010,
Digest of Technical Papers, San Francisco, CA, USA, 7-11 February,
2010},
pages = {342--343},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISSCC.2010.5433814},
doi = {10.1109/ISSCC.2010.5433814},
timestamp = {Fri, 16 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/BarthPNHFSMRNC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jurix/CondliffeAZ10,
author = {Peter Condliffe and
Brooke Abrahams and
John Zeleznikow},
editor = {Radboud Winkels},
title = {A Legal Decision Support Guide for Owners Corporation Cases},
booktitle = {Legal Knowledge and Information Systems - {JURIX} 2010: The Twenty-Third
Annual Conference on Legal Knowledge and Information Systems, Liverpool,
UK, 16-17 December 2010},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {223},
pages = {147--150},
publisher = {{IOS} Press},
year = {2010},
url = {https://doi.org/10.3233/978-1-60750-682-9-147},
doi = {10.3233/978-1-60750-682-9-147},
timestamp = {Thu, 15 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/jurix/CondliffeAZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kes/VillanuevaHDPVS10,
author = {David {Ter{'{a}}n Villanueva} and
H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
Abraham Duarte and
Rodolfo A. Pazos Rangel and
Juan Mart{\'{\i}}n Carpio Valadez and
H{\'{e}}ctor Jos{\'{e}} Puga Soberanes},
editor = {Rossitza Setchi and
Ivan Jordanov and
Robert J. Howlett and
Lakhmi C. Jain},
title = {Improving Iterated Local Search Solution for the Linear Ordering Problem
with Cumulative Costs {(LOPCC)}},
booktitle = {Knowledge-Based and Intelligent Information and Engineering Systems
- 14th International Conference, {KES} 2010, Cardiff, UK, September
8-10, 2010, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {6277},
pages = {183--192},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15390-7\_19},
doi = {10.1007/978-3-642-15390-7\_19},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kes/VillanuevaHDPVS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kesamsta/AbrahamsZ10,
author = {Brooke Abrahams and
John Zeleznikow},
editor = {Piotr Jedrzejowicz and
Ngoc Thanh Nguyen and
Robert J. Howlett and
Lakhmi C. Jain},
title = {Including Notions of Fairness in Development of an Integrated Multi-agent
Online Dispute Resolution Environment},
booktitle = {Agent and Multi-Agent Systems: Technologies and Applications, 4th
{KES} International Symposium, {KES-AMSTA} 2010, Gdynia, Poland, June
23-25, 2010, Proceedings. Part {I}},
series = {Lecture Notes in Computer Science},
volume = {6070},
pages = {102--111},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-13480-7\_12},
doi = {10.1007/978-3-642-13480-7\_12},
timestamp = {Thu, 16 Mar 2023 20:00:31 +0100},
biburl = {https://dblp.org/rec/conf/kesamsta/AbrahamsZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mc/0004CAH10,
author = {Thomas Winkler and
J{\"{o}}rg Cassens and
Martin Abraham and
Michael Herczeg},
editor = {Ulrik Schroeder},
title = {Die Interactive School Wall - eine be-greifbare Schnittstelle zum
Network Environment for Multimedia Objects},
booktitle = {Interaktive Kulturen: Workshop-Band. Proceedings der Workshops der
Mensch {\&} Computer 2010 - 10. Fach{\"{u}}bergreifende Konferenz
f{\"{u}}r Interaktive und Kooperative Medien, DeLFI 2010 - die
8. E-Learning Fachtagung Informatik der Gesellschaft f{\"{u}}r
Informatik e.V. und der Entertainment Interfaces 2010, Duisburg, Germany,
September 12-15, 2010},
pages = {177--178},
publisher = {Logos Verlag},
year = {2010},
url = {https://dl.gi.de/handle/20.500.12116/7337},
timestamp = {Thu, 07 Dec 2023 20:49:06 +0100},
biburl = {https://dblp.org/rec/conf/mc/0004CAH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/TierneyABBBBKKM10,
author = {William M. Tierney and
Marion Achieng and
Elaine Baker and
April Bell and
Paul G. Biondich and
Paula Braitstein and
Daniel Kayiwa and
Sylvester N. Kimaiyo and
Burke W. Mamlin and
Brian McKown and
Nicholas Musinguzi and
Winstone M. Nyandiko and
Joseph K. Rotich and
John E. Sidle and
Abraham M. Siika and
Martin Chieng Were and
Benjamin A. Wolfe and
Kara Wools{-}Kaloustian and
Ada Yeung and
Constantin T. Yiannoutsos},
editor = {Charles Safran and
Shane R. Reti and
Heimar F. Marin},
title = {Experience Implementing Electronic Health Records in Three East African
Countries},
booktitle = {{MEDINFO} 2010 - Proceedings of the 13th World Congress on Medical
Informatics, Cape Town, South Africa, September 12-15, 2010},
series = {Studies in Health Technology and Informatics},
volume = {160},
pages = {371--375},
publisher = {{IOS} Press},
year = {2010},
url = {https://doi.org/10.3233/978-1-60750-588-4-371},
doi = {10.3233/978-1-60750-588-4-371},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/medinfo/TierneyABBBBKKM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobiopp/Martin-Campillo10,
author = {Abraham Mart{\'{\i}}n{-}Campillo and
Jon Crowcroft and
Eiko Yoneki and
Ramon Mart{\'{\i}} and
Carles Mart{\'{\i}}nez{-}Garc{\'{\i}}a},
editor = {Sergio Palazzo and
Tracy Camp and
Marco Conti},
title = {Using Haggle to create an electronic triage tag},
booktitle = {Proceedings of the Second International Workshop on Mobile Opportunistic
Networking, MobiOpp '10, Pisa, Italy, February 22-23, 2010},
pages = {167--170},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1755743.1755775},
doi = {10.1145/1755743.1755775},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mobiopp/Martin-Campillo10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/odr/CondliffeAZ10,
author = {Peter Condliffe and
Brooke Abrahams and
John Zeleznikow},
editor = {Marta Poblet and
Brooke Abrahams and
John Zeleznikow},
title = {An {OWL} Ontology and Bayesian Network to Support Legal Reasoning
in the Owners Corporation Domain},
booktitle = {Proceedings of the 6th International Workshop on Online Dispute Resolution
2010, Liverpool, United Kingdom, December 15, 2010},
series = {{CEUR} Workshop Proceedings},
volume = {684},
pages = {51--62},
publisher = {CEUR-WS.org},
year = {2010},
url = {https://ceur-ws.org/Vol-684/paper5.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:27 +0100},
biburl = {https://dblp.org/rec/conf/odr/CondliffeAZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qest/AbrahamJWKB10,
author = {Erika {\'{A}}brah{\'{a}}m and
Nils Jansen and
Ralf Wimmer and
Joost{-}Pieter Katoen and
Bernd Becker},
title = {{DTMC} Model Checking by {SCC} Reduction},
booktitle = {{QEST} 2010, Seventh International Conference on the Quantitative
Evaluation of Systems, Williamsburg, Virginia, USA, 15-18 September
2010},
pages = {37--46},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/QEST.2010.13},
doi = {10.1109/QEST.2010.13},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qest/AbrahamJWKB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sab/PrietoBBPD10,
author = {Abraham Prieto and
Francisco Bellas and
Jos{\'{e}} Antonio Becerra and
Becerra Priego and
Richard J. Duro},
editor = {St{\'{e}}phane Doncieux and
Beno{\^{\i}}t Girard and
Agn{\`{e}}s Guillot and
John Hallam and
Jean{-}Arcady Meyer and
Jean{-}Baptiste Mouret},
title = {Self-organizing Robot Teams Using Asynchronous Situated Co-evolution},
booktitle = {From Animals to Animats 11, 11th International Conference on Simulation
of Adaptive Behavior, {SAB} 2010, Paris - Clos Luc{\'{e}}, France,
August 25-28, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6226},
pages = {565--574},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15193-4\_53},
doi = {10.1007/978-3-642-15193-4\_53},
timestamp = {Sat, 30 Sep 2023 09:55:34 +0200},
biburl = {https://dblp.org/rec/conf/sab/PrietoBBPD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/services/SivakumarAHH10,
author = {Gandhi Sivakumar and
Faried Abrahams and
Kerard Hogg and
John Hartley},
title = {{SOI} (Service Oriented Integration) and {SIMM} (Service Integration
Maturity Model},
booktitle = {6th World Congress on Services, {SERVICES} 2010, Miami, Florida, USA,
July 5-10, 2010},
pages = {178--182},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/SERVICES.2010.55},
doi = {10.1109/SERVICES.2010.55},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/services/SivakumarAHH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/softcomp/BanerjeeDRA10,
author = {Tribeni Prasad Banerjee and
Swagatam Das and
Joydeb Roychoudhury and
Ajith Abraham},
editor = {Emilio Corchado and
Paulo Novais and
Cesar Analide and
Javier Sedano},
title = {Implementation of a New Hybrid Methodology for Fault Signal Classification
Using Short -Time Fourier Transform and Support Vector Machines},
booktitle = {Soft Computing Models in Industrial and Environmental Applications,
5th International Workshop {(SOCO} 2010), Guimar{\~{a}}es, Portugal,
June 2010},
series = {Advances in Intelligent and Soft Computing},
volume = {73},
pages = {219--225},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-13161-5\_28},
doi = {10.1007/978-3-642-13161-5\_28},
timestamp = {Fri, 27 Mar 2020 08:49:49 +0100},
biburl = {https://dblp.org/rec/conf/softcomp/BanerjeeDRA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/ChungPABW10,
author = {Jaeyong Chung and
Joonsung Park and
Jacob A. Abraham and
Eonjo Byun and
Cheol{-}Jong Woo},
title = {Reducing test time and area overhead of an embedded memory array built-in
repair analyzer with optimal repair rate},
booktitle = {28th {IEEE} {VLSI} Test Symposium, {VTS} 2010, April 19-22, 2010,
Santa Cruz, California, {USA}},
pages = {33--38},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/VTS.2010.5469625},
doi = {10.1109/VTS.2010.5469625},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/vts/ChungPABW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/odr/2010,
editor = {Marta Poblet and
Brooke Abrahams and
John Zeleznikow},
title = {Proceedings of the 6th International Workshop on Online Dispute Resolution
2010, Liverpool, United Kingdom, December 15, 2010},
series = {{CEUR} Workshop Proceedings},
volume = {684},
publisher = {CEUR-WS.org},
year = {2010},
url = {https://ceur-ws.org/Vol-684},
urn = {urn:nbn:de:0074-684-1},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/odr/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/uksim/2010,
editor = {David Al{-}Dabass and
Alessandra Orsoni and
Richard J. Cant and
Ajith Abraham},
title = {Proceedings of the 12th UKSim, International Conference on Computer
Modelling and Simulation, Cambridge, UK, 24-26 March 2010},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://ieeexplore.ieee.org/xpl/conhome/5479086/proceeding},
isbn = {978-0-7695-4016-0},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uksim/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/ArenasGJV09,
author = {Abraham J. Arenas and
Gilberto Gonz{\'{a}}lez{-}Parra and
Lucas J{\'{o}}dar and
Rafael J. Villanueva},
title = {Piecewise finite series solution of nonlinear initial value differential
problem},
journal = {Appl. Math. Comput.},
volume = {212},
number = {1},
pages = {209--215},
year = {2009},
url = {https://doi.org/10.1016/j.amc.2009.02.014},
doi = {10.1016/J.AMC.2009.02.014},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/amc/ArenasGJV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biosystems/ArenasGM09,
author = {Abraham J. Arenas and
Gilberto Gonz{\'{a}}lez{-}Parra and
Jos{\'{e}} Antonio Mora{\~{n}}o},
title = {Stochastic modeling of the transmission of respiratory syncytial virus
{(RSV)} in the region of Valencia, Spain},
journal = {Biosyst.},
volume = {96},
number = {3},
pages = {206--212},
year = {2009},
url = {https://doi.org/10.1016/j.biosystems.2009.01.007},
doi = {10.1016/J.BIOSYSTEMS.2009.01.007},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biosystems/ArenasGM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cma/Gonzalez-ParraAAVJ09,
author = {Gilberto C. Gonz{\'{a}}lez{-}Parra and
Abraham J. Arenas and
Diego F. Aranda and
Rafael J. Villanueva and
Lucas J{\'{o}}dar},
title = {Dynamics of a model of Toxoplasmosis disease in human and cat populations},
journal = {Comput. Math. Appl.},
volume = {57},
number = {10},
pages = {1692--1700},
year = {2009},
url = {https://doi.org/10.1016/j.camwa.2008.09.012},
doi = {10.1016/J.CAMWA.2008.09.012},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cma/Gonzalez-ParraAAVJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/MartiVD09,
author = {Rafael Mart{\'{\i}} and
Jos{\'{e}} Luis Gonz{\'{a}}lez Velarde and
Abraham Duarte},
title = {Heuristics for the bi-objective path dissimilarity problem},
journal = {Comput. Oper. Res.},
volume = {36},
number = {11},
pages = {2905--2912},
year = {2009},
url = {https://doi.org/10.1016/j.cor.2009.01.003},
doi = {10.1016/J.COR.2009.01.003},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/MartiVD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbpim/KimbroughAJEB09,
author = {Steven O. Kimbrough and
Alan S. Abrahams and
Andrew J. I. Jones and
David M. Eyers and
Jean Bacon},
title = {Introducing the fair and logical trade project},
journal = {Int. J. Bus. Process. Integr. Manag.},
volume = {4},
number = {3},
pages = {174--186},
year = {2009},
url = {https://doi.org/10.1504/IJBPIM.2009.030984},
doi = {10.1504/IJBPIM.2009.030984},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbpim/KimbroughAJEB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/ReddyPAMDY09,
author = {Madhu C. Reddy and
Sharoda A. Paul and
Joanna Abraham and
Michael D. McNeese and
Christopher DeFlitch and
John Yen},
title = {Challenges to effective crisis management: Using information and communication
technologies to coordinate emergency medical services and emergency
department teams},
journal = {Int. J. Medical Informatics},
volume = {78},
number = {4},
pages = {259--269},
year = {2009},
url = {https://doi.org/10.1016/j.ijmedinf.2008.08.003},
doi = {10.1016/J.IJMEDINF.2008.08.003},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/ReddyPAMDY09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jnca/MartiRMC09,
author = {Ramon Mart{\'{\i}} and
Sergi Robles and
Abraham Mart{\'{\i}}n{-}Campillo and
Jordi Cucurull{-}Juan},
title = {Providing early resource allocation during emergencies: The mobile
triage tag},
journal = {J. Netw. Comput. Appl.},
volume = {32},
number = {6},
pages = {1167--1182},
year = {2009},
url = {https://doi.org/10.1016/j.jnca.2009.05.006},
doi = {10.1016/J.JNCA.2009.05.006},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jnca/MartiRMC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KlimBRDFKLKWGKM09,
author = {Peter J. Klim and
John Barth and
William R. Reohr and
David Dick and
Gregory Fredeman and
Gary Koch and
Hien M. Le and
Aditya Khargonekar and
Pamela Wilcox and
John Golz and
Jente B. Kuang and
Abraham Mathews and
Jethro C. Law and
Trong Luong and
Hung C. Ngo and
Ryan Freese and
Hillery C. Hunter and
Erik Nelson and
Paul C. Parries and
Toshiaki Kirihata and
Subramanian S. Iyer},
title = {A 1 {MB} Cache Subsystem Prototype With 1.8 ns Embedded DRAMs in 45
nm {SOI} {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {44},
number = {4},
pages = {1216--1226},
year = {2009},
url = {https://doi.org/10.1109/JSSC.2009.2014207},
doi = {10.1109/JSSC.2009.2014207},
timestamp = {Fri, 25 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/KlimBRDFKLKWGKM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/libt/GutmannAAAABCCDKLMPRTY09,
author = {Myron P. Gutmann and
Mark Abrahamson and
Margaret O. Adams and
Micah Altman and
Caroline Arms and
Kenneth Bollen and
Michael Carlson and
Jonathan David Crabtree and
Darrell Donakowski and
Gary King and
Jared Lyle and
Marc Maynard and
Amy Pienta and
Richard Rockwell and
Lois Timms{-}Ferrara and
Copeland H. Young},
title = {From Preserving the Past to Preserving the Future: The Data-PASS Project
and the Challenges of Preserving Digital Social Science Data},
journal = {Libr. Trends},
volume = {57},
number = {3},
pages = {315--337},
year = {2009},
url = {https://doi.org/10.1353/lib.0.0039},
doi = {10.1353/LIB.0.0039},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/libt/GutmannAAAABCCDKLMPRTY09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lr/MendozaV09,
author = {Abraham Mendoza and
Jos{\'{e}} A. Ventura},
title = {Estimating freight rates in inventory replenishment and supplier selection
decisions},
journal = {Logist. Res.},
volume = {1},
number = {3-4},
pages = {185--196},
year = {2009},
url = {https://doi.org/10.1007/s12159-009-0018-5},
doi = {10.1007/S12159-009-0018-5},
timestamp = {Sun, 10 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lr/MendozaV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/WhiteSCPRSC09,
author = {Brian R. White and
Abraham Z. Snyder and
Alexander Li Cohen and
Steven E. Petersen and
Marcus E. Raichle and
Bradley L. Schlaggar and
Joseph P. Culver},
title = {Resting-state functional connectivity in the human brain revealed
with diffuse optical tomography},
journal = {NeuroImage},
volume = {47},
number = {1},
pages = {148--156},
year = {2009},
url = {https://doi.org/10.1016/j.neuroimage.2009.03.058},
doi = {10.1016/J.NEUROIMAGE.2009.03.058},
timestamp = {Thu, 13 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/WhiteSCPRSC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ram/HowFKBTBBR09,
author = {Jonathan P. How and
Cameron S. R. Fraser and
Karl C. Kulling and
Luca F. Bertuccelli and
Olivier Toupet and
Luc Brunet and
Abraham Bachrach and
Nicholas Roy},
title = {Increasing autonomy of UAVs},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {16},
number = {2},
pages = {43--51},
year = {2009},
url = {https://doi.org/10.1109/MRA.2009.932530},
doi = {10.1109/MRA.2009.932530},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ram/HowFKBTBBR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/transci/SimaoDGGNP09,
author = {Hugo P. Sim{\~{a}}o and
Jeff Day and
Abraham P. George and
Ted Gifford and
John Nienow and
Warren B. Powell},
title = {An Approximate Dynamic Programming Algorithm for Large-Scale Fleet
Management: {A} Case Application},
journal = {Transp. Sci.},
volume = {43},
number = {2},
pages = {178--197},
year = {2009},
url = {https://doi.org/10.1287/trsc.1080.0238},
doi = {10.1287/TRSC.1080.0238},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/transci/SimaoDGGNP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaim/AbrahamCFFZ09,
author = {John Abraham and
Zhixiang Chen and
Richard H. Fowler and
Bin Fu and
Binhai Zhu},
editor = {Andrew V. Goldberg and
Yunhong Zhou},
title = {On the Approximability of Some Haplotyping Problems},
booktitle = {Algorithmic Aspects in Information and Management, 5th International
Conference, {AAIM} 2009, San Francisco, CA, USA, June 15-17, 2009.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5564},
pages = {3--14},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02158-9\_3},
doi = {10.1007/978-3-642-02158-9\_3},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaim/AbrahamCFFZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/AbrahamKR09,
author = {Joanna Abraham and
Thomas George Kannampallil and
Madhu C. Reddy},
title = {Peripheral Activities during {EMR} Use in Emergency Care: {A} Case
Study},
booktitle = {{AMIA} 2009, American Medical Informatics Association Annual Symposium,
San Francisco, CA, USA, November 14-18, 2009},
publisher = {{AMIA}},
year = {2009},
url = {https://knowledge.amia.org/amia-55142-a2009a-1.626575/t-001-1.627318/f-001-1.627319/a-001-1.627718},
timestamp = {Wed, 17 Apr 2024 11:48:10 +0200},
biburl = {https://dblp.org/rec/conf/amia/AbrahamKR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ats/ParkCA09,
author = {Joonsung Park and
Jaeyong Chung and
Jacob A. Abraham},
title = {LFSR-Based Performance Characterization of Nonlinear Analog and Mixed-Signal
Circuits},
booktitle = {Proceedings of the Eighteentgh Asian Test Symposium, {ATS} 2009, 23-26
November 2009, Taichung, Taiwan},
pages = {373--378},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ATS.2009.66},
doi = {10.1109/ATS.2009.66},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ats/ParkCA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisis-spain/ChoudhuryBDAS09,
author = {Joydeb Roy Choudhury and
Tribeni Prasad Banerjee and
Swagatam Das and
Ajith Abraham and
V{\'{a}}clav Sn{\'{a}}sel},
editor = {{\'{A}}lvaro Herrero and
Paolo Gastaldo and
Rodolfo Zunino and
Emilio Corchado},
title = {Fuzzy Rule Based Intelligent Security and Fire Detector System},
booktitle = {Computational Intelligence in Security for Information Systems - CISIS'09,
2nd International Workshop, Burgos, Spain, 23-26 September 2009 Proceedings},
series = {Advances in Intelligent and Soft Computing},
volume = {63},
pages = {45--51},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-04091-7\_6},
doi = {10.1007/978-3-642-04091-7\_6},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cisis-spain/ChoudhuryBDAS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/TappoletB09,
author = {Jonas Tappolet and
Abraham Bernstein},
editor = {Lora Aroyo and
Paolo Traverso and
Fabio Ciravegna and
Philipp Cimiano and
Tom Heath and
Eero Hyv{\"{o}}nen and
Riichiro Mizoguchi and
Eyal Oren and
Marta Sabou and
Elena Simperl},
title = {Applied Temporal {RDF:} Efficient Temporal Querying of {RDF} Data
with {SPARQL}},
booktitle = {The Semantic Web: Research and Applications, 6th European Semantic
Web Conference, {ESWC} 2009, Heraklion, Crete, Greece, May 31-June
4, 2009, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5554},
pages = {308--322},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02121-3\_25},
doi = {10.1007/978-3-642-02121-3\_25},
timestamp = {Fri, 23 Jun 2023 11:56:12 +0200},
biburl = {https://dblp.org/rec/conf/esws/TappoletB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/etfa/MoutonS09,
author = {Abraham Jacobus Johannes Mouton and
George E. Smith},
title = {Effective Remote Control of Electric Motors using {GSM} Technology},
booktitle = {Proceedings of 12th {IEEE} International Conference on Emerging Technologies
and Factory Automation, {ETFA} 2009, September 22-25, 2008, Palma
de Mallorca, Spain},
pages = {1--7},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ETFA.2009.5347030},
doi = {10.1109/ETFA.2009.5347030},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/etfa/MoutonS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ets/HanPLABWO09,
author = {Kihyuk Han and
Joonsung Park and
Jae Wook Lee and
Jacob A. Abraham and
Eonjo Byun and
Cheol{-}Jong Woo and
Sejang Oh},
title = {Low-Complexity Off-Chip Skew Measurement and Compensation Module {(SMCM)}
Design for Built-Off Test Chip},
booktitle = {14th {IEEE} European Test Symposium, {ETS} 2009, Sevilla, Spain, May
25-29, 2009},
pages = {129--134},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ETS.2009.20},
doi = {10.1109/ETS.2009.20},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ets/HanPLABWO09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hima/MelendezCGGS09,
author = {Abraham Melendez and
Oscar Castillo and
Arnulfo Alanis Garza and
Mario Garc{\'{\i}}a Valdez and
Jos{\'{e}} Soria},
title = {Fuzzy logic reactive control of an autonomous mobile robot in a distributed
environment},
booktitle = {2009 {IEEE} Workshop on Hybrid Intelligent Models and Applications,
{HIMA} 2009, Nashville, TN, USA, March 30, 2009},
pages = {13--18},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/HIMA.2009.4937819},
doi = {10.1109/HIMA.2009.4937819},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/hima/MelendezCGGS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/his/RoychoudhuryBBA09,
author = {Joydeb Roychoudhury and
Tribeni Prasad Banerjee and
Anup K. Bandopadhaya and
Ajith Abraham},
editor = {Ge Yu and
Mario K{\"{o}}ppen and
Shyi{-}Ming Chen and
Xiamu Niu},
title = {Design Methodology of a Fault Aware Controller Using an Incipient
Fault Diagonizer},
booktitle = {9th International Conference on Hybrid Intelligent Systems {(HIS}
2009), August 12-14, 2009, Shenyang, China},
pages = {15--19},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/HIS.2009.216},
doi = {10.1109/HIS.2009.216},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/his/RoychoudhuryBBA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icail/ZeleznikowA09,
author = {John Zeleznikow and
Brooke Abrahams},
title = {Incorporating issues of fairness into development of a multi-agent
negotiation support system},
booktitle = {The 12th International Conference on Artificial Intelligence and Law,
Proceedings of the Conference, June 8-12, 2009, Barcelona, Spain},
pages = {177--184},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1568234.1568254},
doi = {10.1145/1568234.1568254},
timestamp = {Tue, 06 Nov 2018 16:58:12 +0100},
biburl = {https://dblp.org/rec/conf/icail/ZeleznikowA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/TjioeWLX09,
author = {Jonathan Tjioe and
Renata Widjaja and
Abraham Lee and
Tao Xie},
title = {{DORA:} {A} Dynamic File Assignment Strategy with Replication},
booktitle = {{ICPP} 2009, International Conference on Parallel Processing, Vienna,
Austria, 22-25 September 2009},
pages = {148--155},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICPP.2009.8},
doi = {10.1109/ICPP.2009.8},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/TjioeWLX09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/MurphyFACSG09,
author = {Michael A. Murphy and
Michael Fenn and
Linton Abraham and
Joshua A. Canter and
Benjamin T. Sterrett and
Sebastien Goasguen},
title = {Distributed management of virtual cluster infrastructures},
booktitle = {23rd {IEEE} International Symposium on Parallel and Distributed Processing,
{IPDPS} 2009, Rome, Italy, May 23-29, 2009},
pages = {1--8},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/IPDPS.2009.5161235},
doi = {10.1109/IPDPS.2009.5161235},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/MurphyFACSG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/msr/EkanayakeTGB09,
author = {Jayalath Ekanayake and
Jonas Tappolet and
Harald C. Gall and
Abraham Bernstein},
editor = {Michael W. Godfrey and
Jim Whitehead},
title = {Tracking concept drift of software projects using defect prediction
quality},
booktitle = {Proceedings of the 6th International Working Conference on Mining
Software Repositories, {MSR} 2009 (Co-located with ICSE), Vancouver,
BC, Canada, May 16-17, 2009, Proceedings},
pages = {51--60},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/MSR.2009.5069480},
doi = {10.1109/MSR.2009.5069480},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/msr/EkanayakeTGB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paams/Martinez-GarciaNBM09,
author = {Carles Mart{\'{\i}}nez{-}Garc{\'{\i}}a and
Guillermo Navarro{-}Arribas and
Joan Borrell and
Abraham Mart{\'{\i}}n{-}Campillo},
editor = {Yves Demazeau and
Juan Pav{\'{o}}n and
Juan M. Corchado and
Javier Bajo},
title = {An Access Control Scheme for Multi-agent Systems over Multi-Domain
Environments},
booktitle = {7th International Conference on Practical Applications of Agents and
Multi-Agent Systems, {PAAMS} 2009, Salamanca, Spain, 25-27 March 2009},
series = {Advances in Intelligent and Soft Computing},
volume = {55},
pages = {401--410},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-00487-2\_43},
doi = {10.1007/978-3-642-00487-2\_43},
timestamp = {Fri, 19 May 2017 01:26:06 +0200},
biburl = {https://dblp.org/rec/conf/paams/Martinez-GarciaNBM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigsoft/BirdBADBFD09,
author = {Christian Bird and
Adrian Bachmann and
Eirik Aune and
John Duffy and
Abraham Bernstein and
Vladimir Filkov and
Premkumar T. Devanbu},
editor = {Hans van Vliet and
Val{\'{e}}rie Issarny},
title = {Fair and balanced?: bias in bug-fix datasets},
booktitle = {Proceedings of the 7th joint meeting of the European Software Engineering
Conference and the {ACM} {SIGSOFT} International Symposium on Foundations
of Software Engineering, 2009, Amsterdam, The Netherlands, August
24-28, 2009},
pages = {121--130},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1595696.1595716},
doi = {10.1145/1595696.1595716},
timestamp = {Tue, 01 Feb 2022 10:45:16 +0100},
biburl = {https://dblp.org/rec/conf/sigsoft/BirdBADBFD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/simutools/MukwevhoPJ09,
author = {Abraham Mukosi Mukwevho and
John Andrew van der Poll and
Robert Mark Jolliffe},
editor = {Olivier Dalle and
Gabriel A. Wainer and
L. Felipe Perrone and
Giovanni Stea},
title = {A virtual integrated network emulator on {XEN} (viNEX)},
booktitle = {Proceedings of the 2nd International Conference on Simulation Tools
and Techniques for Communications, Networks and Systems, SimuTools
2009, Rome, Italy, March 2-6, 2009},
pages = {3},
publisher = {{ICST/ACM}},
year = {2009},
url = {https://doi.org/10.4108/ICST.SIMUTOOLS2009.5745},
doi = {10.4108/ICST.SIMUTOOLS2009.5745},
timestamp = {Tue, 27 Nov 2018 10:40:37 +0100},
biburl = {https://dblp.org/rec/conf/simutools/MukwevhoPJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uksim/VillamizarBA09,
author = {Jos{\'{e}} Francisco Saray Villamizar and
Youakim Badr and
Ajith Abraham},
editor = {David Al{-}Dabass},
title = {An Enhanced Fuzzy-Genetic Algorithm to Solve Satisfiability Problems},
booktitle = {Proceedings of the UKSim'11, International Conference on Computer
Modelling and Simulation, Cambridge University, Emmanuel College,
Cambridge, UK, 25-27 March 2009},
pages = {77--82},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/UKSIM.2009.106},
doi = {10.1109/UKSIM.2009.106},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uksim/VillamizarBA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xpu/FraserADKPS09,
author = {Steven Fraser and
Pekka Abrahamsson and
Rachel Davies and
Joshua Kerievsky and
Mary Poppendieck and
Giancarlo Succi},
editor = {Pekka Abrahamsson and
Michele Marchesi and
Frank Maurer},
title = {The Future of Lean in an Agile World},
booktitle = {Agile Processes in Software Engineering and Extreme Programming, 10th
International Conference, {XP} 2009, Pula, Sardinia, Italy, May 25-29,
2009. Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {31},
pages = {263--266},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-01853-4\_60},
doi = {10.1007/978-3-642-01853-4\_60},
timestamp = {Sat, 19 Oct 2019 20:05:08 +0200},
biburl = {https://dblp.org/rec/conf/xpu/FraserADKPS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/PaucaFRGT09,
author = {V. Paul Pauca and
Kelly Smith Faddis and
Arun Ross and
Joseph van der Gracht and
Todd C. Torgersen},
editor = {Stan Z. Li and
Anil K. Jain},
title = {Wavefront Coded{\textregistered} Iris Biometric Systems},
booktitle = {Encyclopedia of Biometrics},
pages = {1397--1402},
publisher = {Springer {US}},
year = {2009},
url = {https://doi.org/10.1007/978-0-387-73003-5\_215},
doi = {10.1007/978-0-387-73003-5\_215},
timestamp = {Fri, 27 Oct 2017 15:34:05 +0200},
biburl = {https://dblp.org/rec/reference/bio/PaucaFRGT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/AbrahamRP08,
author = {Anne{-}Laure Abraham and
Eduardo P. C. Rocha and
Jo{\"{e}}l Pothier},
title = {Swelfe: a detector of internal repeats in sequences and structures},
journal = {Bioinform.},
volume = {24},
number = {13},
pages = {1536--1537},
year = {2008},
url = {https://doi.org/10.1093/bioinformatics/btn234},
doi = {10.1093/BIOINFORMATICS/BTN234},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/AbrahamRP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/AbrahamPR08,
author = {Anne{-}Laure Abraham and
Jo{\"{e}}l Pothier and
Eduardo P. C. Rocha},
title = {Protein evolution driven by symmetric structural repeats},
journal = {{BMC} Bioinform.},
volume = {9},
number = {{S-10}},
year = {2008},
url = {http://www.biomedcentral.com/1471-2105/9/S10/P3},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/AbrahamPR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cma/ArenasMC08,
author = {Abraham J. Arenas and
Jos{\'{e}} Antonio Mora{\~{n}}o and
Juan Carlos Cort{\'{e}}s},
title = {Non-standard numerical method for a mathematical model of {RSV} epidemiological
transmission},
journal = {Comput. Math. Appl.},
volume = {56},
number = {3},
pages = {670--678},
year = {2008},
url = {https://doi.org/10.1016/j.camwa.2008.01.010},
doi = {10.1016/J.CAMWA.2008.01.010},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cma/ArenasMC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hij/LorenceA08,
author = {Daniel P. Lorence and
Joanna Abraham},
title = {A study of undue pain and surfing: using hierarchical criteria to
assess website quality},
journal = {Health Informatics J.},
volume = {14},
number = {3},
pages = {155--173},
year = {2008},
url = {https://doi.org/10.1177/1081180X08092827},
doi = {10.1177/1081180X08092827},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/hij/LorenceA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mcm/JodarVA08,
author = {Lucas J{\'{o}}dar and
Rafael J. Villanueva and
Abraham J. Arenas},
title = {Modeling the spread of seasonal epidemiological diseases: Theory and
applications},
journal = {Math. Comput. Model.},
volume = {48},
number = {3-4},
pages = {548--557},
year = {2008},
url = {https://doi.org/10.1016/j.mcm.2007.08.017},
doi = {10.1016/J.MCM.2007.08.017},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mcm/JodarVA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mcs/JodarVAG08,
author = {Lucas J{\'{o}}dar and
Rafael J. Villanueva and
Abraham J. Arenas and
Gilberto C. Gonz{\'{a}}lez{-}Parra},
title = {Nonstandard numerical methods for a mathematical model for influenza
disease},
journal = {Math. Comput. Simul.},
volume = {79},
number = {3},
pages = {622--633},
year = {2008},
url = {https://doi.org/10.1016/j.matcom.2008.04.008},
doi = {10.1016/J.MATCOM.2008.04.008},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mcs/JodarVAG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/AbrahamZCSR08,
author = {Doron Abraham and
Zeev Zalevsky and
Avraham Chelly and
Jossef Shappir and
Michael Rosenbluh},
title = {Silicon on insulator photo-activated modulator},
journal = {Microelectron. J.},
volume = {39},
number = {12},
pages = {1429--1432},
year = {2008},
url = {https://doi.org/10.1016/j.mejo.2008.06.075},
doi = {10.1016/J.MEJO.2008.06.075},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/AbrahamZCSR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/PantrigoSMD08,
author = {Juan Jos{\'{e}} Pantrigo and
{\'{A}}ngel S{\'{a}}nchez and
Antonio S. Montemayor and
Abraham Duarte},
title = {Multi-dimensional visual tracking using scatter search particle filter},
journal = {Pattern Recognit. Lett.},
volume = {29},
number = {8},
pages = {1160--1174},
year = {2008},
url = {https://doi.org/10.1016/j.patrec.2007.12.012},
doi = {10.1016/J.PATREC.2007.12.012},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/prl/PantrigoSMD08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/IshiharaDB08,
author = {Abraham K. Ishihara and
Johan van Doornik and
Shahar Ben{-}Menahem},
title = {Feedback Error Learning with a noisy teacher},
booktitle = {American Control Conference, {ACC} 2008, Seattle, WA, USA, 11-13 June
2008},
pages = {4529--4534},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ACC.2008.4587209},
doi = {10.1109/ACC.2008.4587209},
timestamp = {Fri, 03 Dec 2021 13:02:23 +0100},
biburl = {https://dblp.org/rec/conf/amcc/IshiharaDB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/PaulRAD08,
author = {Sharoda A. Paul and
Madhu C. Reddy and
Joanna Abraham and
Christopher DeFlitch},
title = {The Usefulness of Information and Communication Technologies in Crisis
Response},
booktitle = {{AMIA} 2008, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 8-12, 2008},
publisher = {{AMIA}},
year = {2008},
url = {https://knowledge.amia.org/amia-55142-a2008a-1.625176/t-001-1.626020/f-001-1.626021/a-116-1.626216/a-117-1.626213},
timestamp = {Wed, 17 Apr 2024 11:48:12 +0200},
biburl = {https://dblp.org/rec/conf/amia/PaulRAD08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asiams/HaslumAK08,
author = {Kjetil Haslum and
Ajith Abraham and
Svein J. Knapskog},
title = {HiNFRA: Hierarchical Neuro-Fuzzy Learning for Online Risk Assessment},
booktitle = {Second Asia International Conference on Modelling and Simulation,
{AMS} 2008, Kuala Lumpur, Malaysia, May 13-15, 2008},
pages = {631--636},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/AMS.2008.120},
doi = {10.1109/AMS.2008.120},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asiams/HaslumAK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/AbrahamR08,
author = {Joanna Abraham and
Madhu C. Reddy},
editor = {Bo Begole and
David W. McDonald},
title = {Moving patients around: a field study of coordination between clinical
and non-clinical staff in hospitals},
booktitle = {Proceedings of the 2008 {ACM} Conference on Computer Supported Cooperative
Work, {CSCW} 2008, San Diego, CA, USA, November 8-12, 2008},
pages = {225--228},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1460563.1460598},
doi = {10.1145/1460563.1460598},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cscw/AbrahamR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dcc/GilbertA08,
author = {John Gilbert and
David M. Abrahamson},
title = {Adaptive Compression of Graph Structured Text},
booktitle = {2008 Data Compression Conference {(DCC} 2008), 25-27 March 2008, Snowbird,
UT, {USA}},
pages = {519},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/DCC.2008.42},
doi = {10.1109/DCC.2008.42},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dcc/GilbertA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/KuangMBGNSNCPNV08,
author = {Jente B. Kuang and
Abraham Mathews and
John Barth and
Fadi H. Gebara and
Tuyet Nguyen and
Jeremy D. Schaub and
Kevin J. Nowka and
Gary D. Carpenter and
Don Plass and
Erik Nelson and
Ivan Vo and
William R. Reohr and
Toshiaki Kirihata},
editor = {William Redman{-}White and
Anthony J. Walton},
title = {An on-chip dual supply charge pump system for 45nm {PD} {SOI} eDRAM},
booktitle = {{ESSCIRC} 2008 - 34th European Solid-State Circuits Conference, Edinburgh,
Scotland, UK, 15-19 September 2008},
pages = {66--69},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ESSCIRC.2008.4681793},
doi = {10.1109/ESSCIRC.2008.4681793},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/KuangMBGNSNCPNV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/RobertsonWAP08,
author = {Scott P. Robertson and
Christine E. Wania and
George Abraham and
Sang Joon Park},
title = {Drop-Down Democracy: Internet Portal Design Influences Voters' Search
Strategies},
booktitle = {41st Hawaii International International Conference on Systems Science
{(HICSS-41} 2008), Proceedings, 7-10 January 2008, Waikoloa, Big Island,
HI, {USA}},
pages = {191},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HICSS.2008.131},
doi = {10.1109/HICSS.2008.131},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/RobertsonWAP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hucom/AbrahamsZ08,
author = {Brooke Abrahams and
John Zeleznikow},
editor = {Koen V. Hindriks and
Willem{-}Paul Brinkman},
title = {Asset negotiation and trade-off support within a multi-agent environment},
booktitle = {Proceedings of the 1st International Working Conference on Human Factors
and Computational Models in Negotiation, HuCom '08, Delft, The Netherlands,
December 8-9, 2008},
pages = {4--10},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1609170.1609171},
doi = {10.1145/1609170.1609171},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hucom/AbrahamsZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ncm/AbrahamAL08,
author = {Blanca Z. Abraham and
Jos{\'{e}} Aguilar and
Ernst L. Leiss},
editor = {Jinhwa Kim and
Dursun Delen and
Jinsoo Park and
Franz Ko and
Yun Ji Na},
title = {Middleware for Improving Security in a Component Based Software Architecture},
booktitle = {{NCM} 2008, The Fourth International Conference on Networked Computing
and Advanced Information Management, Gyeongju, Korea, September 2-4,
2008 - Volume 1},
pages = {502--509},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/NCM.2008.261},
doi = {10.1109/NCM.2008.261},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ncm/AbrahamAL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/odr/AbrahamsZ08,
author = {Brooke Abrahams and
John Zeleznikow},
editor = {Marta Poblet},
title = {A Multi-Agent Architecture for Online Dispute Resolution Services},
booktitle = {Proceedings of the 5th International Workshop on Online Dispute Resolution,
in conjunction with the 21st International Conference on Legal Knowledge
and Information Systems {(JURIX} 2008), Firenze, Italy, December 13,
2008},
series = {{CEUR} Workshop Proceedings},
volume = {430},
publisher = {CEUR-WS.org},
year = {2008},
url = {https://ceur-ws.org/Vol-430/Paper7.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:27 +0100},
biburl = {https://dblp.org/rec/conf/odr/AbrahamsZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/podc/AbrahamDH08,
author = {Ittai Abraham and
Danny Dolev and
Joseph Y. Halpern},
editor = {Rida A. Bazzi and
Boaz Patt{-}Shamir},
title = {An almost-surely terminating polynomial protocol forasynchronous byzantine
agreement with optimal resilience},
booktitle = {Proceedings of the Twenty-Seventh Annual {ACM} Symposium on Principles
of Distributed Computing, {PODC} 2008, Toronto, Canada, August 18-21,
2008},
pages = {405--414},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1400751.1400804},
doi = {10.1145/1400751.1400804},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/podc/AbrahamDH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tcc/AbrahamDH08,
author = {Ittai Abraham and
Danny Dolev and
Joseph Y. Halpern},
editor = {Ran Canetti},
title = {Lower Bounds on Implementing Robust and Resilient Mediators},
booktitle = {Theory of Cryptography, Fifth Theory of Cryptography Conference, {TCC}
2008, New York, USA, March 19-21, 2008},
series = {Lecture Notes in Computer Science},
volume = {4948},
pages = {302--319},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-78524-8\_17},
doi = {10.1007/978-3-540-78524-8\_17},
timestamp = {Tue, 14 May 2019 10:00:47 +0200},
biburl = {https://dblp.org/rec/conf/tcc/AbrahamDH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uksim/HaslumAK08,
author = {Kjetil Haslum and
Ajith Abraham and
Svein Johan Knapskog},
editor = {David Al{-}Dabass and
Alessandra Orsoni and
Adam Brentnall and
Ajith Abraham and
Richard N. Zobel},
title = {Fuzzy Online Risk Assessment for Distributed Intrusion Prediction
and Prevention Systems},
booktitle = {Proceedings of the 10th EUROS/UKSim International Conference on Computer
Modelling and Simulation, Cambridge University, Emmanuel College,
Cambridge, UK, 1-3 April 2008},
pages = {216--223},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/UKSIM.2008.30},
doi = {10.1109/UKSIM.2008.30},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uksim/HaslumAK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/ParkSA08,
author = {Joonsung Park and
Hongjoong Shin and
Jacob A. Abraham},
title = {Parallel Loopback Test of Mixed-Signal Circuits},
booktitle = {26th {IEEE} {VLSI} Test Symposium {(VTS} 2008), April 27 - May 1,
2008, San Diego, California, {USA}},
pages = {309--316},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/VTS.2008.53},
doi = {10.1109/VTS.2008.53},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vts/ParkSA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/08/ParmeeAM08,
author = {Ian C. Parmee and
Johnson A. R. Abraham and
Azahar Tekchand Machwe},
editor = {Joshua D. Knowles and
David Corne and
Kalyanmoy Deb},
title = {User-Centric Evolutionary Computing: Melding Human and Machine Capability
to Satisfy Multiple Criteria},
booktitle = {Multiobjective Problem Solving from Nature},
series = {Natural Computing Series},
pages = {263--283},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-72964-8\_13},
doi = {10.1007/978-3-540-72964-8\_13},
timestamp = {Wed, 17 Jul 2019 14:23:55 +0200},
biburl = {https://dblp.org/rec/books/sp/08/ParmeeAM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/his/2008,
editor = {Fatos Xhafa and
Francisco Herrera and
Ajith Abraham and
Mario K{\"{o}}ppen and
Jos{\'{e}} Manuel Ben{\'{\i}}tez},
title = {8th International Conference on Hybrid Intelligent Systems {(HIS}
2008), September 10-12, 2008, Barcelona, Spain},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://ieeexplore.ieee.org/xpl/conhome/4626579/proceeding},
isbn = {978-0-7695-3326-1},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/his/2008.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0808-1505,
author = {Ittai Abraham and
Danny Dolev and
Joseph Y. Halpern},
title = {An Almost-Surely Terminating Polynomial Protocol for Asynchronous
Byzantine Agreement with Optimal Resilience},
journal = {CoRR},
volume = {abs/0808.1505},
year = {2008},
url = {http://arxiv.org/abs/0808.1505},
eprinttype = {arXiv},
eprint = {0808.1505},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0808-1505.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/db/JunglasJSAL07,
author = {Iris A. Junglas and
Norman A. Johnson and
Douglas J. Steel and
Chon Abraham and
Paul Mac Loughlin},
title = {Identity formation, learning styles and trust in virtual worlds},
journal = {Data Base},
volume = {38},
number = {4},
pages = {90--96},
year = {2007},
url = {https://doi.org/10.1145/1314234.1314251},
doi = {10.1145/1314234.1314251},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/db/JunglasJSAL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/ReddyA07,
author = {Madhu C. Reddy and
Joanna Abraham},
title = {Handbook of Evaluation Methods for Health Informatics, Jytte Brender
{(2005).} {ISBN:} 0-12-370464-2, {GBP69.95}},
journal = {Inf. Process. Manag.},
volume = {43},
number = {1},
pages = {287--288},
year = {2007},
url = {https://doi.org/10.1016/j.ipm.2006.05.006},
doi = {10.1016/J.IPM.2006.05.006},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/ReddyA07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/CorwinSMM07,
author = {John Corwin and
Avi Silberschatz and
Perry L. Miller and
Luis N. Marenco},
title = {Application of Information Technology: Dynamic Tables: An Architecture
for Managing Evolving, Heterogeneous Biomedical Data in Relational
Database Management Systems},
journal = {J. Am. Medical Informatics Assoc.},
volume = {14},
number = {1},
pages = {86--93},
year = {2007},
url = {https://doi.org/10.1197/jamia.M2189},
doi = {10.1197/JAMIA.M2189},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/CorwinSMM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/PremnathA07,
author = {Kannan N. Premnath and
John Abraham},
title = {Three-dimensional multi-relaxation time {(MRT)} lattice-Boltzmann
models for multiphase flow},
journal = {J. Comput. Phys.},
volume = {224},
number = {2},
pages = {539--559},
year = {2007},
url = {https://doi.org/10.1016/j.jcp.2006.10.023},
doi = {10.1016/J.JCP.2006.10.023},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/PremnathA07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jnca/AbrahamJTH07,
author = {Ajith Abraham and
Ravi Jain and
Johnson P. Thomas and
Sang{-}Yong Han},
title = {{D-SCIDS:} Distributed soft computing intrusion detection system},
journal = {J. Netw. Comput. Appl.},
volume = {30},
number = {1},
pages = {81--98},
year = {2007},
url = {https://doi.org/10.1016/j.jnca.2005.06.001},
doi = {10.1016/J.JNCA.2005.06.001},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jnca/AbrahamJTH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jnca/PeddabachigariAGT07,
author = {Sandhya Peddabachigari and
Ajith Abraham and
Crina Grosan and
Johnson P. Thomas},
title = {Modeling intrusion detection system using hybrid intelligent systems},
journal = {J. Netw. Comput. Appl.},
volume = {30},
number = {1},
pages = {114--132},
year = {2007},
url = {https://doi.org/10.1016/j.jnca.2005.06.003},
doi = {10.1016/J.JNCA.2005.06.003},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jnca/PeddabachigariAGT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ram/WoodASSEBBS07,
author = {Robert J. Wood and
Srinath Avadhanula and
Erik Steltz and
Michael D. Seeman and
Jon Entwistle and
Abraham Bachrach and
Geoffrey L. Barrows and
Seth Sanders},
title = {An Autonomous Palm-Sized Gliding Micro Air Vehicle},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {14},
number = {2},
pages = {82--91},
year = {2007},
url = {https://doi.org/10.1109/MRA.2007.380656},
doi = {10.1109/MRA.2007.380656},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ram/WoodASSEBBS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taasm/AbrahamD07,
author = {John Abraham and
Courtney Davis},
title = {Interpellative Sociology of Pharmaceuticals: Problems and Challenges
for Innovation and Regulation in the 21st Century},
journal = {Technol. Anal. Strateg. Manag.},
volume = {19},
number = {3},
pages = {387--402},
year = {2007},
url = {https://doi.org/10.1080/09537320701281607},
doi = {10.1080/09537320701281607},
timestamp = {Thu, 08 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taasm/AbrahamD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEias/HaslumAK07,
author = {Kjetil Haslum and
Ajith Abraham and
Svein J. Knapskog},
editor = {Ning Zhang and
Ajith Abraham},
title = {{DIPS:} {A} Framework for Distributed Intrusion Prediction and Prevention
Using Hidden Markov Models and Online Fuzzy Risk Assessment},
booktitle = {Proceedings of the Third International Symposium on Information Assurance
and Security, {IAS} 2007, August 29-31, 2007, Manchester, United Kingdom},
pages = {183--190},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/IAS.2007.67},
doi = {10.1109/IAS.2007.67},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEias/HaslumAK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aime/ZhuAPRYPD07,
author = {Shizhuo Zhu and
Joanna Abraham and
Sharoda A. Paul and
Madhu C. Reddy and
John Yen and
Mark S. Pfaff and
Christopher DeFlitch},
editor = {Riccardo Bellazzi and
Ameen Abu{-}Hanna and
Jim Hunter},
title = {{R-CAST-MED:} Applying Intelligent Agents to Support Emergency Medical
Decision-Making Teams},
booktitle = {Artificial Intelligence in Medicine, 11th Conference on Artificial
Intelligence in Medicine, {AIME} 2007, Amsterdam, The Netherlands,
July 7-11, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4594},
pages = {24--33},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-73599-1\_3},
doi = {10.1007/978-3-540-73599-1\_3},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/aime/ZhuAPRYPD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csreaSAM/FuAA07,
author = {Bin Fu and
Sai Aravalli and
John Abraham},
editor = {Selim Aissi and
Hamid R. Arabnia},
title = {Software Protection by Hardware and Obfuscation},
booktitle = {Proceedings of the 2007 International Conference on Security {\&}
Management, {SAM} 2007, Las Vegas, Nevada, USA, June 25-28, 2007},
pages = {367--373},
publisher = {{CSREA} Press},
year = {2007},
timestamp = {Wed, 12 Dec 2007 16:45:17 +0100},
biburl = {https://dblp.org/rec/conf/csreaSAM/FuAA07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/KieferBLKS07,
author = {Christoph Kiefer and
Abraham Bernstein and
Hong Joo Lee and
Mark Klein and
Markus Stocker},
editor = {Enrico Franconi and
Michael Kifer and
Wolfgang May},
title = {Semantic Process Retrieval with iSPARQL},
booktitle = {The Semantic Web: Research and Applications, 4th European Semantic
Web Conference, {ESWC} 2007, Innsbruck, Austria, June 3-7, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4519},
pages = {609--623},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72667-8\_43},
doi = {10.1007/978-3-540-72667-8\_43},
timestamp = {Mon, 27 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esws/KieferBLKS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icann/IshiharaDS07,
author = {Abraham K. Ishihara and
Johan van Doornik and
Terence D. Sanger},
editor = {Joaquim Marques de S{\'{a}} and
Lu{\'{\i}}s A. Alexandre and
Wlodzislaw Duch and
Danilo P. Mandic},
title = {A Direct Measurement of Internal Model Learning Rates in a Visuomotor
Tracking Task},
booktitle = {Artificial Neural Networks - {ICANN} 2007, 17th International Conference,
Porto, Portugal, September 9-13, 2007, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {4669},
pages = {39--48},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-74695-9\_5},
doi = {10.1007/978-3-540-74695-9\_5},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/icann/IshiharaDS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/ParkSA07,
author = {Joonsung Park and
Hongjoong Shin and
Jacob A. Abraham},
title = {Pseudorandom Test for Nonlinear Circuits Based on a Simplified Volterra
Series Model},
booktitle = {8th International Symposium on Quality of Electronic Design {(ISQED}
2007), 26-28 March 2007, San Jose, CA, {USA}},
pages = {495--500},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ISQED.2007.130},
doi = {10.1109/ISQED.2007.130},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isqed/ParkSA07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwinac/CaamanoPBDB07,
author = {Pilar Caama{\~{n}}o and
Abraham Prieto and
Jos{\'{e}} Antonio Becerra and
Richard J. Duro and
Francisco Bellas},
editor = {Jos{\'{e}} Mira and
Jos{\'{e}} R. {\'{A}}lvarez},
title = {Evolutionary Tool for the Incremental Design of Controllers for Collective
Behaviors},
booktitle = {Bio-inspired Modeling of Cognitive Tasks, Second International Work-Conference
on the Interplay Between Natural and Artificial Computation, {IWINAC}
2007, La Manga del Mar Menor, Spain, June 18-21, 2007, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {4527},
pages = {587--596},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-73053-8\_59},
doi = {10.1007/978-3-540-73053-8\_59},
timestamp = {Wed, 13 Jan 2021 08:41:00 +0100},
biburl = {https://dblp.org/rec/conf/iwinac/CaamanoPBDB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kesamsta/AbrahamA07,
author = {Blanca Z. Abraham and
Jos{\'{e}} Aguilar},
editor = {Ngoc Thanh Nguyen and
Adam Grzech and
Robert J. Howlett and
Lakhmi C. Jain},
title = {Software Component Selection Algorithm Using Intelligent Agents},
booktitle = {Agent and Multi-Agent Systems: Technologies and Applications, First
{KES} International Symposium, {KES-AMSTA} 2007, Wroclaw, Poland,
May 31- June 1, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4496},
pages = {82--91},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72830-6\_9},
doi = {10.1007/978-3-540-72830-6\_9},
timestamp = {Thu, 16 Mar 2023 20:00:31 +0100},
biburl = {https://dblp.org/rec/conf/kesamsta/AbrahamA07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/TierneyRHSBMNKWSSKMME07,
author = {William M. Tierney and
Joseph K. Rotich and
Terry J. Hannan and
Abraham M. Siika and
Paul G. Biondich and
Burke W. Mamlin and
Winstone M. Nyandiko and
Sylvester N. Kimaiyo and
Kara Wools{-}Kaloustian and
John E. Sidle and
Chrispinus J. Simiyu and
Erica M. Kigotho and
Beverly Musick and
Joseph J. Mamlin and
Robert M. Einterz},
editor = {Klaus A. Kuhn and
James R. Warren and
Tze{-}Yun Leong},
title = {The {AMPATH} Medical Record System: Creating, Implementing, and Sustaining
an Electronic Medical Record System to Support Hiv/AIDS Care in Western
Kenya},
booktitle = {{MEDINFO} 2007 - Proceedings of the 12th World Congress on Health
(Medical) Informatics - Building Sustainable Health Systems, 20-24
August, 2007, Brisbane, Australia},
series = {Studies in Health Technology and Informatics},
volume = {129},
pages = {372--376},
publisher = {{IOS} Press},
year = {2007},
url = {https://doi.org/10.3233/978-1-58603-774-1-372},
doi = {10.3233/978-1-58603-774-1-372},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/medinfo/TierneyRHSBMNKWSSKMME07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/membrane/TejedorGFABG07,
author = {Jorge Aurelio Tejedor and
Abraham Guti{\'{e}}rrez and
Luis Fern{\'{a}}ndez and
Fernando Arroyo and
Gin{\'{e}}s Bravo and
Sandra G{\'{o}}mez Canaval},
editor = {George Eleftherakis and
Petros Kefalas and
Gheorghe Paun and
Grzegorz Rozenberg and
Arto Salomaa},
title = {Optimizing Evolution Rules Application and Communication Times in
Membrane Systems Implementation},
booktitle = {Membrane Computing, 8th International Workshop, {WMC} 2007, Thessaloniki,
Greece, June 25-28, 2007 Revised Selected and Invited Papers},
series = {Lecture Notes in Computer Science},
volume = {4860},
pages = {298--319},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-77312-2\_19},
doi = {10.1007/978-3-540-77312-2\_19},
timestamp = {Tue, 01 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/membrane/TejedorGFABG07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micad/SuzukiHKGVD07,
author = {Kenji Suzuki and
Lifeng He and
Shweta Khankari and
Liang Ge and
Joel Verceles and
Abraham H. Dachman},
editor = {Maryellen L. Giger and
Nico Karssemeijer},
title = {Mixture of expert artificial neural networks with ensemble training
for reduction of various sources of false positives in {CAD}},
booktitle = {Medical Imaging 2007: Computer-Aided Diagnosis, San Diego, CA, United
States, 17-22 February 2007},
series = {{SPIE} Proceedings},
volume = {6514},
pages = {65140I},
publisher = {{SPIE}},
year = {2007},
url = {https://doi.org/10.1117/12.713708},
doi = {10.1117/12.713708},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micad/SuzukiHKGVD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/msr/KieferBT07,
author = {Christoph Kiefer and
Abraham Bernstein and
Jonas Tappolet},
title = {Mining Software Repositories with iSPAROL and a Software Evolution
Ontology},
booktitle = {Fourth International Workshop on Mining Software Repositories, {MSR}
2007 {(ICSE} Workshop), Minneapolis, MN, USA, May 19-20, 2007, Proceedings},
pages = {10},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/MSR.2007.21},
doi = {10.1109/MSR.2007.21},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/msr/KieferBT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0704-3646,
author = {Ittai Abraham and
Danny Dolev and
Joseph Y. Halpern},
title = {Lower Bounds on Implementing Robust and Resilient Mediators},
journal = {CoRR},
volume = {abs/0704.3646},
year = {2007},
url = {http://arxiv.org/abs/0704.3646},
eprinttype = {arXiv},
eprint = {0704.3646},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0704-3646.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cleiej/BrietzkeR06,
author = {Josiane Brietzke and
Abraham Rabelo},
title = {Resistance Factors in Software Processes Improvement},
journal = {{CLEI} Electron. J.},
volume = {9},
number = {1},
year = {2006},
url = {https://doi.org/10.19153/cleiej.9.1.4},
doi = {10.19153/CLEIEJ.9.1.4},
timestamp = {Tue, 21 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cleiej/BrietzkeR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comcom/LeducABBDDDCGMPQRSSTUU06,
author = {Guy Leduc and
Henrik Abrahamsson and
Simon Balon and
Sandford Bessler and
Maurizio D'Arienzo and
Olivier Delcourt and
Jordi Domingo{-}Pascual and
Selin Cerav{-}Erbas and
Ivan Gojmerac and
Xavier Masip{-}Bruin and
Antonio Pescap{\`{e}} and
Bruno Quoitin and
S. F. Romano and
E. Salvatori and
Fabian Skiv{\'{e}}e and
Hung Tuan Tran and
Steve Uhlig and
Hakan {\"{U}}mit},
title = {An open source traffic engineering toolbox},
journal = {Comput. Commun.},
volume = {29},
number = {5},
pages = {593--610},
year = {2006},
url = {https://doi.org/10.1016/j.comcom.2005.06.010},
doi = {10.1016/J.COMCOM.2005.06.010},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/comcom/LeducABBDDDCGMPQRSSTUU06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijeh/LorenceA06,
author = {Daniel P. Lorence and
Joanna Abraham},
title = {Analysis of semantic search within the domains of uncertainty: using
Keyword Effectiveness Indexing as an evaluation tool},
journal = {Int. J. Electron. Heal.},
volume = {2},
number = {3},
pages = {263--276},
year = {2006},
url = {https://doi.org/10.1504/IJEH.2006.009273},
doi = {10.1504/IJEH.2006.009273},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijeh/LorenceA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/SchneiderLR06,
author = {Abraham R. Schneider and
Timothy J. Lewis and
John Rinzel},
title = {Effects of correlated input and electrical coupling on synchrony in
fast-spiking cell networks},
journal = {Neurocomputing},
volume = {69},
number = {10-12},
pages = {1125--1129},
year = {2006},
url = {https://doi.org/10.1016/j.neucom.2005.12.058},
doi = {10.1016/J.NEUCOM.2005.12.058},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/SchneiderLR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/StrizhevACLWC06,
author = {Alex Strizhev and
Edmond J. Abrahamian and
Sun Choi and
Joseph M. Leonard and
Philippa R. N. Wolohan and
Robert D. Clark},
title = {The Effects of Biasing Torsional Mutations in a Conformational {GA}},
journal = {J. Chem. Inf. Model.},
volume = {46},
number = {4},
pages = {1862--1870},
year = {2006},
url = {https://doi.org/10.1021/ci0502193},
doi = {10.1021/CI0502193},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/StrizhevACLWC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/LorenceA06,
author = {Daniel P. Lorence and
Joanna Abraham},
title = {Comparative Analysis of Medical Web Search Using Generalized vs. Niche
Technologies},
journal = {J. Medical Syst.},
volume = {30},
number = {3},
pages = {211--219},
year = {2006},
url = {https://doi.org/10.1007/s10916-005-7990-y},
doi = {10.1007/S10916-005-7990-Y},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/LorenceA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/misqe/ZwiegKBBGGHSAACEHLGKMRRRW06,
author = {Phil Zwieg and
Kate M. Kaiser and
Cynthia Mathis Beath and
Christine V. Bullen and
Kevin P. Gallagher and
Tim Goles and
Joy Howland and
Judy C. Simon and
Pamela Abbott and
Thomas Abraham and
Erran Carmel and
Roberto Evaristo and
Stephen Hawk and
Mary C. Lacity and
Michael Gallivan and
S{\'{e}}amas Kelly and
John G. Mooney and
C. Ranganathan and
Joseph W. Rottman and
Terry Ryan and
Rick Wion},
title = {The Information Technology Workforce: Trends and Implications 2005-2008},
journal = {{MIS} Q. Executive},
volume = {5},
number = {2},
pages = {6},
year = {2006},
url = {https://aisel.aisnet.org/misqe/vol5/iss2/6},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/misqe/ZwiegKBBGGHSAACEHLGKMRRRW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/DashKASCBN06,
author = {Denver Dash and
Branislav Kveton and
John Mark Agosta and
Eve M. Schooler and
Jaideep Chandrashekar and
Abraham Bachrach and
Alex Newman},
title = {When Gossip is Good: Distributed Probabilistic Inference for Detection
of Slow Network Intrusions},
booktitle = {Proceedings, The Twenty-First National Conference on Artificial Intelligence
and the Eighteenth Innovative Applications of Artificial Intelligence
Conference, July 16-20, 2006, Boston, Massachusetts, {USA}},
pages = {1115--1122},
publisher = {{AAAI} Press},
year = {2006},
url = {http://www.aaai.org/Library/AAAI/2006/aaai06-175.php},
timestamp = {Tue, 05 Sep 2023 09:10:47 +0200},
biburl = {https://dblp.org/rec/conf/aaai/DashKASCBN06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cases/GilbertA06,
author = {John Gilbert and
David M. Abrahamson},
editor = {Seongsoo Hong and
Wayne H. Wolf and
Kriszti{\'{a}}n Flautner and
Taewhan Kim},
title = {Adaptive object code compression},
booktitle = {Proceedings of the 2006 International Conference on Compilers, Architecture,
and Synthesis for Embedded Systems, {CASES} 2006, Seoul, Korea, October
22-25, 2006},
pages = {282--292},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1176760.1176795},
doi = {10.1145/1176760.1176795},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cases/GilbertA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccece/MoutonSS06,
author = {Abraham Jacobus Johannes Mouton and
C. Smith and
George E. Smith},
title = {Wireless Control and Communication to Motor Protection Relays by using
an Embedded Microprocessor},
booktitle = {Proceedings of the Canadian Conference on Electrical and Computer
Engineering, {CCECE} 2006, May 7-10, 2006, Ottawa Congress Centre,
Ottawa, Canada},
pages = {1104--1107},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/CCECE.2006.277438},
doi = {10.1109/CCECE.2006.277438},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/ccece/MoutonSS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarcv/DoornikIS06,
author = {Johan van Doornik and
Abraham K. Ishihara and
Terence D. Sanger},
title = {Uniform Boundedness of Feedback Error Learning for a Class of Stochastic
Nonlinear Systems},
booktitle = {Ninth International Conference on Control, Automation, Robotics and
Vision, {ICARCV} 2006, Singapore, 5-8 December 2006, Proceedings},
pages = {1--5},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ICARCV.2006.345252},
doi = {10.1109/ICARCV.2006.345252},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icarcv/DoornikIS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/IshiharaDS06,
author = {Abraham K. Ishihara and
Johan van Doornik and
Terence D. Sanger},
title = {Failure Modes in Feedback Error Learning},
booktitle = {Proceedings of the International Joint Conference on Neural Networks,
{IJCNN} 2006, part of the {IEEE} World Congress on Computational Intelligence,
{WCCI} 2006, Vancouver, BC, Canada, 16-21 July 2006},
pages = {277--284},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IJCNN.2006.246692},
doi = {10.1109/IJCNN.2006.246692},
timestamp = {Tue, 10 Aug 2021 14:29:47 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/IshiharaDS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/ShinPA06,
author = {Hongjoong Shin and
Joonsung Park and
Jacob A. Abraham},
editor = {Scott Davidson and
Anne Gattiker},
title = {Built-in Fault Diagnosis for Tunable Analog Systems Using an Ensemble
Method},
booktitle = {2006 {IEEE} International Test Conference, {ITC} 2006, Santa Clara,
CA, USA, October 22-27, 2006},
pages = {1--10},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/TEST.2006.297678},
doi = {10.1109/TEST.2006.297678},
timestamp = {Tue, 12 Dec 2023 09:46:27 +0100},
biburl = {https://dblp.org/rec/conf/itc/ShinPA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/podc/AbrahamDGH06,
author = {Ittai Abraham and
Danny Dolev and
Rica Gonen and
Joseph Y. Halpern},
editor = {Eric Ruppert and
Dahlia Malkhi},
title = {Distributed computing meets game theory: robust mechanisms for rational
secret sharing and multiparty computation},
booktitle = {Proceedings of the Twenty-Fifth Annual {ACM} Symposium on Principles
of Distributed Computing, {PODC} 2006, Denver, CO, USA, July 23-26,
2006},
pages = {53--62},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1146381.1146393},
doi = {10.1145/1146381.1146393},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/podc/AbrahamDGH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/setn/KoutroumbasPMGGK06,
author = {Konstantinos Koutroumbas and
Abraham Pouliakis and
Tatiana Mona Megalopoulou and
John Georgoulakis and
Anna{-}Eva Giachnaki and
Petros Karakitsos},
editor = {Grigoris Antoniou and
George Potamias and
Costas Spyropoulos and
Dimitris Plexousakis},
title = {Discrimination of Benign from Malignant Breast Lesions Using Statistical
Classifiers},
booktitle = {Advances in Artificial Intelligence, 4th Helenic Conference on AI,
{SETN} 2006, Heraklion, Crete, Greece, May 18-20, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3955},
pages = {543--546},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11752912\_64},
doi = {10.1007/11752912\_64},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/setn/KoutroumbasPMGGK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vl/LawranceABE06,
author = {Joseph Lawrance and
Robin Abraham and
Margaret M. Burnett and
Martin Erwig},
title = {Sharing reasoning about faults in spreadsheets: An empirical study},
booktitle = {2006 {IEEE} Symposium on Visual Languages and Human-Centric Computing
{(VL/HCC} 2006), 4-8 September 2006, Brighton, {UK}},
pages = {35--42},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/VLHCC.2006.43},
doi = {10.1109/VLHCC.2006.43},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vl/LawranceABE06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2006,
editor = {Viorel Negru and
Dana Petcu and
Daniela Zaharie and
Ajith Abraham and
Bruno Buchberger and
Alexandru Cicortas and
Dorian Gorgan and
Jo{\"{e}}l Quinqueton},
title = {8th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing {(SYNASC} 2006), 26-29 September 2006, Timisoara,
Romania},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://ieeexplore.ieee.org/xpl/conhome/4090273/proceeding},
isbn = {0-7695-2740-X},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2006.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/AbiteboulABCCCDFGGGHHHIKPLMNSSSSSUWWZ05,
author = {Serge Abiteboul and
Rakesh Agrawal and
Philip A. Bernstein and
Michael J. Carey and
Stefano Ceri and
W. Bruce Croft and
David J. DeWitt and
Michael J. Franklin and
Hector Garcia{-}Molina and
Dieter Gawlick and
Jim Gray and
Laura M. Haas and
Alon Y. Halevy and
Joseph M. Hellerstein and
Yannis E. Ioannidis and
Martin L. Kersten and
Michael J. Pazzani and
Michael Lesk and
David Maier and
Jeffrey F. Naughton and
Hans{-}J{\"{o}}rg Schek and
Timos K. Sellis and
Avi Silberschatz and
Michael Stonebraker and
Richard T. Snodgrass and
Jeffrey D. Ullman and
Gerhard Weikum and
Jennifer Widom and
Stanley B. Zdonik},
title = {The Lowell database research self-assessment},
journal = {Commun. {ACM}},
volume = {48},
number = {5},
pages = {111--118},
year = {2005},
url = {https://doi.org/10.1145/1060710.1060718},
doi = {10.1145/1060710.1060718},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/AbiteboulABCCCDFGGGHHHIKPLMNSSSSSUWWZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/compsec/ChebroluAT05,
author = {Srilatha Chebrolu and
Ajith Abraham and
Johnson P. Thomas},
title = {Feature deduction and ensemble design of intrusion detection systems},
journal = {Comput. Secur.},
volume = {24},
number = {4},
pages = {295--307},
year = {2005},
url = {https://doi.org/10.1016/j.cose.2004.09.008},
doi = {10.1016/J.COSE.2004.09.008},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/compsec/ChebroluAT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/SiikaRSKSSWKNHT05,
author = {Abraham M. Siika and
Joseph K. Rotich and
Chrispinus J. Simiyu and
Erica M. Kigotho and
Faye E. Smith and
John E. Sidle and
Kara Wools{-}Kaloustian and
Sylvester N. Kimaiyo and
Winstone M. Nyandiko and
Terry J. Hannan and
William M. Tierney},
title = {An electronic medical record system for ambulatory care of HIV-infected
patients in Kenya},
journal = {Int. J. Medical Informatics},
volume = {74},
number = {5},
pages = {345--355},
year = {2005},
url = {https://doi.org/10.1016/j.ijmedinf.2005.03.002},
doi = {10.1016/J.IJMEDINF.2005.03.002},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/SiikaRSKSSWKNHT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/CooperAAABCFJLM05,
author = {Gregory F. Cooper and
Vijoy Abraham and
Constantin F. Aliferis and
John M. Aronis and
Bruce G. Buchanan and
Rich Caruana and
Michael J. Fine and
Janine E. Janosky and
Gary Livingston and
Tom M. Mitchell},
title = {Predicting dire outcomes of patients with community acquired pneumonia},
journal = {J. Biomed. Informatics},
volume = {38},
number = {5},
pages = {347--366},
year = {2005},
url = {https://doi.org/10.1016/j.jbi.2005.02.005},
doi = {10.1016/J.JBI.2005.02.005},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/CooperAAABCFJLM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/AbrahamTSJ05,
author = {Ajith Abraham and
Johnson P. Thomas and
Sugata Sanyal and
Lakhmi C. Jain},
title = {Information Assurance and Security},
journal = {J. Univers. Comput. Sci.},
volume = {11},
number = {1},
pages = {1--3},
year = {2005},
url = {http://www.jucs.org/jucs\_11\_1/information\_assurance\_and\_security},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jucs/AbrahamTSJ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEscc/BilalTTA05,
author = {M. Bilal and
Johnson P. Thomas and
Mathews Thomas and
Subil Abraham},
title = {Fair {BPEL} Processes Transaction using Non-Repudiation Protocols},
booktitle = {2005 {IEEE} International Conference on Services Computing {(SCC}
2005), 11-15 July 2005, Orlando, FL, {USA}},
pages = {337--342},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/SCC.2005.52},
doi = {10.1109/SCC.2005.52},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEscc/BilalTTA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amt/OHareCS05,
author = {Gregory M. P. O'Hare and
Abraham G. Campbell and
John W. Stafford},
editor = {Hiroyuki Tarumi and
Yuefeng Li and
Tetsuya Yoshida},
title = {NeXuS: delivering behavioural realism through intentional agents},
booktitle = {Proceedings of the 2005 International Conference on Active Media Technology,
{AMT} 2005, Kagawa International Conference Hall, Takamatsu, Kagawa,
Japan, May 19-21, 2005},
pages = {481--486},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/AMT.2005.1505402},
doi = {10.1109/AMT.2005.1505402},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/amt/OHareCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/FisherATED05,
author = {Karen E. Fisher and
Jennie A. Abrahamson and
Anne G. Turner and
Phillip M. Edwards and
Joan C. Durrance},
title = {Lost, found, and feeling better: Exploring proxy health information
behavior},
booktitle = {Sparking Synergies: Bringing Research and Practice Together - Proceedings
of the 68th ASIS{\&}T Annual Meeting, {ASIST} 2005, Charlotte,
North Carolina, USA, October 28 - November 2, 2005},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {42},
number = {1},
publisher = {Wiley},
year = {2005},
url = {https://doi.org/10.1002/meet.14504201258},
doi = {10.1002/MEET.14504201258},
timestamp = {Fri, 21 Jan 2022 13:55:35 +0100},
biburl = {https://dblp.org/rec/conf/asist/FisherATED05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/PantrigoDSC05,
author = {Juan Jos{\'{e}} Pantrigo and
Abraham Duarte and
{\'{A}}ngel S{\'{a}}nchez and
Ra{\'{u}}l Cabido},
editor = {G{\"{u}}nther R. Raidl and
Jens Gottlieb},
title = {Scatter Search Particle Filter to Solve the Dynamic Travelling Salesman
Problem},
booktitle = {Evolutionary Computation in Combinatorial Optimization, 5th European
Conference, EvoCOP 2005, Lausanne, Switzerland, March 30 - April 1,
2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3448},
pages = {177--189},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/978-3-540-31996-2\_17},
doi = {10.1007/978-3-540-31996-2\_17},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/evoW/PantrigoDSC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/focs/AbrahamBCDGKNS05,
author = {Ittai Abraham and
Yair Bartal and
T.{-}H. Hubert Chan and
Kedar Dhamdhere and
Anupam Gupta and
Jon M. Kleinberg and
Ofer Neiman and
Aleksandrs Slivkins},
title = {Metric Embeddings with Relaxed Guarantees},
booktitle = {46th Annual {IEEE} Symposium on Foundations of Computer Science {(FOCS}
2005), 23-25 October 2005, Pittsburgh, PA, USA, Proceedings},
pages = {83--100},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/SFCS.2005.51},
doi = {10.1109/SFCS.2005.51},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/focs/AbrahamBCDGKNS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/AbrahamyanSHSBGRS05,
author = {Lilit Abrahamyan and
Jorrit A. Schaap and
Alfons G. Hoekstra and
Denis P. Shamonin and
Frieke M. A. Box and
Rob J. van der Geest and
Johan H. C. Reiber and
Peter M. A. Sloot},
editor = {Vaidy S. Sunderam and
G. Dick van Albada and
Peter M. A. Sloot and
Jack J. Dongarra},
title = {A Problem Solving Environment for Image-Based Computational Hemodynamics},
booktitle = {Computational Science - {ICCS} 2005, 5th International Conference,
Atlanta, GA, USA, May 22-25, 2005, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {3514},
pages = {287--294},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11428831\_36},
doi = {10.1007/11428831\_36},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/iccS/AbrahamyanSHSBGRS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icebe/AbrahamTT05,
author = {Subil Abraham and
Mathews Thomas and
Johnson P. Thomas},
editor = {Francis C. M. Lau and
Hui Lei and
Xiaofeng Meng and
Min Wang},
title = {Enhancing Web Services Availability},
booktitle = {2005 {IEEE} International Conference on e-Business Engineering {(ICEBE}
2005), 18-21 October 2005, Beijing, China},
pages = {352--355},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICEBE.2005.62},
doi = {10.1109/ICEBE.2005.62},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icebe/AbrahamTT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itcc/DoeksenATP05,
author = {Brent Doeksen and
Ajith Abraham and
Johnson P. Thomas and
Marcin Paprzycki},
title = {Real Stock Trading Using Soft Computing Models},
booktitle = {International Symposium on Information Technology: Coding and Computing
{(ITCC} 2005), Volume 2, 4-6 April 2005, Las Vegas, Nevada, {USA}},
pages = {162--167},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ITCC.2005.238},
doi = {10.1109/ITCC.2005.238},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itcc/DoeksenATP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itcc/MuppalaTA05,
author = {P. Muppala and
Johnson P. Thomas and
Ajith Abraham},
title = {QoS-Based Authentication Scheme for Ad Hoc Wireless Networks},
booktitle = {International Symposium on Information Technology: Coding and Computing
{(ITCC} 2005), Volume 1, 4-6 April 2005, Las Vegas, Nevada, {USA}},
pages = {709--714},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ITCC.2005.234},
doi = {10.1109/ITCC.2005.234},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itcc/MuppalaTA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itcc/MuppalaTA05a,
author = {P. Muppala and
Johnson P. Thomas and
Ajith Abraham},
title = {QoS-Based Authentication Scheme for Ad Hoc Wireless Networks},
booktitle = {International Symposium on Information Technology: Coding and Computing
{(ITCC} 2005), Volume 2, 4-6 April 2005, Las Vegas, Nevada, {USA}},
pages = {651--656},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ITCC.2005.235},
doi = {10.1109/ITCC.2005.235},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itcc/MuppalaTA05a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iva/OHareSC05,
author = {Gregory M. P. O'Hare and
John W. Stafford and
Abraham G. Campbell},
editor = {Themis Panayiotopoulos and
Jonathan Gratch and
Ruth Aylett and
Daniel Ballin and
Patrick Olivier and
Thomas Rist},
title = {NeXuS: Delivering Perceptions to Situated Embodied Agents},
booktitle = {Intelligent Virtual Agents, 5th International Working Conference,
{IVA} 2005, Kos, Greece, September 12-14, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3661},
pages = {500},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11550617\_51},
doi = {10.1007/11550617\_51},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iva/OHareSC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mata/BrunnerGCCAGASCNSPSM05,
author = {Marcus Brunner and
Alex Galis and
Lawrence Cheng and
Jorge Andr{\'{e}}s Col{\'{a}}s and
Bengt Ahlgren and
Anders Gunnar and
Henrik Abrahamsson and
R{\'{o}}bert Szab{\'{o}} and
Csaba Simon and
Johan Nielsen and
Simon Sch{\"{u}}tz and
Alberto Gonzalez Prieto and
Rolf Stadler and
Gergely Molnar},
editor = {Thomas Magedanz and
Ahmed Karmouch and
Samuel Pierre and
Iakovos S. Venieris},
title = {Towards Ambient Networks Management},
booktitle = {Mobility Aware Technologies and Applications, Second International
Workshop, {MATA} 2005, Montreal, Canada, October 17-19, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3744},
pages = {215--229},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11569510\_21},
doi = {10.1007/11569510\_21},
timestamp = {Tue, 14 May 2019 10:00:55 +0200},
biburl = {https://dblp.org/rec/conf/mata/BrunnerGCCAGASCNSPSM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/otm/AliRPAS05,
author = {Ali Shaikh Ali and
Omer F. Rana and
Ian C. Parmee and
Johnson A. R. Abraham and
Mark R. N. Shackelford},
editor = {Robert Meersman and
Zahir Tari and
Pilar Herrero and
Gonzalo M{\'{e}}ndez and
Lawrence Cavedon and
David B. Martin and
Annika Hinze and
George Buchanan and
Mar{\'{\i}}a S. P{\'{e}}rez and
V{\'{\i}}ctor Robles and
Jan Humble and
Antonia Albani and
Jan L. G. Dietz and
Herv{\'{e}} Panetto and
Monica Scannapieco and
Terry A. Halpin and
Peter Spyns and
Johannes Maria Zaha and
Esteban Zim{\'{a}}nyi and
Emmanuel Stefanakis and
Tharam S. Dillon and
Ling Feng and
Mustafa Jarrar and
Jos Lehmann and
Aldo de Moor and
Erik Duval and
Lora Aroyo},
title = {Web-Services Based Modelling/Optimisation for Engineering Design},
booktitle = {On the Move to Meaningful Internet Systems 2005: {OTM} 2005 Workshops,
{OTM} Confederated International Workshops and Posters, AWeSOMe, CAMS,
GADA, MIOS+INTEROP, ORM, PhDS, SeBGIS, SWWS, and {WOSE} 2005, Agia
Napa, Cyprus, October 31 - November 4, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3762},
pages = {244--253},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11575863\_44},
doi = {10.1007/11575863\_44},
timestamp = {Tue, 11 Apr 2023 12:52:01 +0200},
biburl = {https://dblp.org/rec/conf/otm/AliRPAS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/WuA05,
author = {Xiaodong Wu and
John Abraham},
editor = {Hisham Haddad and
Lorie M. Liebrock and
Andrea Omicini and
Roger L. Wainwright},
title = {The intensity level reduction in radiation therapy},
booktitle = {Proceedings of the 2005 {ACM} Symposium on Applied Computing (SAC),
Santa Fe, New Mexico, USA, March 13-17, 2005},
pages = {242--246},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1066677.1066736},
doi = {10.1145/1066677.1066736},
timestamp = {Tue, 06 Nov 2018 11:06:45 +0100},
biburl = {https://dblp.org/rec/conf/sac/WuA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/AbrahamMM05,
author = {Ralph Abraham and
Michael Miller and
John Miller},
editor = {Patricia Beckmann{-}Wells},
title = {Emerging 4D graphics for math and science education},
booktitle = {International Conference on Computer Graphics and Interactive Techniques,
{SIGGRAPH} 2005, Los Angeles, California, USA, July 31 - August 4,
2005, Educators Program},
pages = {22},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1187358.1187386},
doi = {10.1145/1187358.1187386},
timestamp = {Fri, 12 Mar 2021 11:32:12 +0100},
biburl = {https://dblp.org/rec/conf/siggraph/AbrahamMM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/visualization/KnissUSLTH05,
author = {Joe Michael Kniss and
Robert L. Van Uitert Jr. and
Abraham Stephens and
Guo{-}Shi Li and
Tolga Tasdizen and
Charles D. Hansen},
title = {Statistically Quantitative Volume Visualization},
booktitle = {16th {IEEE} Visualization Conference, {IEEE} Vis 2005, Minneapolis,
MN, USA, October 23-28, 2005, Proceedings},
pages = {287--294},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/VISUAL.2005.1532807},
doi = {10.1109/VISUAL.2005.1532807},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/visualization/KnissUSLTH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/BonehFSW04,
author = {Dan Boneh and
Joan Feigenbaum and
Abraham Silberschatz and
Rebecca N. Wright},
title = {{PORTIA:} Privacy, Obligations, and Rights in Technologies of Information
Assessment},
journal = {{IEEE} Data Eng. Bull.},
volume = {27},
number = {1},
pages = {10--18},
year = {2004},
url = {http://sites.computer.org/debull/A04mar/avi.ps},
timestamp = {Wed, 19 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/debu/BonehFSW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbc/BabuBCG04,
author = {Gutti Jogesh Babu and
Abraham Boyarsky and
Yogendra P. Chaubey and
Pawel G{\'{o}}ra},
title = {A New Statistical Method for Filtering and Entropy Estimation of a
Chaotic Map from Noisy Data},
journal = {Int. J. Bifurc. Chaos},
volume = {14},
number = {11},
pages = {3989--3994},
year = {2004},
url = {https://doi.org/10.1142/S0218127404011612},
doi = {10.1142/S0218127404011612},
timestamp = {Tue, 02 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbc/BabuBCG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/AbrahamBJJJ04,
author = {Ajith Abraham and
Emilia I. Barakova and
Ravi Jain and
Istv{\'{a}}n J{\'{o}}nyer and
Lakhmi C. Jain},
title = {Special issue on hybrid neurocomputing},
journal = {Neurocomputing},
volume = {61},
pages = {1--3},
year = {2004},
url = {https://doi.org/10.1016/j.neucom.2004.03.010},
doi = {10.1016/J.NEUCOM.2004.03.010},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijon/AbrahamBJJJ04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/Martin-SanchezINMGLJAAB04,
author = {Fernando Mart{\'{\i}}n{-}S{\'{a}}nchez and
Ilias Iakovidis and
S. N{\o}rager and
Victor Maojo and
Piet C. de Groen and
Johan van der Lei and
T. Jones and
Klaus Abraham{-}Fuchs and
Rolf Apweiler and
Ankica Babic},
title = {Synergy between medical informatics and bioinformatics: facilitating
genomic medicine for future health care},
journal = {J. Biomed. Informatics},
volume = {37},
number = {1},
pages = {30--42},
year = {2004},
url = {https://doi.org/10.1016/j.jbi.2003.09.003},
doi = {10.1016/J.JBI.2003.09.003},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/Martin-SanchezINMGLJAAB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/JoverBS04,
author = {Jes{\'{u}}s Jover and
Ram{\'{o}}n Bosque and
Joaquim Sales},
title = {Determination of Abraham Solute Parameters from Molecular Structure},
journal = {J. Chem. Inf. Model.},
volume = {44},
number = {3},
pages = {1098--1106},
year = {2004},
url = {https://doi.org/10.1021/ci049943w},
doi = {10.1021/CI049943W},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/JoverBS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BucknerHPFMMS04,
author = {Randy L. Buckner and
Denise Head and
Jamie Parker and
Anthony F. Fotenos and
Daniel S. Marcus and
John C. Morris and
Abraham Z. Snyder},
title = {A unified approach for morphometric and functional data analysis in
young, old, and demented adults using automated atlas-based head size
normalization: reliability and validation against manual measurement
of total intracranial volume},
journal = {NeuroImage},
volume = {23},
number = {2},
pages = {724--738},
year = {2004},
url = {https://doi.org/10.1016/j.neuroimage.2004.06.018},
doi = {10.1016/J.NEUROIMAGE.2004.06.018},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BucknerHPFMMS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tfs/CarinenaROBB04,
author = {Purificaci{\'{o}}n Cari{\~{n}}ena and
Carlos V{\'{a}}zquez Regueiro and
Abraham Otero and
Alberto Bugar{\'{\i}}n and
Sen{\'{e}}n Barro},
title = {Landmark detection in mobile robotics using fuzzy temporal rules},
journal = {{IEEE} Trans. Fuzzy Syst.},
volume = {12},
number = {4},
pages = {423--435},
year = {2004},
url = {https://doi.org/10.1109/TFUZZ.2004.832534},
doi = {10.1109/TFUZZ.2004.832534},
timestamp = {Fri, 17 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tfs/CarinenaROBB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/urban/MillerHAS04,
author = {Eric J. Miller and
John Douglas Hunt and
John E. Abraham and
Paul A. Salvini},
title = {Microsimulating urban systems},
journal = {Comput. Environ. Urban Syst.},
volume = {28},
number = {1-2},
pages = {9--44},
year = {2004},
url = {https://doi.org/10.1016/S0198-9715(02)00044-3},
doi = {10.1016/S0198-9715(02)00044-3},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/urban/MillerHAS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/ParmeeA04,
author = {Ian C. Parmee and
Johnson A. R. Abraham},
title = {Supporting implicit learning via the visualisation of {COGA} multi-objective
data},
booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
2004, 19-23 June 2004, Portland, OR, {USA}},
pages = {395--402},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/CEC.2004.1330884},
doi = {10.1109/CEC.2004.1330884},
timestamp = {Thu, 16 Dec 2021 13:58:46 +0100},
biburl = {https://dblp.org/rec/conf/cec/ParmeeA04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/DuarteSFMP04,
author = {Abraham Duarte and
{\'{A}}ngel S{\'{a}}nchez and
Felipe Fern{\'{a}}ndez and
Antonio S. Montemayor and
Juan Jos{\'{e}} Pantrigo},
editor = {G{\"{u}}nther R. Raidl and
Stefano Cagnoni and
J{\"{u}}rgen Branke and
David Corne and
Rolf Drechsler and
Yaochu Jin and
Colin G. Johnson and
Penousal Machado and
Elena Marchiori and
Franz Rothlauf and
George D. Smith and
Giovanni Squillero},
title = {Top-Down Evolutionary Image Segmentation Using a Hierarchical Social
Metaheuristic},
booktitle = {Applications of Evolutionary Computing, EvoWorkshops 2004: EvoBIO,
EvoCOMNET, EvoHOT, EvoIASP, EvoMUSART, and EvoSTOC, Coimbra, Portugal,
April 5-7, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3005},
pages = {301--311},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-24653-4\_31},
doi = {10.1007/978-3-540-24653-4\_31},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/evoW/DuarteSFMP04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icls/AbrahamsonBSUW04,
author = {Dor Abrahamson and
Matthew Berland and
R. Benjamin Shapiro and
Joshua W. Unterman and
Uri Wilensky},
editor = {Yasmin B. Kafai and
Noel Enyedy and
Bill Sandoval},
title = {Leveraging Epistemological Diversity through Computer-based Argumentation
in the Domain of Probability},
booktitle = {Embracing Diversity in the Learning Sciences: Proceedings of the 6th
International Conference for the Learning Sciences, {ICLS} 2004, Los
Angeles, CA, USA, June 22-26, 2004},
publisher = {International Society of the Learning Sciences},
year = {2004},
url = {https://repository.isls.org/handle/1/3957},
timestamp = {Tue, 11 May 2021 18:13:28 +0200},
biburl = {https://dblp.org/rec/conf/icls/AbrahamsonBSUW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/AbrahamWL04,
author = {A. S. Abraham and
Ju Wang and
Jonathan C. L. Liu},
title = {Bandwidth-aware video encoding with adaptive image scaling},
booktitle = {Proceedings of the 2004 {IEEE} International Conference on Multimedia
and Expo, {ICME} 2004, 27-30 June 2004, Taipei, Taiwan},
pages = {157--160},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICME.2004.1394149},
doi = {10.1109/ICME.2004.1394149},
timestamp = {Tue, 30 Jul 2024 10:01:11 +0200},
biburl = {https://dblp.org/rec/conf/icmcs/AbrahamWL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/ChebroluAT04,
author = {Srilatha Chebrolu and
Ajith Abraham and
Johnson P. Thomas},
editor = {Nikhil R. Pal and
Nikola K. Kasabov and
Rajani K. Mudi and
Srimanta Pal and
Swapan K. Parui},
title = {Hybrid Feature Selection for Modeling Intrusion Detection Systems},
booktitle = {Neural Information Processing, 11th International Conference, {ICONIP}
2004, Calcutta, India, November 22-25, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3316},
pages = {1020--1025},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30499-9\_158},
doi = {10.1007/978-3-540-30499-9\_158},
timestamp = {Thu, 04 Jun 2020 19:07:58 +0200},
biburl = {https://dblp.org/rec/conf/iconip/ChebroluAT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mata/BrunnerGCCAGASCNPSM04,
author = {Marcus Brunner and
Alex Galis and
Lawrence Cheng and
Jorge Andr{\'{e}}s Col{\'{a}}s and
Bengt Ahlgren and
Anders Gunnar and
Henrik Abrahamsson and
R{\'{o}}bert Szab{\'{o}} and
Csaba Simon and
Johan Nielsen and
Alberto Gonzalez Prieto and
Rolf Stadler and
Gergely Molnar},
editor = {Ahmed Karmouch and
Larry Korba and
Edmundo Roberto Mauro Madeira},
title = {Ambient Networks Management Challenges and Approaches},
booktitle = {Mobility Aware Technologies and Applications, First International
Workshop,MATA 2004, Florian{\'{o}}polis, Brazil, October 20-22,
2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3284},
pages = {196--216},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30178-3\_19},
doi = {10.1007/978-3-540-30178-3\_19},
timestamp = {Tue, 14 May 2019 10:00:55 +0200},
biburl = {https://dblp.org/rec/conf/mata/BrunnerGCCAGASCNPSM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/profes/JokelaA04,
author = {Timo Jokela and
Pekka Abrahamsson},
editor = {Frank Bomarius and
Hajimu Iida},
title = {Usability Assessment of an Extreme Programming Project: Close Co-operation
with the Customer Does Not Equal to Good Usability},
booktitle = {Product Focused Software Process Improvement, 5th International Conference,
{PROFES} 2004, Kausai Science City, Japan, April 5-8, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3009},
pages = {393--407},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-24659-6\_28},
doi = {10.1007/978-3-540-24659-6\_28},
timestamp = {Tue, 14 May 2019 10:00:38 +0200},
biburl = {https://dblp.org/rec/conf/profes/JokelaA04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sibgrapi/AbrahamFCC04,
author = {Frederico Rodrigues Abraham and
Waldemar Celes Filho and
Renato Cerqueira and
Jo{\~{a}}o Luiz Campos},
title = {A Load-Balancing Strategy for Sort-First Distributed Rendering},
booktitle = {{XVII} Brazilian Symposium on Computer Graphics and Image Processing,
{(SIBGRAPI} 2004) 17-20 October 2004, Curitiba, PR, Brazil},
pages = {292--299},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/SIBGRA.2004.1352973},
doi = {10.1109/SIBGRA.2004.1352973},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sibgrapi/AbrahamFCC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sspr/PantrigoSGD04,
author = {Juan Jos{\'{e}} Pantrigo and
{\'{A}}ngel S{\'{a}}nchez and
Kostas Gianikellis and
Abraham Duarte},
editor = {Ana L. N. Fred and
Terry Caelli and
Robert P. W. Duin and
Aur{\'{e}}lio C. Campilho and
Dick de Ridder},
title = {Path Relinking Particle Filter for Human Body Pose Estimation},
booktitle = {Structural, Syntactic, and Statistical Pattern Recognition, Joint
{IAPR} International Workshops, {SSPR} 2004 and {SPR} 2004, Lisbon,
Portugal, August 18-20, 2004 Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3138},
pages = {653--661},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-27868-9\_71},
doi = {10.1007/978-3-540-27868-9\_71},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sspr/PantrigoSGD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/Chu-CarrollCPIB04,
author = {Jennifer Chu{-}Carroll and
Krzysztof Czuba and
John M. Prager and
Abraham Ittycheriah and
Sasha Blair{-}Goldensohn},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {IBM's {PIQUANT} {II} in {TREC} 2004},
booktitle = {Proceedings of the Thirteenth Text REtrieval Conference, {TREC} 2004,
Gaithersburg, Maryland, USA, November 16-19, 2004},
series = {{NIST} Special Publication},
volume = {500-261},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2004},
url = {http://trec.nist.gov/pubs/trec13/papers/ibm-prager.qa.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/Chu-CarrollCPIB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/is/SchnaseCFFLMS03,
author = {John L. Schnase and
Judith Bayard Cushing and
Mike Frame and
Anne Frondorf and
Eric Landis and
David Maier and
Abraham Silberschatz},
title = {Information technology challenges of biodiversity and ecosystems informatics},
journal = {Inf. Syst.},
volume = {28},
number = {4},
pages = {339--345},
year = {2003},
url = {https://doi.org/10.1016/S0306-4379(02)00070-4},
doi = {10.1016/S0306-4379(02)00070-4},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/is/SchnaseCFFLMS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/BooksteinKRN03,
author = {Abraham Bookstein and
Vladimir A. Kulyukin and
Timo Raita and
John Nicholson},
title = {Adapting measures of clumping strength to assess term-term similarity},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {54},
number = {7},
pages = {611--620},
year = {2003},
url = {https://doi.org/10.1002/asi.10249},
doi = {10.1002/ASI.10249},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/BooksteinKRN03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BarchMBMCS03,
author = {Deanna M. Barch and
Jennifer R. Mathews and
Randy L. Buckner and
Luigi Maccotta and
John G. Csernansky and
Abraham Z. Snyder},
title = {Hemodynamic responses in visual, motor, and somatosensory cortices
in schizophrenia},
journal = {NeuroImage},
volume = {20},
number = {3},
pages = {1884--1893},
year = {2003},
url = {https://doi.org/10.1016/S1053-8119(03)00449-X},
doi = {10.1016/S1053-8119(03)00449-X},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/BarchMBMCS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hldvt/LevingerZBAJK03,
author = {Moshe Levinger and
Avi Ziv and
Brian Bailey and
Jacob Abraham and
Bob Bentley and
William H. Joyner and
Yaron Kas},
title = {Panel: What's the next 'big thing' in simulation-based verification?},
booktitle = {Eighth {IEEE} International High-Level Design Validation and Test
Workshop 2003, San Francisco, CA, USA, November 12-14, 2003},
pages = {175},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/HLDVT.2003.1252493},
doi = {10.1109/HLDVT.2003.1252493},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hldvt/LevingerZBAJK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kes/Rodriguez-RodriguezPQ03,
author = {Abraham Rodr{\'{\i}}guez{-}Rodr{\'{\i}}guez and
Jos{\'{e}} Palma and
Francisca Quintana{-}Dominguez},
editor = {Vasile Palade and
Robert J. Howlett and
Lakhmi C. Jain},
title = {Experiences in Reusing Problem Solving Methods - An Application in
Constraint Programming},
booktitle = {Knowledge-Based Intelligent Information and Engineering Systems, 7th
International Conference, {KES} 2003, Oxford, UK, September 3-5, 2003,
Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {2774},
pages = {1299--1306},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-45226-3\_176},
doi = {10.1007/978-3-540-45226-3\_176},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kes/Rodriguez-RodriguezPQ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Chu-CarrollCPI03,
author = {Jennifer Chu{-}Carroll and
Krzysztof Czuba and
John M. Prager and
Abraham Ittycheriah},
editor = {Marti A. Hearst and
Mari Ostendorf},
title = {In Question Answering, Two Heads Are Better Than One},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association for Computational Linguistics, {HLT-NAACL} 2003,
Edmonton, Canada, May 27 - June 1, 2003},
publisher = {The Association for Computational Linguistics},
year = {2003},
url = {https://aclanthology.org/N03-1004/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Chu-CarrollCPI03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/PragerCCWIM03,
author = {John M. Prager and
Jennifer Chu{-}Carroll and
Krzysztof Czuba and
Christopher A. Welty and
Abraham Ittycheriah and
Ruchi Mahindru},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {IBM's {PIQUANT} in {TREC2003}},
booktitle = {Proceedings of The Twelfth Text REtrieval Conference, {TREC} 2003,
Gaithersburg, Maryland, USA, November 18-21, 2003},
series = {{NIST} Special Publication},
volume = {500-255},
pages = {283--292},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2003},
url = {http://trec.nist.gov/pubs/trec12/papers/ibm-prager.qa.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/PragerCCWIM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-DB-0310006,
author = {Serge Abiteboul and
Rakesh Agrawal and
Philip A. Bernstein and
Michael J. Carey and
Stefano Ceri and
W. Bruce Croft and
David J. DeWitt and
Michael J. Franklin and
Hector Garcia{-}Molina and
Dieter Gawlick and
Jim Gray and
Laura M. Haas and
Alon Y. Halevy and
Joseph M. Hellerstein and
Yannis E. Ioannidis and
Martin L. Kersten and
Michael J. Pazzani and
Michael Lesk and
David Maier and
Jeffrey F. Naughton and
Hans{-}J{\"{o}}rg Schek and
Timos K. Sellis and
Avi Silberschatz and
Michael Stonebraker and
Richard T. Snodgrass and
Jeffrey D. Ullman and
Gerhard Weikum and
Jennifer Widom and
Stanley B. Zdonik},
title = {The Lowell Database Research Self Assessment},
journal = {CoRR},
volume = {cs.DB/0310006},
year = {2003},
url = {http://arxiv.org/abs/cs/0310006},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-DB-0310006.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/BeckMAAJ02,
author = {Micah Beck and
Terry Moore and
Leif Abrahamsson and
Christophe Achouiantz and
Patrick Johansson},
title = {Enabling full service surrogates using the portable channel representation},
journal = {Comput. Networks},
volume = {39},
number = {5},
pages = {559--576},
year = {2002},
url = {https://doi.org/10.1016/S1389-1286(02)00216-5},
doi = {10.1016/S1389-1286(02)00216-5},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/BeckMAAJ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/ZissimosAKEW02,
author = {Andreas M. Zissimos and
Michael H. Abraham and
Andreas Klamt and
Frank Eckert and
John Wood},
title = {A Comparison between the Two General Sets of Linear Free Energy Descriptors
of Abraham and Klamt},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {42},
number = {6},
pages = {1320--1331},
year = {2002},
url = {https://doi.org/10.1021/ci025530o},
doi = {10.1021/CI025530O},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/ZissimosAKEW02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/VisserEM02,
author = {Abraham J. Visser and
Johan H. R. Enslin and
Hendrik du T. Mouton},
title = {Transformerless series sag compensation with a cascaded multilevel
inverter},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {49},
number = {4},
pages = {824--831},
year = {2002},
url = {https://doi.org/10.1109/TIE.2002.801067},
doi = {10.1109/TIE.2002.801067},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/VisserEM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdsp/LimaAA02,
author = {Charles B. de Lima and
Abraham Alcaim and
Jos{\'{e}} Antonio Apolin{\'{a}}rio},
title = {On the use of {PCA} in {GMM} and AR-vector models for text independent
speaker verification},
booktitle = {14th International Conference on Digital Signal Processing, {DSP}
2002, Santorini, Greece, July 1-3, 2002},
pages = {595--598},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/ICDSP.2002.1028160},
doi = {10.1109/ICDSP.2002.1028160},
timestamp = {Fri, 19 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdsp/LimaAA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdsp/LimaSAA02,
author = {Charles B. de Lima and
Dirceu G. da Silva and
Abraham Alcaim and
Jos{\'{e}} Antonio Apolin{\'{a}}rio},
title = {AR-vector using {CMS} for robust text independent speaker verification},
booktitle = {14th International Conference on Digital Signal Processing, {DSP}
2002, Santorini, Greece, July 1-3, 2002},
pages = {1073--1076},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/ICDSP.2002.1028276},
doi = {10.1109/ICDSP.2002.1028276},
timestamp = {Thu, 25 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdsp/LimaSAA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BlackKSP01,
author = {Kevin J. Black and
Jonathan M. Koller and
Abraham Z. Snyder and
Joel S. Perlmutter},
title = {Template Images for Nonhuman Primate Neuroimaging: 2. Macaque},
journal = {NeuroImage},
volume = {14},
number = {3},
pages = {744--748},
year = {2001},
url = {https://doi.org/10.1006/nimg.2001.0871},
doi = {10.1006/NIMG.2001.0871},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/BlackKSP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BlackSKGP01,
author = {Kevin J. Black and
Abraham Z. Snyder and
Jonathan M. Koller and
Mokhtar H. Gado and
Joel S. Perlmutter},
title = {Template Images for Nonhuman Primate Neuroimaging: 1. Baboon},
journal = {NeuroImage},
volume = {14},
number = {3},
pages = {736--743},
year = {2001},
url = {https://doi.org/10.1006/nimg.2001.0752},
doi = {10.1006/NIMG.2001.0752},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/BlackSKGP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BraverBKBCMSOAC01,
author = {Todd S. Braver and
Deanna M. Barch and
William M. Kelley and
Randy L. Buckner and
Neal J. Cohen and
Francis M. Miezin and
Abraham Z. Snyder and
John M. Ollinger and
Erbil Akbudak and
Thomas E. Conturo and
Steven E. Petersen},
title = {Direct Comparison of Prefrontal Cortex Regions Engaged by Working
and Long-Term Memory Tasks},
journal = {NeuroImage},
volume = {14},
number = {1},
pages = {48--59},
year = {2001},
url = {https://doi.org/10.1006/nimg.2001.0791},
doi = {10.1006/NIMG.2001.0791},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/BraverBKBCMSOAC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/QuinteroAAVMS01,
author = {Jos{\'{e}} Quintero and
Antonio Aguilera and
Maryvonne Abraham and
Hyxia Villegas and
Guillermo Montilla and
Basel Solaiman},
editor = {Nikolaos G. Bourbakis},
title = {Medical Decision-Making and Collaborative Reasoning},
booktitle = {2nd {IEEE} International Symposium on Bioinformatics and Bioengineering,
Bethesda, Maryland, USA, November 4-5, 2001, Proceedings},
pages = {161--165},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/BIBE.2001.974425},
doi = {10.1109/BIBE.2001.974425},
timestamp = {Fri, 09 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bibe/QuinteroAAVMS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/SahaAU01,
author = {Punam K. Saha and
John M. Abrahams and
Jayaram K. Udupa},
editor = {Milan Sonka and
Kenneth M. Hanson},
title = {Automatic bone-free rendering of cerebral aneurysms via 3D {CTA}},
booktitle = {Medical Imaging 2001: Image Processing, San Diego, CA, United States,
17-22 February 2001},
series = {{SPIE} Proceedings},
volume = {4322},
publisher = {{SPIE}},
year = {2001},
url = {https://doi.org/10.1117/12.431004},
doi = {10.1117/12.431004},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miip/SahaAU01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/BeckMAAJ01,
author = {Micah Beck and
Terry Moore and
Leif Abrahamsson and
Christophe Achouiantz and
Patrick Johansson},
editor = {Vincent Y. Shen and
Nobuo Saito and
Michael R. Lyu and
Mary Ellen Zurko},
title = {Enabling full service surrogates using the portable channel representation},
booktitle = {Proceedings of the Tenth International World Wide Web Conference,
{WWW} 10, Hong Kong, China, May 1-5, 2001},
pages = {376--385},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/371920.372091},
doi = {10.1145/371920.372091},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/www/BeckMAAJ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/DeignanMFAJ00,
author = {Paul B. Deignan Jr. and
Peter H. Meckl and
Matthew A. Franchek and
John Abraham and
Salim Jaliwala},
title = {Using mutual information to pre-process input data for a virtual sensor},
booktitle = {American Control Conference, {ACC} 2000, Chicago, Illinois, USA, 28-30
June, 2000},
pages = {2927--2931},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/ACC.2000.878746},
doi = {10.1109/ACC.2000.878746},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/DeignanMFAJ00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/AbrahamDLMRW00,
author = {Shelby Abraham and
Keith Duddy and
Michael Lawley and
Zoran Milosevic and
Kerry Raymond and
Andrew Wood},
title = {Mapping Enterprise Events to the {CORBA} Notification Service},
booktitle = {4th International Enterprise Distributed Object Computing Conference
{(EDOC} 2000), 25-28 September 2000, Makuhari, Japan, Proceedings},
pages = {124--134},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/EDOC.2000.882352},
doi = {10.1109/EDOC.2000.882352},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/AbrahamDLMRW00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/profes/JokelaA00,
author = {Timo Jokela and
Pekka Abrahamsson},
editor = {Frank Bomarius and
Markku Oivo},
title = {Modelling Usability Capability - Introducing the Dimensions},
booktitle = {Product Focused Software Process Improvement, Second International
Conference, {PROFES} 2000, Oulu, Finland, June 20-22, 2000, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1840},
pages = {73--87},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/978-3-540-45051-1\_10},
doi = {10.1007/978-3-540-45051-1\_10},
timestamp = {Tue, 14 May 2019 10:00:38 +0200},
biburl = {https://dblp.org/rec/conf/profes/JokelaA00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigopsE/MagoutisBGNS00,
author = {Kostas Magoutis and
Jos{\'{e}} Carlos Brustoloni and
Eran Gabber and
Wee Teck Ng and
Abraham Silberschatz},
title = {Building appliances out of components using Pebble},
booktitle = {Proceedings of the 9th {ACM} {SIGOPS} European Workshop, Kolding,
Denmark, September 17-20, 2000},
pages = {211--216},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/566726.566769},
doi = {10.1145/566726.566769},
timestamp = {Thu, 07 Nov 2019 10:24:25 +0100},
biburl = {https://dblp.org/rec/conf/sigopsE/MagoutisBGNS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/BrustoloniGSS00,
author = {Jos{\'{e}} Carlos Brustoloni and
Eran Gabber and
Abraham Silberschatz and
Amit Singh},
title = {Signaled Receiver Processing},
booktitle = {Proceedings of the General Track: 2000 {USENIX} Annual Technical Conference,
June 18-23, 2000, San Diego, CA, {USA}},
pages = {211--224},
publisher = {{USENIX}},
year = {2000},
url = {http://www.usenix.org/publications/library/proceedings/usenix2000/general/brustoloni.html},
timestamp = {Tue, 16 Jul 2024 09:12:32 +0200},
biburl = {https://dblp.org/rec/conf/usenix/BrustoloniGSS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bell/BlottMBBGKKLSS99,
author = {Stephen Blott and
Clifford E. Martin and
Yuri Breitbart and
Jos{\'{e}} Carlos Brustoloni and
Thomas R. Gramaglia and
Henry F. Korth and
David M. Kristol and
Robert H. Liao and
Eben Scanlon and
Avi Silberschatz},
title = {User-level billing and accounting in {IP} networks},
journal = {Bell Labs Tech. J.},
volume = {4},
number = {4},
pages = {237--251},
year = {1999},
url = {https://doi.org/10.1002/bltj.2201},
doi = {10.1002/BLTJ.2201},
timestamp = {Thu, 27 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bell/BlottMBBGKKLSS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/geoinformatica/AbrahamR99,
author = {Tamas Abraham and
John F. Roddick},
title = {Survey of Spatio-Temporal Databases},
journal = {GeoInformatica},
volume = {3},
number = {1},
pages = {61--99},
year = {1999},
url = {https://doi.org/10.1023/A:1009800916313},
doi = {10.1023/A:1009800916313},
timestamp = {Tue, 06 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/geoinformatica/AbrahamR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embsys/GabberSBBS99,
author = {Eran Gabber and
Christopher Small and
John L. Bruno and
Jos{\'{e}} Carlos Brustoloni and
Avi Silberschatz},
editor = {Dan Geer and
Mike Hawley},
title = {Pebble: {A} Component-based Operating System for Embedded Applications},
booktitle = {{USENIX} Workshop on Embedded Systems 1999, Cambridge, MA, USA, March
29-31, 1999},
publisher = {{USENIX} Association},
year = {1999},
url = {https://www.usenix.org/conference/workshop-embedded-systems/pebble-component-based-operating-system-embedded-applications},
timestamp = {Fri, 27 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embsys/GabberSBBS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/BrunoBGOS99,
author = {John L. Bruno and
Jos{\'{e}} Carlos Brustoloni and
Eran Gabber and
Banu {\"{O}}zden and
Abraham Silberschatz},
title = {Disk Scheduling with Quality of Service Guarantees},
booktitle = {{IEEE} International Conference on Multimedia Computing and Systems,
{ICMCS} 1999, Florence, Italy, June 7-11, 1999. Volume {II}},
pages = {400--405},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/MMCS.1999.778459},
doi = {10.1109/MMCS.1999.778459},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmcs/BrunoBGOS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/BaulierBGGHJKKMMNNRSSSWW99,
author = {Jerry Baulier and
Philip Bohannon and
S. Gogate and
C. Gupta and
Sibsankar Haldar and
S. Joshi and
A. Khivesera and
Henry F. Korth and
Peter McIlroy and
J. Miller and
P. P. S. Narayan and
M. Nemeth and
Rajeev Rastogi and
S. Seshadri and
Abraham Silberschatz and
S. Sudarshan and
M. Wilder and
C. Wei},
editor = {Alex Delis and
Christos Faloutsos and
Shahram Ghandeharizadeh},
title = {DataBlitz Storage Manager: Main Memory Database Performance for Critical
Applications},
booktitle = {{SIGMOD} 1999, Proceedings {ACM} {SIGMOD} International Conference
on Management of Data, June 1-3, 1999, Philadelphia, Pennsylvania,
{USA}},
pages = {519--520},
publisher = {{ACM} Press},
year = {1999},
url = {https://doi.org/10.1145/304182.304239},
doi = {10.1145/304182.304239},
timestamp = {Sun, 22 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmod/BaulierBGGHJKKMMNNRSSSWW99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/BrunoBGOS99,
author = {John L. Bruno and
Jos{\'{e}} Carlos Brustoloni and
Eran Gabber and
Banu {\"{O}}zden and
Abraham Silberschatz},
title = {Retrofitting Quality of Service into a Time-Sharing Operating System},
booktitle = {Proceedings of the 1999 {USENIX} Annual Technical Conference, June
6-11, 1999, Monterey, California, {USA}},
pages = {15--26},
publisher = {{USENIX}},
year = {1999},
url = {http://www.usenix.org/events/usenix99/full\_papers/bruno/bruno.pdf},
timestamp = {Tue, 16 Jul 2024 09:12:24 +0200},
biburl = {https://dblp.org/rec/conf/usenix/BrunoBGOS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/GabberSBBS99,
author = {Eran Gabber and
Christopher Small and
John L. Bruno and
Jos{\'{e}} Carlos Brustoloni and
Abraham Silberschatz},
title = {The Pebble Component-Based Operating System},
booktitle = {Proceedings of the 1999 {USENIX} Annual Technical Conference, June
6-11, 1999, Monterey, California, {USA}},
pages = {267--282},
publisher = {{USENIX}},
year = {1999},
url = {http://www.usenix.org/events/usenix99/full\_papers/gabber/gabber.pdf},
timestamp = {Tue, 16 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/usenix/GabberSBBS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ajis/AbrahamR98,
author = {Tamas Abraham and
John F. Roddick},
title = {Opportunities for Knowledge Discovery in Spatio-Temporal Information
Systems},
journal = {Australas. J. Inf. Syst.},
volume = {5},
number = {2},
year = {1998},
url = {http://journal.acs.org.au/index.php/ajis/article/view/338},
timestamp = {Wed, 10 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ajis/AbrahamR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jim/KarneBBBKWTKLD98,
author = {Ramesh K. Karne and
John S. Baras and
Michael O. Ball and
Sridhar Bashyam and
Abraham Kebede and
Jim Williams and
Vinai Trichur and
Manish Karir and
Hsing{-}Tsu Lai and
Swati Dandekar},
title = {Integrated product and process designenvironment tool for manufacturing
{T/R} modules},
journal = {J. Intell. Manuf.},
volume = {9},
number = {1},
pages = {9--15},
year = {1998},
url = {https://doi.org/10.1023/A\%3A1008891123347},
doi = {10.1023/A\%3A1008891123347},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jim/KarneBBBKWTKLD98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/KreimerM98,
author = {Joseph Kreimer and
Abraham Mehrez},
title = {Computation of availability of a real-time system using queueing theory
methodology},
journal = {J. Oper. Res. Soc.},
volume = {49},
number = {10},
pages = {1095--1100},
year = {1998},
url = {https://doi.org/10.1057/palgrave.jors.2600610},
doi = {10.1057/PALGRAVE.JORS.2600610},
timestamp = {Fri, 21 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/KreimerM98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/FerreiraR98,
author = {Jan Abraham Ferreira and
Johannes A. Roux},
title = {A series resonant converter for arc-striking applications},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {45},
number = {4},
pages = {585--592},
year = {1998},
url = {https://doi.org/10.1109/41.704886},
doi = {10.1109/41.704886},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/FerreiraR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/AbrahamR98,
author = {Tamas Abraham and
John F. Roddick},
editor = {Yahiko Kambayashi and
Dik Lun Lee and
Ee{-}Peng Lim and
Mukesh K. Mohania and
Yoshifumi Masunaga},
title = {Incremental Meta-Mining from Large Temporal Data Sets},
booktitle = {Advances in Database Technologies, {ER} '98 Workshops on Data Warehousing
and Data Mining, Mobile Data Access, and Collaborative Work Support
and Spatio-Temporal Data Management, Singapore, November 19-20, 1998,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1552},
pages = {41--54},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/978-3-540-49121-7\_4},
doi = {10.1007/978-3-540-49121-7\_4},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/er/AbrahamR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ftcs/GrosspietschAMKR98,
author = {Karl{-}Erwin Gro{\ss}pietsch and
Jacob A. Abraham and
Johannes Maier and
Hans{-}Dieter Kochs and
Michel Renovell},
title = {From Dependable Computing Systems to Computing for Integrated Dependable
Systems? (Panel)},
booktitle = {Digest of Papers: FTCS-28, The Twenty-Eigth Annual International Symposium
on Fault-Tolerant Computing, Munich, Germany, June 23-25, 1998},
pages = {296--301},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/FTCS.1998.689480},
doi = {10.1109/FTCS.1998.689480},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/ftcs/GrosspietschAMKR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/BrunoGOS98,
author = {John L. Bruno and
Eran Gabber and
Banu {\"{O}}zden and
Avi Silberschatz},
editor = {Fred Douglis},
title = {The Eclipse Operating System: Providing Quality of Service via Reservation
Domains},
booktitle = {Proceedings of the 1998 {USENIX} Annual Technical Conference, New
Orleans, Louisiana, USA, June 15-19, 1998},
publisher = {{USENIX} Association},
year = {1998},
url = {https://www.usenix.org/conference/1998-usenix-annual-technical-conference/eclipse-operating-system-providing-quality},
timestamp = {Tue, 16 Jul 2024 09:13:40 +0200},
biburl = {https://dblp.org/rec/conf/usenix/BrunoGOS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vldb/BaulierBGJGKKMMNNRSS98,
author = {Jerry Baulier and
Philip Bohannon and
S. Gogate and
S. Joshi and
C. Gupta and
A. Khivesera and
Henry F. Korth and
Peter McIlroy and
J. Miller and
P. P. S. Narayan and
M. Nemeth and
Rajeev Rastogi and
Abraham Silberschatz and
S. Sudarshan},
editor = {Ashish Gupta and
Oded Shmueli and
Jennifer Widom},
title = {DataBlitz: {A} High Performance Main-Memory Storage Manager},
booktitle = {VLDB'98, Proceedings of 24rd International Conference on Very Large
Data Bases, August 24-27, 1998, New York City, New York, {USA}},
pages = {701},
publisher = {Morgan Kaufmann},
year = {1998},
url = {http://www.vldb.org/conf/1998/p701.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vldb/BaulierBGJGKKMMNNRSS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fss/FarrellK97,
author = {John Farrell and
Abraham Kandel},
title = {A fuzzy rule-based expert system for marine bioassessment},
journal = {Fuzzy Sets Syst.},
volume = {89},
number = {1},
pages = {27--34},
year = {1997},
url = {https://doi.org/10.1016/S0165-0114(96)00093-0},
doi = {10.1016/S0165-0114(96)00093-0},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fss/FarrellK97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/HoskoteAFM97,
author = {Yatin Vasant Hoskote and
Jacob A. Abraham and
Donald S. Fussell and
John Moondanos},
title = {Automatic verification of implementations of large circuits against
{HDL} specifications},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {16},
number = {3},
pages = {217--228},
year = {1997},
url = {https://doi.org/10.1109/43.594828},
doi = {10.1109/43.594828},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/HoskoteAFM97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/BrunoGOS97,
author = {John L. Bruno and
Eran Gabber and
Banu {\"{O}}zden and
Abraham Silberschatz},
editor = {Ephraim P. Glinert and
Mark Scott Johnson and
Jim Foley and
Jim Hollan},
title = {Move-to-Rear List Scheduling: {A} New Scheduling Algorithm for Providing
QoS Guarantees},
booktitle = {Proceedings of the Fifth {ACM} International Conference on Multimedia
'97, Seattle, WA, USA, November 9-13, 1997},
pages = {63--73},
publisher = {{ACM} Press},
year = {1997},
url = {https://doi.org/10.1145/266180.266336},
doi = {10.1145/266180.266336},
timestamp = {Wed, 21 Jul 2021 12:11:06 +0200},
biburl = {https://dblp.org/rec/conf/mm/BrunoGOS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/JourdanA96,
author = {Marcelo Mollica Jourdan and
Abraham Alcaim},
title = {Edge-preserving {ADPCM} and {ECVQ} coding of image sub-bands using
subjective criteria},
booktitle = {Proceedings 1996 International Conference on Image Processing, Lausanne,
Switzerland, September 16-19, 1996},
pages = {411--414},
publisher = {{IEEE} Computer Society},
year = {1996},
url = {https://doi.org/10.1109/ICIP.1996.560518},
doi = {10.1109/ICIP.1996.560518},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icip/JourdanA96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/BernsteinDMQ95,
author = {Abraham Bernstein and
Chrysanthos Dellarocas and
Thomas W. Malone and
John Quimby},
title = {Software Tools for a Process Handbook},
journal = {{IEEE} Data Eng. Bull.},
volume = {18},
number = {1},
pages = {41--48},
year = {1995},
url = {http://sites.computer.org/debull/95MAR-CD.pdf},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/debu/BernsteinDMQ95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/JohansenKNS95,
author = {John Johansen and
Uday S. Karmarkar and
Dhananjay Nanda and
Abraham Seidmann},
title = {Computer Integrated Manufacturing: Empirical Implications for Industrial
Information Systems},
journal = {J. Manag. Inf. Syst.},
volume = {12},
number = {2},
pages = {59--82},
year = {1995},
url = {https://doi.org/10.1080/07421222.1995.11518081},
doi = {10.1080/07421222.1995.11518081},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/JohansenKNS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/logcom/MakowskyS95,
author = {Johann A. Makowsky and
Abraham Sharell},
title = {On Average Case Complexity of {SAT} for Symmetric Distribution},
journal = {J. Log. Comput.},
volume = {5},
number = {1},
pages = {71--92},
year = {1995},
url = {https://doi.org/10.1093/logcom/5.1.71},
doi = {10.1093/LOGCOM/5.1.71},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/logcom/MakowskyS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/JohansenKNS95,
author = {John Johansen and
Uday S. Karmarkar and
Dhananjay Nanda and
Abraham Seidmann},
title = {Business experience with computer integrated manufacturing. {A} survey
of current strategy and practice},
booktitle = {28th Annual Hawaii International Conference on System Sciences (HICSS-28),
January 3-6, 1995, Kihei, Maui, Hawaii, {USA}},
pages = {970--979},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/HICSS.1995.375650},
doi = {10.1109/HICSS.1995.375650},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/JohansenKNS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmnet/DanskinZA95,
author = {John M. Danskin and
Qin Zhang and
D. M. Abrahams{-}Gessel},
title = {Fast Higher Bandwidth {X}},
booktitle = {Proceedings of the International Conference on Multimedia Networking,
MmNet 1995, Aizu, Japan, September 26-29, 1995},
pages = {192--199},
publisher = {{IEEE} Computer Society},
year = {1995},
timestamp = {Mon, 20 Mar 2017 14:07:43 +0100},
biburl = {https://dblp.org/rec/conf/mmnet/DanskinZA95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-10-07 09:05 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
