default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Chia-Che Lee"
more than 1000 matches, exporting first 1000 hits only!
download as .bib file
@article{DBLP:journals/access/LinLKLCCK24,
author = {Chih{-}Lung Lin and
Chia{-}Lun Lee and
Cheng{-}Han Ke and
Po{-}Cheng Lai and
Chung{-}Tien Chiu and
Yu{-}Chang Chiu and
Chia{-}Wei Kuo},
title = {Lifetime Optimization of Optical Sensing System With Highly Reliable
a-Si:H TFT-Based Optical Sensor and Driver Circuit in Large AMLCDs},
journal = {{IEEE} Access},
volume = {12},
pages = {78122--78131},
year = {2024},
url = {https://doi.org/10.1109/ACCESS.2024.3399483},
doi = {10.1109/ACCESS.2024.3399483},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LinLKLCCK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcmi/HuangHCMHLCLHC24,
author = {Shu{-}Hua Huang and
Wen{-}Chiu Hsiao and
Hsin{-}I Chang and
Mi{-}Chia Ma and
Shih{-}Wei Hsu and
Chen{-}Chang Lee and
Hong{-}Jie Chen and
Ching{-}Heng Lin and
Chi{-}Wei Huang and
Chiung{-}Chih Chang},
title = {The use of individual-based {FDG-PET} volume of interest in predicting
conversion from mild cognitive impairment to dementia},
journal = {{BMC} Medical Imaging},
volume = {24},
number = {1},
pages = {75},
year = {2024},
url = {https://doi.org/10.1186/s12880-024-01256-x},
doi = {10.1186/S12880-024-01256-X},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcmi/HuangHCMHLCLHC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcmi/PangSLYLLLKTCTLNLL24,
author = {Jeffer Hann Wei Pang and
Seyed Ehsan Saffari and
Guan Rong Lee and
Wai{-}Yung Yu and
C. C. Tchoyoson Lim and
Kheng Choon Lim and
Chia Ching Lee and
Wee Yao Koh and
David Chia Wei Tsau and
Kevin Lee Min Chua and
Chee Kian Tham and
Yin Yee Sharon Low and
Wai Hoe Ng and
Chyi Yeu David Low and
Xuling Lin},
title = {Tumour growth rate predicts overall survival in patients with recurrent
{WHO} grade 4 glioma},
journal = {{BMC} Medical Imaging},
volume = {24},
number = {1},
pages = {125},
year = {2024},
url = {https://doi.org/10.1186/s12880-024-01263-y},
doi = {10.1186/S12880-024-01263-Y},
timestamp = {Sun, 02 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcmi/PangSLYLLLKTCTLNLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/ChenYTTYLLLWYCHHCCW24,
author = {Pey{-}Yu Chen and
Ta{-}Wei Yang and
Yi{-}Shan Tseng and
Cheng{-}Yu Tsai and
Chiung{-}Szu Yeh and
Yen{-}Hui Lee and
Pei{-}Hsuan Lin and
Ting{-}Chun Lin and
Yu{-}Jen Wu and
Ting{-}Hua Yang and
Yu{-}Ting Chiang and
Jacob Shujui Hsu and
Chuan{-}Jen Hsu and
Pei{-}Lung Chen and
Cheng{-}Fu Chou and
Chen{-}Chi Wu},
title = {Machine learning-based longitudinal prediction for GJB2-related sensorineural
hearing loss},
journal = {Comput. Biol. Medicine},
volume = {176},
pages = {108597},
year = {2024},
url = {https://doi.org/10.1016/j.compbiomed.2024.108597},
doi = {10.1016/J.COMPBIOMED.2024.108597},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/ChenYTTYLLLWYCHHCCW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/LiuLHCLCLWLDT24,
author = {Chien{-}Liang Liu and
Min{-}Hsuan Lee and
Shan{-}Ni Hsueh and
Chia{-}Chen Chung and
Chun{-}Ju Lin and
Po{-}Han Chang and
An{-}Chun Luo and
Hsuan{-}Chi Weng and
Yu{-}Hsien Lee and
Ming{-}Ji Dai and
Min{-}Juei Tsai},
title = {A bagging approach for improved predictive accuracy of intradialytic
hypotension during hemodialysis treatment},
journal = {Comput. Biol. Medicine},
volume = {172},
pages = {108244},
year = {2024},
url = {https://doi.org/10.1016/j.compbiomed.2024.108244},
doi = {10.1016/J.COMPBIOMED.2024.108244},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/LiuLHCLCLWLDT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/DaoutidisLRCGSHMMBLRG24,
author = {Prodromos Daoutidis and
Jay H. Lee and
Srinivas Rangarajan and
Leo Chiang and
R. Bhushan Gopaluni and
Artur M. Schweidtmann and
Iiro Harjunkoski and
Mehmet Mercang{\"{o}}z and
Ali Mesbah and
Fani Boukouvala and
Fernando V. Lima and
Ehecatl Antonio del Rio{-}Chanona and
Christos Georgakis},
title = {Machine learning in process systems engineering: Challenges and opportunities},
journal = {Comput. Chem. Eng.},
volume = {181},
pages = {108523},
year = {2024},
url = {https://doi.org/10.1016/j.compchemeng.2023.108523},
doi = {10.1016/J.COMPCHEMENG.2023.108523},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cce/DaoutidisLRCGSHMMBLRG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/LeeHC24,
author = {Chia{-}Yen Lee and
Yi{-}Tao Huang and
Peng{-}Jen Chen},
title = {Robust-optimization-guiding deep reinforcement learning for chemical
material production scheduling},
journal = {Comput. Chem. Eng.},
volume = {187},
pages = {108745},
year = {2024},
url = {https://doi.org/10.1016/j.compchemeng.2024.108745},
doi = {10.1016/J.COMPCHEMENG.2024.108745},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cce/LeeHC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/LinCCLYZTZ24,
author = {Tu{-}Liang Lin and
Hong{-}Yi Chang and
Yuan{-}Yao Chiang and
Shu{-}Cheng Lin and
Tsung{-}Yen Yang and
Chun{-}Jun Zhuang and
Wha{-}Lee Tseng and
Bo{-}Hao Zhang},
title = {Ransomware Detection by Distinguishing {API} Call Sequences through
{LSTM} and {BERT} Models},
journal = {Comput. J.},
volume = {67},
number = {2},
pages = {632--641},
year = {2024},
url = {https://doi.org/10.1093/comjnl/bxad005},
doi = {10.1093/COMJNL/BXAD005},
timestamp = {Sat, 16 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cj/LinCCLYZTZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmms/LinYZLTLLK24,
author = {Yang Chen Lin and
Shang{-}Lin Yu and
An{-}Yu Zhuang and
Chiayun Lee and
Yao An Ting and
Sheng{-}Kai Lee and
Bo{-}Jyun Lin and
Po{-}Chih Kuo},
title = {Representing scents: An evaluation framework of scent-related experiences
through associations between grounded and psychophysiological data},
journal = {Int. J. Hum. Comput. Stud.},
volume = {192},
pages = {103357},
year = {2024},
url = {https://doi.org/10.1016/j.ijhcs.2024.103357},
doi = {10.1016/J.IJHCS.2024.103357},
timestamp = {Fri, 20 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmms/LinYZLTLLK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/ChiangWLLJ24,
author = {Yu{-}Lun Chiang and
Jen{-}Cheng Wang and
Mu{-}Hwa Lee and
An{-}Chi Liu and
Joe{-}Air Jiang},
title = {Deep-Learning-Based Multi-Timestamp Multi-Location PM\({}_{\mbox{2.5}}\)
Prediction: Verification by Using a Mobile Monitoring System With
an IoT Framework Deployed in the Urban Zone of a Metropolitan Area},
journal = {{IEEE} Internet Things J.},
volume = {11},
number = {5},
pages = {8815--8837},
year = {2024},
url = {https://doi.org/10.1109/JIOT.2023.3322862},
doi = {10.1109/JIOT.2023.3322862},
timestamp = {Sun, 08 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/ChiangWLLJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcheminf/MoshawihBGKLGL24,
author = {Said Moshawih and
Zhen Hui Bu and
Hui Poh Goh and
Nurolaini Kifli and
Lam Hong Lee and
Khang Wen Goh and
Chiau Ming Long},
title = {Consensus holistic virtual screening for drug discovery: a novel machine
learning model approach},
journal = {J. Cheminformatics},
volume = {16},
number = {1},
pages = {62},
year = {2024},
url = {https://doi.org/10.1186/s13321-024-00855-8},
doi = {10.1186/S13321-024-00855-8},
timestamp = {Mon, 10 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcheminf/MoshawihBGKLGL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/YaoXGCHPWCL24,
author = {Lantian Yao and
Peilin Xie and
Jiahui Guan and
Chia{-}Ru Chung and
Yixian Huang and
Yuxuan Pang and
Huacong Wu and
Ying{-}Chih Chiang and
Tzong{-}Yi Lee},
title = {CapsEnhancer: An Effective Computational Framework for Identifying
Enhancers Based on Chaos Game Representation and Capsule Network},
journal = {J. Chem. Inf. Model.},
volume = {64},
number = {14},
pages = {5725--5736},
year = {2024},
url = {https://doi.org/10.1021/acs.jcim.4c00546},
doi = {10.1021/ACS.JCIM.4C00546},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/YaoXGCHPWCL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcloudc/AuliyaLCLW24,
author = {Ridlo Sayyidina Auliya and
Yen{-}Lin Lee and
Chia{-}Ching Chen and
Deron Liang and
Wei{-}Jen Wang},
title = {Analysis and prediction of virtual machine boot time on virtualized
computing environments},
journal = {J. Cloud Comput.},
volume = {13},
number = {1},
pages = {80},
year = {2024},
url = {https://doi.org/10.1186/s13677-024-00646-4},
doi = {10.1186/S13677-024-00646-4},
timestamp = {Thu, 11 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcloudc/AuliyaLCLW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/HungLLLFLWT24,
author = {Yuan Hung and
Chin Lin and
Chin{-}Sheng Lin and
Chiao{-}Chin Lee and
Wen{-}Hui Fang and
Chia{-}Cheng Lee and
Chih{-}Hung Wang and
Dung{-}Jang Tsai},
title = {Artificial Intelligence-Enabled Electrocardiography Predicts Future
Pacemaker Implantation and Adverse Cardiovascular Events},
journal = {J. Medical Syst.},
volume = {48},
number = {1},
pages = {67},
year = {2024},
url = {https://doi.org/10.1007/s10916-024-02088-6},
doi = {10.1007/S10916-024-02088-6},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/HungLLLFLWT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/TsaiLLLWF24,
author = {Dung{-}Jang Tsai and
Chin Lin and
Chin{-}Sheng Lin and
Chia{-}Cheng Lee and
Chih{-}Hung Wang and
Wen{-}Hui Fang},
title = {Artificial Intelligence-enabled Chest X-ray Classifies Osteoporosis
and Identifies Mortality Risk},
journal = {J. Medical Syst.},
volume = {48},
number = {1},
pages = {12},
year = {2024},
url = {https://doi.org/10.1007/s10916-023-02030-2},
doi = {10.1007/S10916-023-02030-2},
timestamp = {Tue, 23 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jms/TsaiLLLWF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenCLFY24,
author = {Po{-}Shao Chen and
Yen{-}Lung Chen and
Yu{-}Chi Lee and
Zih{-}Sing Fu and
Chia{-}Hsiang Yang},
title = {A 28.8-mW Accelerator {IC} for Dark Channel Prior-Based Blind Image
Deblurring},
journal = {{IEEE} J. Solid State Circuits},
volume = {59},
number = {6},
pages = {1899--1911},
year = {2024},
url = {https://doi.org/10.1109/JSSC.2023.3344539},
doi = {10.1109/JSSC.2023.3344539},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenCLFY24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jtaer/DemirciLLC24,
author = {Serhan Demirci and
Chia{-}Ju Ling and
Dai{-}Rong Lee and
Chien{-}Wen Chen},
title = {How Personality Traits Affect Customer Empathy Expression of Social
Media Ads and Purchasing Intention: {A} Psychological Perspective},
journal = {J. Theor. Appl. Electron. Commer. Res.},
volume = {19},
number = {1},
pages = {581--596},
year = {2024},
url = {https://doi.org/10.3390/jtaer19010031},
doi = {10.3390/JTAER19010031},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jtaer/DemirciLLC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/ChengLNHHL24,
author = {Chien{-}Hsiang Cheng and
Bor{-}Jen Lee and
Oswald Ndi Nfor and
Chih{-}Hsuan Hsiao and
Yi{-}Chia Huang and
Yung{-}Po Liaw},
title = {Using machine learning-based algorithms to construct cardiovascular
risk prediction models for Taiwanese adults based on traditional and
novel risk factors},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {24},
number = {1},
pages = {199},
year = {2024},
url = {https://doi.org/10.1186/s12911-024-02603-2},
doi = {10.1186/S12911-024-02603-2},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/ChengLNHHL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmhci/LaiLCDC24,
author = {Yu{-}Ju Lai and
Yi{-}Chieh Lee and
Chia{-}Chi Chang and
Wan{-}Ting Dai and
Ying{-}Yu Chen},
title = {Exploring the Role of Mom's Chat Groups in the Messaging App: Enhancing
Support and Empowerment for Stay-At-Home Mothers},
journal = {Proc. {ACM} Hum. Comput. Interact.},
volume = {8},
number = {{GROUP}},
pages = {1--20},
year = {2024},
url = {https://doi.org/10.1145/3633068},
doi = {10.1145/3633068},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmhci/LaiLCDC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamd/TsengLCLTLC24,
author = {Yi{-}Li Tseng and
Hong{-}Hsiang Liu and
Yen{-}Nan Chiu and
Chia{-}Hsin Lee and
Wen{-}Che Tsai and
Yang{-}Min Lin and
Yi{-}Ling Chien},
title = {Electroencephalography Connectivity Assesses Cognitive Disorders of
Autistic Children During Game-Based Social Interaction},
journal = {{IEEE} Trans. Cogn. Dev. Syst.},
volume = {16},
number = {2},
pages = {782--793},
year = {2024},
url = {https://doi.org/10.1109/TCDS.2023.3297609},
doi = {10.1109/TCDS.2023.3297609},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamd/TsengLCLTLC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/LeeLYCH24,
author = {Kai{-}Xuan Lee and
Chun{-}Chieh Lin and
Tzu{-}Chiao Yen and
Ya{-}Shu Chen and
Chan{-}Peng Hsu},
title = {{FASE:} Energy Isolation Framework for Latency-Sensitive Applications
in Intermittent Systems With Multiple Peripherals},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {43},
number = {2},
pages = {456--467},
year = {2024},
url = {https://doi.org/10.1109/TCAD.2023.3318199},
doi = {10.1109/TCAD.2023.3318199},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcad/LeeLYCH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcss/LeeJYCCS24,
author = {Boyi Lee and
Jhao{-}Yin Jhang and
Lo{-}Yao Yeh and
Ming{-}Yi Chang and
Chia{-}Mei Chen and
Chih{-}Ya Shen},
title = {Detecting Targets of Graph Adversarial Attacks With Edge and Feature
Perturbations},
journal = {{IEEE} Trans. Comput. Soc. Syst.},
volume = {11},
number = {3},
pages = {3218--3231},
year = {2024},
url = {https://doi.org/10.1109/TCSS.2023.3344642},
doi = {10.1109/TCSS.2023.3344642},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcss/LeeJYCCS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcss/LeeWOLLC24,
author = {Jui{-}Hsuan Lee and
Eric Hsiao{-}Kuang Wu and
Yu{-}Yen Ou and
Yueh{-}Che Lee and
Cheng{-}Hsun Lee and
Chia{-}Ru Chung},
title = {Anti-Drugs Chatbot: Chinese BERT-Based Cognitive Intent Analysis},
journal = {{IEEE} Trans. Comput. Soc. Syst.},
volume = {11},
number = {1},
pages = {514--521},
year = {2024},
url = {https://doi.org/10.1109/TCSS.2023.3238477},
doi = {10.1109/TCSS.2023.3238477},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcss/LeeWOLLC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tem/LeeC24a,
author = {Chia{-}Yen Lee and
Yen{-}Wen Chen},
title = {Reinforcement Learning With Data Envelopment Analysis and Conditional
Value-At-Risk for the Capacity Expansion Problem},
journal = {{IEEE} Trans. Engineering Management},
volume = {71},
pages = {6469--6480},
year = {2024},
url = {https://doi.org/10.1109/TEM.2023.3264566},
doi = {10.1109/TEM.2023.3264566},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tem/LeeC24a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/HsuJTLC24,
author = {Chih{-}Chung Hsu and
Chih{-}Yu Jian and
Eng{-}Shen Tu and
Chia{-}Ming Lee and
Guan{-}Lin Chen},
title = {Real-Time Compressed Sensing for Joint Hyperspectral Image Transmission
and Restoration for CubeSat},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {62},
pages = {1--16},
year = {2024},
url = {https://doi.org/10.1109/TGRS.2024.3378828},
doi = {10.1109/TGRS.2024.3378828},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/HsuJTLC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tist/ChenLHP24,
author = {Chiao{-}Ting Chen and
Chi Lee and
Szu{-}Hao Huang and
Wen{-}Chih Peng},
title = {Credit Card Fraud Detection via Intelligent Sampling and Self-supervised
Learning},
journal = {{ACM} Trans. Intell. Syst. Technol.},
volume = {15},
number = {2},
pages = {35:1--35:29},
year = {2024},
url = {https://doi.org/10.1145/3641283},
doi = {10.1145/3641283},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tist/ChenLHP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tist/LiuCLH24,
author = {Jhih{-}Chen Liu and
Chiao{-}Ting Chen and
Chi Lee and
Szu{-}Hao Huang},
title = {Evolving Knowledge Graph Representation Learning with Multiple Attention
Strategies for Citation Recommendation System},
journal = {{ACM} Trans. Intell. Syst. Technol.},
volume = {15},
number = {2},
pages = {33:1--33:26},
year = {2024},
url = {https://doi.org/10.1145/3635273},
doi = {10.1145/3635273},
timestamp = {Tue, 14 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tist/LiuCLH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/LeeCLMLFW24,
author = {Hao{-}Wei Lee and
Chun{-}Chia Chen and
Chen{-}I Stephanie Liao and
Abdelkader Medles and
Debby Lin and
I{-}Kang Fu and
Hung{-}Yu Wei},
title = {Interference Mitigation for Reverse Spectrum Sharing in {B5G/6G} Satellite-Terrestrial
Networks},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {73},
number = {3},
pages = {4247--4263},
year = {2024},
url = {https://doi.org/10.1109/TVT.2023.3328599},
doi = {10.1109/TVT.2023.3328599},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/LeeCLMLFW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/ChenLLYL24,
author = {Kuan{-}Fu Chen and
Ming{-}Chun Lee and
Chia{-}Hung Lin and
Wan{-}Chi Yeh and
Ta{-}Sung Lee},
title = {Multi-Fault and Severity Diagnosis for Self-Organizing Networks Using
Deep Supervised Learning and Unsupervised Transfer Learning},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {23},
number = {1},
pages = {141--157},
year = {2024},
url = {https://doi.org/10.1109/TWC.2023.3276313},
doi = {10.1109/TWC.2023.3276313},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/twc/ChenLLYL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/uais/TsaiLCLHL24,
author = {Chia{-}Wen Tsai and
Lan{-}Yu Lee and
Yih{-}Ping Cheng and
Chih{-}Hsien Lin and
Min{-}Ling Hung and
Jian{-}Wei Lin},
title = {Integrating online meta-cognitive learning strategy and team regulation
to develop students' programming skills, academic motivation, and
refusal self-efficacy of Internet use in a cloud classroom},
journal = {Univers. Access Inf. Soc.},
volume = {23},
number = {1},
pages = {395--410},
year = {2024},
url = {https://doi.org/10.1007/s10209-022-00958-9},
doi = {10.1007/S10209-022-00958-9},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/uais/TsaiLCLHL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ChiangL24,
author = {Cheng{-}Han Chiang and
Hung{-}yi Lee},
editor = {Lun{-}Wei Ku and
Andre Martins and
Vivek Srikumar},
title = {Merging Facts, Crafting Fallacies: Evaluating the Contradictory Nature
of Aggregated Factual Claims in Long-Form Generations},
booktitle = {Findings of the Association for Computational Linguistics, {ACL} 2024,
Bangkok, Thailand and virtual meeting, August 11-16, 2024},
pages = {2734--2751},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://doi.org/10.18653/v1/2024.findings-acl.160},
doi = {10.18653/V1/2024.FINDINGS-ACL.160},
timestamp = {Tue, 24 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ChiangL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LinCL24,
author = {Guan{-}Ting Lin and
Cheng{-}Han Chiang and
Hung{-}yi Lee},
editor = {Lun{-}Wei Ku and
Andre Martins and
Vivek Srikumar},
title = {Advancing Large Language Models to Capture Varied Speaking Styles
and Respond Properly in Spoken Conversations},
booktitle = {Proceedings of the 62nd Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2024, Bangkok, Thailand,
August 11-16, 2024},
pages = {6626--6642},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://doi.org/10.18653/v1/2024.acl-long.358},
doi = {10.18653/V1/2024.ACL-LONG.358},
timestamp = {Tue, 24 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LinCL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/Lee0LSH24,
author = {Shu{-}Hung Lee and
Chia{-}Hsin Cheng and
Kuan{-}Hsien Lu and
Yeong{-}Long Shiue and
Yung{-}Fa Huang},
editor = {Leonard Barolli},
title = {Performance Improvement of {DE} Algorithm for Indoor Positioning in
Wireless Sensor Networks},
booktitle = {Advanced Information Networking and Applications - Proceedings of
the 38th International Conference on Advanced Information Networking
and Applications (AINA-2024), Kitakyushu, Japan, 17-19 April, 2024,
Volume 1},
series = {Lecture Notes on Data Engineering and Communications Technologies},
volume = {199},
pages = {216--226},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-57840-3\_20},
doi = {10.1007/978-3-031-57840-3\_20},
timestamp = {Fri, 12 Apr 2024 15:34:52 +0200},
biburl = {https://dblp.org/rec/conf/aina/Lee0LSH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/LinTLHCYC24,
author = {Fang{-}Yu Lin and
Pei{-}Hua Tsai and
Chia{-}Yi Lee and
Yi{-}Ting Ho and
Yao{-}Kuang Chen and
Yu{-}Chun (Grace) Yen and
Yung{-}Ju Chang},
editor = {Florian 'Floyd' Mueller and
Penny Kyburz and
Julie R. Williamson and
Corina Sas and
Max L. Wilson and
Phoebe O. Toups Dugas and
Irina Shklovski},
title = {"I Prefer Regular Visitors to Answer My Questions": Users' Desired
Experiential Background of Contributors for Location-based Crowdsourcing
Platform},
booktitle = {Proceedings of the {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2024, Honolulu, HI, USA, May 11-16, 2024},
pages = {735:1--735:18},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3613904.3642520},
doi = {10.1145/3613904.3642520},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/LinTLHCYC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/YaoLLTL24,
author = {Ting{-}Chia Yao and
Kai{-}Wen Lin and
Chih{-}Kuo Lee and
Po{-}Hsuan Tseng and
Che{-}Rung Lee},
editor = {Hossain Shahriar and
Hiroyuki Ohsaki and
Moushumi Sharmin and
Dave Towey and
A. K. M. Jahangir Alam Majumder and
Yoshiaki Hori and
Ji{-}Jiang Yang and
Michiharu Takemoto and
Nazmus Sakib and
Ryohei Banno and
Sheikh Iqbal Ahamed},
title = {Training Sequential {CAG} Segmentation Models Without Labeled {CAG}
Video Data},
booktitle = {48th {IEEE} Annual Computers, Software, and Applications Conference,
{COMPSAC} 2024, Osaka, Japan, July 2-4, 2024},
pages = {934--940},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/COMPSAC61105.2024.00129},
doi = {10.1109/COMPSAC61105.2024.00129},
timestamp = {Thu, 05 Sep 2024 13:56:33 +0200},
biburl = {https://dblp.org/rec/conf/compsac/YaoLLTL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsn/ChenHLYH24,
author = {Wei{-}Jia Chen and
Chia{-}Yi Hsu and
Wei{-}Bin Lee and
Chia{-}Mu Yu and
Chun{-}Ying Huang},
title = {Road Decals as Trojans: Disrupting Autonomous Vehicle Navigation with
Adversarial Patterns},
booktitle = {54th Annual {IEEE/IFIP} International Conference on Dependable Systems
and Networks, {DSN} 2024 - Supplemental Volume, Brisbane, Australia,
June 24-27, 2024},
pages = {133--140},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/DSN-S60304.2024.00039},
doi = {10.1109/DSN-S60304.2024.00039},
timestamp = {Thu, 19 Sep 2024 11:00:54 +0200},
biburl = {https://dblp.org/rec/conf/dsn/ChenHLYH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/ChiangL24,
author = {Cheng{-}Han Chiang and
Hung{-}yi Lee},
editor = {Yvette Graham and
Matthew Purver},
title = {Over-Reasoning and Redundant Calculation of Large Language Models},
booktitle = {Proceedings of the 18th Conference of the European Chapter of the
Association for Computational Linguistics, {EACL} 2024 - Volume 2:
Short Papers, St. Julian's, Malta, March 17-22, 2024},
pages = {161--169},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://aclanthology.org/2024.eacl-short.15},
timestamp = {Tue, 02 Apr 2024 16:32:10 +0200},
biburl = {https://dblp.org/rec/conf/eacl/ChiangL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eucnc/LeeC24,
author = {Kelvin Kuang{-}Chi Lee and
Chiao{-}En Chen},
title = {A Sub-band Precoding Scheme for Wideband Massive {MIMO-OFDM} Systems},
booktitle = {Joint European Conference on Networks and Communications {\&}
6G Summit, EuCNC/6G Summit 2024, Antwerp, Belgium, June 3-6, 2024},
pages = {446--450},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/EuCNC/6GSummit60053.2024.10597134},
doi = {10.1109/EUCNC/6GSUMMIT60053.2024.10597134},
timestamp = {Mon, 29 Jul 2024 21:17:00 +0200},
biburl = {https://dblp.org/rec/conf/eucnc/LeeC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LeeTKLY24,
author = {Cheng{-}Yi Lee and
Cheng{-}Chang Tsai and
Ching{-}Chia Kao and
Chun{-}Shien Lu and
Chia{-}Mu Yu},
title = {Defending against Clean-Image Backdoor Attack in Multi-Label Classification},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2024, Seoul, Republic of Korea, April 14-19, 2024},
pages = {5500--5504},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICASSP48485.2024.10447895},
doi = {10.1109/ICASSP48485.2024.10447895},
timestamp = {Mon, 05 Aug 2024 15:26:37 +0200},
biburl = {https://dblp.org/rec/conf/icassp/LeeTKLY24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ChiangLSFHL24,
author = {Chia{-}Cheng Chiang and
Li{-}Cheng Lan and
Wei{-}Fang Sun and
Chien Feng and
Cho{-}Jui Hsieh and
Chun{-}Yi Lee},
title = {Expert Proximity as Surrogate Rewards for Single Demonstration Imitation
Learning},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=gzis9n5r7e},
timestamp = {Mon, 02 Sep 2024 16:45:29 +0200},
biburl = {https://dblp.org/rec/conf/icml/ChiangLSFHL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icppw/HsuHLLL24,
author = {Chia{-}Chen Hsu and
Chun{-}Lin Huang and
Chao{-}Lin Lee and
Jenq{-}Kuen Lee and
Pei{-}Hung Lin},
title = {The Rewriting of DataRaceBench Benchmark for OpenCL Program Validations},
booktitle = {Workshop Proceedings of the 53rd International Conference on Parallel
Processing, {ICPP} Workshops 2024, Gotland, Sweden, August 12-15,
2024},
pages = {15--22},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3677333.3678148},
doi = {10.1145/3677333.3678148},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icppw/HsuHLLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsse/HuangHCL24,
author = {Cheng{-}Ting Huang and
Mei{-}Lin Huang and
Hsin{-}Han Chiang and
Ching{-}Hung Lee},
title = {Toward Personalized Car-Following Behaviors From Driver Data Using
Learned and Hybrid Control Strategies},
booktitle = {International Conference on System Science and Engineering, {ICSSE}
2024, Hsinchu, Taiwan, June 26-28, 2024},
pages = {1--6},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICSSE61472.2024.10608932},
doi = {10.1109/ICSSE61472.2024.10608932},
timestamp = {Thu, 15 Aug 2024 11:54:35 +0200},
biburl = {https://dblp.org/rec/conf/icsse/HuangHCL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/LeeMSWPYZLKWG24,
author = {Pin{-}Yu Lee and
Shubh P. Mehta and
Anurag Sharma and
Hong{-}Jian Wei and
Antonios N. Pouliopoulos and
Yanting Yang and
Chenghao Zhang and
Andrew F. Laine and
Elisa E. Konofagou and
Cheng{-}Chia Wu and
Jia Guo},
title = {Deep Learning Enables Reduced Gadolinium Dose for Contrast-Enhanced
Blood-Brain Barrier Opening Quantitative Measurement},
booktitle = {{IEEE} International Symposium on Biomedical Imaging, {ISBI} 2024,
Athens, Greece, May 27-30, 2024},
pages = {1--5},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISBI56570.2024.10635626},
doi = {10.1109/ISBI56570.2024.10635626},
timestamp = {Fri, 06 Sep 2024 21:02:06 +0200},
biburl = {https://dblp.org/rec/conf/isbi/LeeMSWPYZLKWG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/FujiwaraMZKLPJCHHNTLLLCAAWCCLC24,
author = {Hidehiro Fujiwara and
Haruki Mori and
Wei{-}Chang Zhao and
Kinshuk Khare and
Cheng{-}En Lee and
Xiaochen Peng and
Vineet Joshi and
Chao{-}Kai Chuang and
Shu{-}Huan Hsu and
Takeshi Hashizume and
Toshiaki Naganuma and
Chen{-}Hung Tien and
Yao{-}Yi Liu and
Yen{-}Chien Lai and
Chia{-}Fu Lee and
Tan{-}Li Chou and
Kerem Akarvardar and
Saman Adham and
Yih Wang and
Yu{-}Der Chih and
Yen{-}Huei Chen and
Hung{-}Jen Liao and
Tsung{-}Yung Jonathan Chang},
title = {34.4 {A} 3nm, 32.5TOPS/W, 55.0TOPS/mm\({}^{\mbox{2}}\) and 3.78Mb/mm\({}^{\mbox{2}}\)
Fully-Digital Compute-in-Memory Macro Supporting {INT12} {\texttimes}
{INT12} with a Parallel-MAC Architecture and Foundry 6T-SRAM Bit Cell},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {572--574},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454556},
doi = {10.1109/ISSCC49657.2024.10454556},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/FujiwaraMZKLPJCHHNTLLLCAAWCCLC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LeeCLY24,
author = {Tang Lee and
Ting{-}Yang Chen and
I{-}Hsuan Liu and
Chia{-}Hsiang Yang},
title = {2.6 {A} 131mW 6.4Gbps 256{\texttimes}32 Multi-User {MIMO} {OTFS} Detector
for Next-Gen Communication Systems},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {46--48},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454410},
doi = {10.1109/ISSCC49657.2024.10454410},
timestamp = {Tue, 19 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/LeeCLY24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/00010O24,
author = {Chia{-}Hsuan Lee and
Hao Cheng and
Mari Ostendorf},
editor = {Kevin Duh and
Helena G{\'{o}}mez{-}Adorno and
Steven Bethard},
title = {OrchestraLLM: Efficient Orchestration of Language Models for Dialogue
State Tracking},
booktitle = {Proceedings of the 2024 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies
(Volume 1: Long Papers), {NAACL} 2024, Mexico City, Mexico, June 16-21,
2024},
pages = {1434--1445},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://doi.org/10.18653/v1/2024.naacl-long.79},
doi = {10.18653/V1/2024.NAACL-LONG.79},
timestamp = {Thu, 29 Aug 2024 17:13:57 +0200},
biburl = {https://dblp.org/rec/conf/naacl/00010O24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-11467,
author = {David Cheng{-}Han Chiang and
Hung{-}Yi Lee},
title = {Over-Reasoning and Redundant Calculation of Large Language Models},
journal = {CoRR},
volume = {abs/2401.11467},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.11467},
doi = {10.48550/ARXIV.2401.11467},
eprinttype = {arXiv},
eprint = {2401.11467},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-11467.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-00160,
author = {Simon A. Lee and
Sujay Jain and
Alex Chen and
Arabdha Biswas and
Jennifer Fang and
{\'{A}}kos Rudas and
Jeffrey N. Chiang},
title = {Multimodal Clinical Pseudo-notes for Emergency Department Prediction
Tasks using Multiple Embedding Model for {EHR} {(MEME)}},
journal = {CoRR},
volume = {abs/2402.00160},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.00160},
doi = {10.48550/ARXIV.2402.00160},
eprinttype = {arXiv},
eprint = {2402.00160},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-00160.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-01057,
author = {Chia{-}Cheng Chiang and
Li{-}Cheng Lan and
Wei{-}Fang Sun and
Chien Feng and
Cho{-}Jui Hsieh and
Chun{-}Yi Lee},
title = {Expert Proximity as Surrogate Rewards for Single Demonstration Imitation
Learning},
journal = {CoRR},
volume = {abs/2402.01057},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.01057},
doi = {10.48550/ARXIV.2402.01057},
eprinttype = {arXiv},
eprint = {2402.01057},
timestamp = {Fri, 09 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-01057.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-01741,
author = {Jasmine Chiat Ling Ong and
Liyuan Jin and
Kabilan Elangovan and
Gilbert Yong San Lim and
Daniel Yan Zheng Lim and
Gerald Gui Ren Sng and
Yuhe Ke and
Joshua Yi Min Tung and
Ryan Jian Zhong and
Christopher Ming Yao Koh and
Keane Zhi Hao Lee and
Xiang Chen and
Jack Kian Chng and
Aung Than and
Ken Junyang Goh and
Daniel Shu Wei Ting},
title = {Development and Testing of a Novel Large Language Model-Based Clinical
Decision Support Systems for Medication Safety in 12 Clinical Specialties},
journal = {CoRR},
volume = {abs/2402.01741},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.01741},
doi = {10.48550/ARXIV.2402.01741},
eprinttype = {arXiv},
eprint = {2402.01741},
timestamp = {Fri, 09 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-01741.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-03988,
author = {Liang{-}Hsuan Tseng and
En{-}Pei Hu and
David Cheng{-}Han Chiang and
Yuan Tseng and
Hung{-}yi Lee and
Lin{-}Shan Lee and
Shao{-}Hua Sun},
title = {{REBORN:} Reinforcement-Learned Boundary Segmentation with Iterative
Training for Unsupervised {ASR}},
journal = {CoRR},
volume = {abs/2402.03988},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.03988},
doi = {10.48550/ARXIV.2402.03988},
eprinttype = {arXiv},
eprint = {2402.03988},
timestamp = {Fri, 16 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-03988.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-05629,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
title = {Merging Facts, Crafting Fallacies: Evaluating the Contradictory Nature
of Aggregated Factual Claims in Long-Form Generations},
journal = {CoRR},
volume = {abs/2402.05629},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.05629},
doi = {10.48550/ARXIV.2402.05629},
eprinttype = {arXiv},
eprint = {2402.05629},
timestamp = {Wed, 14 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-05629.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-12786,
author = {Guan{-}Ting Lin and
David Cheng{-}Han Chiang and
Hung{-}yi Lee},
title = {Advancing Large Language Models to Capture Varied Speaking Styles
and Respond Properly in Spoken Conversations},
journal = {CoRR},
volume = {abs/2402.12786},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.12786},
doi = {10.48550/ARXIV.2402.12786},
eprinttype = {arXiv},
eprint = {2402.12786},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-12786.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-06009,
author = {Swapnaja Achintalwar and
Adriana Alvarado Garcia and
Ateret Anaby{-}Tavor and
Ioana Baldini and
Sara E. Berger and
Bishwaranjan Bhattacharjee and
Djallel Bouneffouf and
Subhajit Chaudhury and
Pin{-}Yu Chen and
Lamogha Chiazor and
Elizabeth M. Daly and
Rog{\'{e}}rio Abreu de Paula and
Pierre L. Dognin and
Eitan Farchi and
Soumya Ghosh and
Michael Hind and
Raya Horesh and
George Kour and
Ja Young Lee and
Erik Miehling and
Keerthiram Murugesan and
Manish Nagireddy and
Inkit Padhi and
David Piorkowski and
Ambrish Rawat and
Orna Raz and
Prasanna Sattigeri and
Hendrik Strobelt and
Sarathkrishna Swaminathan and
Christoph Tillmann and
Aashka Trivedi and
Kush R. Varshney and
Dennis Wei and
Shalisha Witherspoon and
Marcel Zalmanovici},
title = {Detectors for Safe and Reliable LLMs: Implementations, Uses, and Limitations},
journal = {CoRR},
volume = {abs/2403.06009},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.06009},
doi = {10.48550/ARXIV.2403.06009},
eprinttype = {arXiv},
eprint = {2403.06009},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-06009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-10988,
author = {Li{-}Yuan Tsao and
Yi{-}Chen Lo and
Chia{-}Che Chang and
Hao{-}Wei Chen and
Roy Tseng and
Chien Feng and
Chun{-}Yi Lee},
title = {Boosting Flow-based Generative Super-Resolution Models via Learned
Prior},
journal = {CoRR},
volume = {abs/2403.10988},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.10988},
doi = {10.48550/ARXIV.2403.10988},
eprinttype = {arXiv},
eprint = {2403.10988},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-10988.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-15791,
author = {Mu{-}Yi Shen and
Chia{-}Chi Hsu and
Hao{-}Yu Hou and
Yu{-}Chen Huang and
Wei{-}Fang Sun and
Chia{-}Che Chang and
Yu{-}Lun Liu and
Chun{-}Yi Lee},
title = {DriveEnv-NeRF: Exploration of {A} NeRF-Based Autonomous Driving Environment
for Real-World Performance Validation},
journal = {CoRR},
volume = {abs/2403.15791},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.15791},
doi = {10.48550/ARXIV.2403.15791},
eprinttype = {arXiv},
eprint = {2403.15791},
timestamp = {Tue, 09 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-15791.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-09790,
author = {Zheng Chen and
Zongwei Wu and
Eduard Zamfir and
Kai Zhang and
Yulun Zhang and
Radu Timofte and
Xiaokang Yang and
Hongyuan Yu and
Cheng Wan and
Yuxin Hong and
Zhijuan Huang and
Yajun Zou and
Yuan Huang and
Jiamin Lin and
Bingnan Han and
Xianyu Guan and
Yongsheng Yu and
Daoan Zhang and
Xuanwu Yin and
Kunlong Zuo and
Jinhua Hao and
Kai Zhao and
Kun Yuan and
Ming Sun and
Chao Zhou and
Hongyu An and
Xinfeng Zhang and
Zhiyuan Song and
Ziyue Dong and
Qing Zhao and
Xiaogang Xu and
Pengxu Wei and
Zhi{-}Chao Dou and
Gui{-}Ling Wang and
Chih{-}Chung Hsu and
Chia{-}Ming Lee and
Yi{-}Shiuan Chou and
Cansu Korkmaz and
A. Murat Tekalp and
Yubin Wei and
Xiaole Yan and
Binren Li and
Haonan Chen and
Siqi Zhang and
Sihan Chen and
Amogh Joshi and
Nikhil Akalwadi and
Sampada Malagi and
Palani Yashaswini and
Chaitra Desai and
Ramesh Ashok Tabib and
Ujwala Patil and
Uma Mudenagudi and
Anjali Sarvaiya and
Pooja Choksy and
Jagrit Joshi and
Shubh Kawa and
Kishor P. Upla and
Sushrut Patwardhan and
Raghavendra Ramachandra and
Sadat Hossain and
Geongi Park and
S. M. Nadim Uddin and
Hao Xu and
Yanhui Guo and
Aman Urumbekov and
Xingzhuo Yan and
Wei Hao and
Minghan Fu and
Isaac Orais and
Samuel Smith and
Ying Liu and
Wangwang Jia and
Qisheng Xu and
Kele Xu and
Weijun Yuan and
Zhan Li and
Wenqing Kuang and
Ruijin Guan and
Ruting Deng and
Zhao Zhang and
Bo Wang and
Suiyi Zhao and
Yan Luo and
Yanyan Wei and
Asif Hussain Khan and
Christian Micheloni and
Niki Martinel},
title = {{NTIRE} 2024 Challenge on Image Super-Resolution ({\unicode{10761}}4):
Methods and Results},
journal = {CoRR},
volume = {abs/2404.09790},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.09790},
doi = {10.48550/ARXIV.2404.09790},
eprinttype = {arXiv},
eprint = {2404.09790},
timestamp = {Mon, 19 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-09790.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-15781,
author = {Chih{-}Chung Hsu and
Chih{-}Yu Jian and
Eng{-}Shen Tu and
Chia{-}Ming Lee and
Guan{-}Lin Chen},
title = {Real-Time Compressed Sensing for Joint Hyperspectral Image Transmission
and Restoration for CubeSat},
journal = {CoRR},
volume = {abs/2404.15781},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.15781},
doi = {10.48550/ARXIV.2404.15781},
eprinttype = {arXiv},
eprint = {2404.15781},
timestamp = {Mon, 03 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-15781.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-10118,
author = {Holy Lovenia and
Rahmad Mahendra and
Salsabil Maulana Akbar and
Lester James V. Miranda and
Jennifer Santoso and
Elyanah Aco and
Akhdan Fadhilah and
Jonibek Mansurov and
Joseph Marvin Imperial and
Onno Pepijn Kampman and
Joel Ruben Antony Moniz and
Muhammad Ravi Shulthan Habibi and
Frederikus Hudi and
Railey Montalan and
Ryan Ignatius and
Joanito Agili Lopo and
William Nixon and
B{\"{o}}rje F. Karlsson and
James Jaya and
Ryandito Diandaru and
Yuze Gao and
Patrick Amadeus Irawan and
Bin Wang and
Jan Christian Blaise Cruz and
Chenxi Whitehouse and
Ivan Halim Parmonangan and
Maria Khelli and
Wenyu Zhang and
Lucky Susanto and
Reynard Adha Ryanda and
Sonny Lazuardi Hermawan and
Dan John Velasco and
Muhammad Dehan Al Kautsar and
Willy Fitra Hendria and
Yasmin Moslem and
Noah Flynn and
Muhammad Farid Adilazuarda and
Haochen Li and
Johanes Lee and
R. Damanhuri and
Shuo Sun and
Muhammad Reza Qorib and
Amirbek Djanibekov and
Wei Qi Leong and
Quyet V. Do and
Niklas Muennighoff and
Tanrada Pansuwan and
Ilham Firdausi Putra and
Yan Xu and
Ngee Chia Tai and
Ayu Purwarianti and
Sebastian Ruder and
William{-}Chandra Tjhi and
Peerat Limkonchotiwat and
Alham Fikri Aji and
Sedrick Keh and
Genta Indra Winata and
Ruochen Zhang and
Fajri Koto and
Zheng Xin Yong and
Samuel Cahyawijaya},
title = {SEACrowd: {A} Multilingual Multimodal Data Hub and Benchmark Suite
for Southeast Asian Languages},
journal = {CoRR},
volume = {abs/2406.10118},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.10118},
doi = {10.48550/ARXIV.2406.10118},
eprinttype = {arXiv},
eprint = {2406.10118},
timestamp = {Thu, 11 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-10118.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-18871,
author = {Ke{-}Han Lu and
Zhehuai Chen and
Szu{-}Wei Fu and
He Huang and
Boris Ginsburg and
Yu{-}Chiang Frank Wang and
Hung{-}yi Lee},
title = {DeSTA: Enhancing Speech Language Models through Descriptive Speech-Text
Alignment},
journal = {CoRR},
volume = {abs/2406.18871},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.18871},
doi = {10.48550/ARXIV.2406.18871},
eprinttype = {arXiv},
eprint = {2406.18871},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-18871.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-19941,
author = {Chih{-}Chung Hsu and
Shao{-}Ning Chen and
Mei{-}Hsuan Wu and
Yi{-}Fang Wang and
Chia{-}Ming Lee and
Yi{-}Shiuan Chou},
title = {{GRACE:} Graph-Regularized Attentive Convolutional Entanglement with
Laplacian Smoothing for Robust DeepFake Video Detection},
journal = {CoRR},
volume = {abs/2406.19941},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.19941},
doi = {10.48550/ARXIV.2406.19941},
eprinttype = {arXiv},
eprint = {2406.19941},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-19941.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-05216,
author = {Cheng{-}Han Chiang and
Wei{-}Chih Chen and
Chun{-}Yi Kuan and
Chienchou Yang and
Hung{-}yi Lee},
title = {Large Language Model as an Assignment Evaluator: Insights, Feedback,
and Challenges in a 1000+ Student Course},
journal = {CoRR},
volume = {abs/2407.05216},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.05216},
doi = {10.48550/ARXIV.2407.05216},
eprinttype = {arXiv},
eprint = {2407.05216},
timestamp = {Mon, 12 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-05216.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-07775,
author = {Hao{-}Tien Lewis Chiang and
Zhuo Xu and
Zipeng Fu and
Mithun George Jacob and
Tingnan Zhang and
Tsang{-}Wei Edward Lee and
Wenhao Yu and
Connor Schenck and
David Rendleman and
Dhruv Shah and
Fei Xia and
Jasmine Hsu and
Jonathan Hoech and
Pete Florence and
Sean Kirmani and
Sumeet Singh and
Vikas Sindhwani and
Carolina Parada and
Chelsea Finn and
Peng Xu and
Sergey Levine and
Jie Tan},
title = {Mobility {VLA:} Multimodal Instruction Navigation with Long-Context
VLMs and Topological Graphs},
journal = {CoRR},
volume = {abs/2407.07775},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.07775},
doi = {10.48550/ARXIV.2407.07775},
eprinttype = {arXiv},
eprint = {2407.07775},
timestamp = {Fri, 16 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-07775.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-10180,
author = {Cheng{-}Yi Lee and
Ching{-}Chia Kao and
Cheng{-}Han Yeh and
Chun{-}Shien Lu and
Chia{-}Mu Yu and
Chu{-}Song Chen},
title = {Defending Against Repetitive-based Backdoor Attacks on Semi-supervised
Learning through Lens of Rate-Distortion-Perception Trade-off},
journal = {CoRR},
volume = {abs/2407.10180},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.10180},
doi = {10.48550/ARXIV.2407.10180},
eprinttype = {arXiv},
eprint = {2407.10180},
timestamp = {Thu, 15 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-10180.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-15458,
author = {Wenze Ren and
Yi{-}Cheng Lin and
Huang{-}Cheng Chou and
Haibin Wu and
Yi{-}Chiao Wu and
Chi{-}Chun Lee and
Hung{-}yi Lee and
Yu Tsao},
title = {EMO-Codec: An In-Depth Look at Emotion Preservation capacity of Legacy
and Neural Codec Models With Subjective and Objective Evaluations},
journal = {CoRR},
volume = {abs/2407.15458},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.15458},
doi = {10.48550/ARXIV.2407.15458},
eprinttype = {arXiv},
eprint = {2407.15458},
timestamp = {Sat, 24 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-15458.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-11679,
author = {Cheng{-}Yi Lee and
Cheng{-}Chang Tsai and
Chia{-}Mu Yu and
Chun{-}Shien Lu},
title = {Exploring Robustness of Visual State Space model against Backdoor
Attacks},
journal = {CoRR},
volume = {abs/2408.11679},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.11679},
doi = {10.48550/ARXIV.2408.11679},
eprinttype = {arXiv},
eprint = {2408.11679},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-11679.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-11841,
author = {Beatriz Borges and
Negar Foroutan and
Deniz Bayazit and
Anna Sotnikova and
Syrielle Montariol and
Tanya Nazaretzky and
Mohammadreza Banaei and
Alireza Sakhaeirad and
Philippe Servant and
Seyed Parsa Neshaei and
Jibril Frej and
Angelika Romanou and
Gail Weiss and
Sepideh Mamooler and
Zeming Chen and
Simin Fan and
Silin Gao and
Mete Ismayilzada and
Debjit Paul and
Alexandre Sch{\"{o}}pfer and
Andrej Janchevski and
Anja Tiede and
Clarence Linden and
Emanuele Troiani and
Francesco Salvi and
Freya Behrens and
Giacomo Orsi and
Giovanni Piccioli and
Hadrien Sevel and
Louis Coulon and
Manuela Pineros{-}Rodriguez and
Marin Bonnassies and
Pierre Hellich and
Puck van Gerwen and
Sankalp Gambhir and
Solal Pirelli and
Thomas Blanchard and
Timoth{\'{e}}e Callens and
Toni Abi Aoun and
Yannick Calvino Alonso and
Yuri Cho and
Alberto Silvio Chiappa and
Antonio Sclocchi and
{\'{E}}tienne Bruno and
Florian Hofhammer and
Gabriel Pescia and
Geovani Rizk and
Leello Dadi and
Lucas Stoffl and
Manoel Horta Ribeiro and
Matthieu Bovel and
Yueyang Pan and
Aleksandra Radenovic and
Alexandre Alahi and
Alexander Mathis and
Anne{-}Florence Bitbol and
Boi Faltings and
C{\'{e}}cile H{\'{e}}bert and
Devis Tuia and
Fran{\c{c}}ois Mar{\'{e}}chal and
George Candea and
Giuseppe Carleo and
Jean{-}C{\'{e}}dric Chappelier and
Nicolas Flammarion and
Jean{-}Marie F{\"{u}}rbringer and
Jean{-}Philippe Pellet and
Karl Aberer and
Lenka Zdeborov{\'{a}} and
Marcel Salath{\'{e}} and
Martin Jaggi and
Martin Rajman and
Mathias Payer and
Matthieu Wyart and
Michael Gastpar and
Michele Ceriotti and
Ola Svensson and
Olivier L{\'{e}}v{\^{e}}que and
Paolo Ienne and
Rachid Guerraoui and
Robert West and
Sanidhya Kashyap and
Valerio Piazza and
Viesturs Simanis and
Viktor Kuncak and
Volkan Cevher and
Philippe Schwaller and
Sacha Friedli and
Patrick Jermann and
Tanja Kaser and
Antoine Bosselut},
title = {Could ChatGPT get an Engineering Degree? Evaluating Higher Education
Vulnerability to {AI} Assistants},
journal = {CoRR},
volume = {abs/2408.11841},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.11841},
doi = {10.48550/ARXIV.2408.11841},
eprinttype = {arXiv},
eprint = {2408.11841},
timestamp = {Sat, 28 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-11841.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChengCKSLLCLCCH23,
author = {Chih{-}Han Cheng and
Ching{-}Te Chiu and
Chia{-}Yu Kuan and
Yu{-}Chi Su and
Kuan{-}Hsien Liu and
Tsung{-}Chan Lee and
Jia{-}Lin Chen and
Jie{-}Yu Luo and
Wei{-}Chang Chung and
Yao{-}Ren Chang and
Kuan{-}Ying Ho},
title = {Multiple Training Stage Image Enhancement Enrolled With {CCRGAN} Pseudo
Templates for Large Area Dry Fingerprint Recognition},
journal = {{IEEE} Access},
volume = {11},
pages = {86790--86800},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3303532},
doi = {10.1109/ACCESS.2023.3303532},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChengCKSLLCLCCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LeeRCCLLCMM23,
author = {Yi Chen Lee and
Harikrishnan Ramiah and
Alexander Choo Chia Chun and
Kishore Kumar Pakkirisami Churchill and
Nai Shyan Lai and
Chee{-}Cheow Lim and
Yong Chen and
Pui{-}In Mak and
Rui Paulo Martins},
title = {High-Performance Multiband Ambient {RF} Energy Harvesting Front-End
System for Sustainable IoT Applications - {A} Review},
journal = {{IEEE} Access},
volume = {11},
pages = {11143--11164},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3241458},
doi = {10.1109/ACCESS.2023.3241458},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/LeeRCCLLCMM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LinLCLCC23,
author = {Shih{-}Hsiang Lin and
Jun{-}Yi Lee and
Chia{-}Chou Chuang and
Narn{-}Yih Lee and
Pei{-}Yin Chen and
Wen{-}Long Chin},
title = {Hardware Implementation of High-Throughput S-Box in {AES} for Information
Security},
journal = {{IEEE} Access},
volume = {11},
pages = {59049--59058},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3284142},
doi = {10.1109/ACCESS.2023.3284142},
timestamp = {Tue, 25 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LinLCLCC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/apin/ChiuLCLSC23,
author = {Sheng{-}Min Chiu and
Yow{-}Shin Liou and
Yi{-}Chung Chen and
Chiang Lee and
Rong{-}Kang Shang and
Tzu{-}Yin Chang},
title = {Identifying key grid cells for crowd flow predictions based on CNN-based
models with the Grad-CAM kit},
journal = {Appl. Intell.},
volume = {53},
number = {11},
pages = {13323--13351},
year = {2023},
url = {https://doi.org/10.1007/s10489-022-03988-1},
doi = {10.1007/S10489-022-03988-1},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/apin/ChiuLCLSC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/ChenHLHTCLL23,
author = {Hsin{-}Hua Chen and
Chun{-}Wei Hsueh and
Chia{-}Hwa Lee and
Ting{-}Yi Hao and
Tzu{-}Ying Tu and
Lan{-}Yun Chang and
Jih{-}Chin Lee and
Chun{-}Yu Lin},
title = {{SWEET:} a single-sample network inference method for deciphering
individual features in disease},
journal = {Briefings Bioinform.},
volume = {24},
number = {2},
year = {2023},
url = {https://doi.org/10.1093/bib/bbad032},
doi = {10.1093/BIB/BBAD032},
timestamp = {Sat, 13 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/ChenHLHTCLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodatamining/OuTLTYCBCLSCT23,
author = {Shuo{-}Ming Ou and
Ming{-}Tsun Tsai and
Kuo{-}Hua Lee and
Wei{-}Cheng Tseng and
Chih{-}Yu Yang and
Tz{-}Heng Chen and
Pin{-}Jie Bin and
Tzeng{-}Ji Chen and
Yao{-}Ping Lin and
Wayne Huey{-}Herng Sheu and
Yuan{-}Chia Chu and
Der{-}Cherng Tarng},
title = {Prediction of the risk of developing end-stage renal diseases in newly
diagnosed type 2 diabetes mellitus using artificial intelligence algorithms},
journal = {BioData Min.},
volume = {16},
number = {1},
year = {2023},
url = {https://doi.org/10.1186/s13040-023-00324-2},
doi = {10.1186/S13040-023-00324-2},
timestamp = {Tue, 25 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodatamining/OuTLTYCBCLSCT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/TsaiLCLCLLT23,
author = {Chia{-}Wen Tsai and
Michael Yu{-}Ching Lin and
Yih{-}Ping Cheng and
Lan{-}Yu Lee and
Wen{-}Li Chyr and
Chih{-}Hsien Lin and
Jian{-}Wei Lin and
Meng{-}Chuan Tsai},
title = {The effects of online peer-facilitated learning and distributed pair
programming on students' learning},
journal = {Comput. Educ.},
volume = {203},
pages = {104849},
year = {2023},
url = {https://doi.org/10.1016/j.compedu.2023.104849},
doi = {10.1016/J.COMPEDU.2023.104849},
timestamp = {Tue, 15 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ce/TsaiLCLCLLT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/HuangWNWKLRHYL23,
author = {Chih{-}Wei Huang and
Bethany C. Y. Wu and
Phung Anh Nguyen and
Hsiao Han Wang and
Chih{-}Chung Kao and
Pei{-}Chen Lee and
Annisa Ristya Rahmanti and
Jason C. Hsu and
Hsuan{-}Chia Yang and
Yu{-}Chuan (Jack) Li},
title = {Emotion recognition in doctor-patient interactions from real-world
clinical video database: Initial development of artificial empathy},
journal = {Comput. Methods Programs Biomed.},
volume = {233},
pages = {107480},
year = {2023},
url = {https://doi.org/10.1016/j.cmpb.2023.107480},
doi = {10.1016/J.CMPB.2023.107480},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/HuangWNWKLRHYL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LeeYLLWCWGW23,
author = {Wei{-}Kai Lee and
Huai{-}Che Yang and
Cheng{-}Chia Lee and
Chia{-}Feng Lu and
Chih{-}Chun Wu and
Wen{-}Yuh Chung and
Hsiu{-}Mei Wu and
Wan{-}Yuo Guo and
Yu{-}Te Wu},
title = {Lesion delineation framework for vestibular schwannoma, meningioma
and brain metastasis for gamma knife radiosurgery using stereotactic
magnetic resonance images},
journal = {Comput. Methods Programs Biomed.},
volume = {229},
pages = {107311},
year = {2023},
url = {https://doi.org/10.1016/j.cmpb.2022.107311},
doi = {10.1016/J.CMPB.2022.107311},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/LeeYLLWCWGW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LouLFLL23,
author = {Yu{-}Sheng Lou and
Chin{-}Sheng Lin and
Wen{-}Hui Fang and
Chia{-}Cheng Lee and
Chin Lin},
title = {Extensive deep learning model to enhance electrocardiogram application
via latent cardiovascular feature extraction from identity identification},
journal = {Comput. Methods Programs Biomed.},
volume = {231},
pages = {107359},
year = {2023},
url = {https://doi.org/10.1016/j.cmpb.2023.107359},
doi = {10.1016/J.CMPB.2023.107359},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/LouLFLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/games/LeeFT23,
author = {Jen{-}Yao Lee and
Chen{-}Chia Fan and
Chien{-}Shu Tsai},
title = {Network Externalities and Downstream Collusion under Asymmetric Costs:
{A} Note},
journal = {Games},
volume = {14},
number = {2},
pages = {29},
year = {2023},
url = {https://doi.org/10.3390/g14020029},
doi = {10.3390/G14020029},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/games/LeeFT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/health/BehYLLW23,
author = {Win{-}Ken Beh and
Yu{-}Chia Yang and
Yi{-}Cheng Lo and
Yun{-}Chieh Lee and
An{-}Yeu Andy Wu},
title = {Machine-aided {PPG} Signal Quality Assessment {(SQA)} for Multi-mode
Physiological Signal Monitoring},
journal = {{ACM} Trans. Comput. Heal.},
volume = {4},
number = {2},
pages = {14:1--14:20},
year = {2023},
url = {https://doi.org/10.1145/3587256},
doi = {10.1145/3587256},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/health/BehYLLW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hij/LeeCSHW23,
author = {Chia{-}Rong Lee and
Edward T.{-}H. Chu and
Hong{-}Cheng Shen and
Juin Hsu and
Hui{-}Mei Wu},
title = {An indoor location-based hospital porter management system and trace
analysis},
journal = {Health Informatics J.},
volume = {29},
number = {2},
year = {2023},
url = {https://doi.org/10.1177/14604582231183399},
doi = {10.1177/14604582231183399},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hij/LeeCSHW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicetb/YehYLLH23,
author = {Kuan{-}Cheng Yeh and
Chia{-}Hsing Yang and
Ming{-}Chun Lee and
Ta{-}Sung Lee and
Hsiang{-}Hsuan Hung},
title = {Parameter Selection and Radar Fusion for Tracking in Roadside Units},
journal = {{IEICE} Trans. Commun.},
volume = {106},
number = {9},
pages = {855--863},
year = {2023},
url = {https://doi.org/10.1587/transcom.2022ebp3146},
doi = {10.1587/TRANSCOM.2022EBP3146},
timestamp = {Sun, 24 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicetb/YehYLLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/HuangCLKH23,
author = {Wei{-}Chia Huang and
Chiao{-}Ting Chen and
Chi Lee and
Fan{-}Hsuan Kuo and
Szu{-}Hao Huang},
title = {Attentive gated graph sequence neural network-based time-series information
fusion for financial trading},
journal = {Inf. Fusion},
volume = {91},
pages = {261--276},
year = {2023},
url = {https://doi.org/10.1016/j.inffus.2022.10.006},
doi = {10.1016/J.INFFUS.2022.10.006},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/HuangCLKH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/LeeCLH23,
author = {Shu{-}Hung Lee and
Chia{-}Hsin Cheng and
Chien{-}Chih Lin and
Yung{-}Fa Huang},
title = {Target Positioning and Tracking in WSNs Based on {AFSA}},
journal = {Inf.},
volume = {14},
number = {4},
pages = {246},
year = {2023},
url = {https://doi.org/10.3390/info14040246},
doi = {10.3390/INFO14040246},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/LeeCLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/ZhangCLLF23,
author = {Yu{-}Ming Zhang and
Chia{-}Yuan Cheng and
Chih{-}Lung Lin and
Chun{-}Chieh Lee and
Kuo{-}Chin Fan},
title = {Develop a Lightweight Convolutional Neural Network to Recognize Palms
Using 3D Point Clouds},
journal = {Inf.},
volume = {14},
number = {7},
pages = {381},
year = {2023},
url = {https://doi.org/10.3390/info14070381},
doi = {10.3390/INFO14070381},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/ZhangCLLF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcal/WangCLLH23,
author = {Wei{-}Sheng Wang and
Yu{-}Ping Cheng and
Hsin{-}Yu Lee and
Chia{-}Ju Lin and
Yueh{-}Min Huang},
title = {Impact of anxiety and confidence in virtual reality-mediated learning
transferred to hands-on tasks},
journal = {J. Comput. Assist. Learn.},
volume = {39},
number = {4},
pages = {1368--1381},
year = {2023},
url = {https://doi.org/10.1111/jcal.12805},
doi = {10.1111/JCAL.12805},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcal/WangCLLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/GuanYCXZDCL23,
author = {Jiahui Guan and
Lantian Yao and
Chia{-}Ru Chung and
Peilin Xie and
Yilun Zhang and
Junyang Deng and
Ying{-}Chih Chiang and
Tzong{-}Yi Lee},
title = {Predicting Anti-inflammatory Peptides by Ensemble Machine Learning
and Deep Learning},
journal = {J. Chem. Inf. Model.},
volume = {63},
number = {24},
pages = {7886--7898},
year = {2023},
url = {https://doi.org/10.1021/acs.jcim.3c01602},
doi = {10.1021/ACS.JCIM.3C01602},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/GuanYCXZDCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/ChenLLTFLWC23,
author = {Yu{-}Hsuan Jamie Chen and
Chin{-}Sheng Lin and
Chin Lin and
Dung{-}Jang Tsai and
Wen{-}Hui Fang and
Chia{-}Cheng Lee and
Chih{-}Hung Wang and
Sy{-}Jou Chen},
title = {An AI-Enabled Dynamic Risk Stratification for Emergency Department
Patients with {ECG} and {CXR} Integration},
journal = {J. Medical Syst.},
volume = {47},
number = {1},
pages = {81},
year = {2023},
url = {https://doi.org/10.1007/s10916-023-01980-x},
doi = {10.1007/S10916-023-01980-X},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/ChenLLTFLWC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/ChenLLTSCL23,
author = {Wanshi Chen and
Xingqin Lin and
Juho Lee and
Antti Toskala and
Shu Sun and
Carla{-}Fabiana Chiasserini and
Lingjia Liu},
title = {Guest Editorial Special Issue on 3GPP Technologies: 5G-Advanced and
Beyond},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {41},
number = {6},
pages = {1587--1591},
year = {2023},
url = {https://doi.org/10.1109/JSAC.2023.3274048},
doi = {10.1109/JSAC.2023.3274048},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/ChenLLTSCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/ChenLLTSCL23a,
author = {Wanshi Chen and
Xingqin Lin and
Juho Lee and
Antti Toskala and
Shu Sun and
Carla{-}Fabiana Chiasserini and
Lingjia Liu},
title = {5G-Advanced Toward 6G: Past, Present, and Future},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {41},
number = {6},
pages = {1592--1619},
year = {2023},
url = {https://doi.org/10.1109/JSAC.2023.3274037},
doi = {10.1109/JSAC.2023.3274037},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/ChenLLTSCL23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiuCLCML23,
author = {Yao{-}Chia Liu and
Wei{-}Zen Chen and
Yuan{-}Sheng Lee and
Yu{-}Hsiang Chen and
Shawn Ming and
Ying{-}Hsi Lin},
title = {A 103 fJ/b/dB, 10-26 Gb/s Receiver With a Dual Feedback Nested Loop
{CDR} for Wide Bandwidth Jitter Tolerance Enhancement},
journal = {{IEEE} J. Solid State Circuits},
volume = {58},
number = {10},
pages = {2801--2811},
year = {2023},
url = {https://doi.org/10.1109/JSSC.2023.3278622},
doi = {10.1109/JSSC.2023.3278622},
timestamp = {Wed, 18 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiuCLCML23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/HsiaoKHMCWCKHL23,
author = {Shih{-}Ming Hsiao and
Mei{-}Chuan Kuo and
Pei{-}Ni Hsiao and
Sin{-}Hua Moi and
Yi{-}Wen Chiu and
Shu{-}Li Wang and
Tzu{-}Hui Chen and
Lan{-}Fang Kung and
Shang{-}Jyh Hwang and
Chia{-}Lun Lee},
title = {Shared decision-making for renal replacement treatment and illness
perception in patients with advanced chronic kidney disease},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {23},
number = {1},
pages = {159},
year = {2023},
url = {https://doi.org/10.1186/s12911-023-02261-w},
doi = {10.1186/S12911-023-02261-W},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/HsiaoKHMCWCKHL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ojcs/WuLWL23,
author = {Cheng{-}Yu Wu and
Yu{-}Kai Lin and
Chun{-}Kuan Wu and
Chia{-}Han Lee},
title = {Deep Learning-Based End-to-End Design for {OFDM} Systems With Hardware
Impairments},
journal = {{IEEE} Open J. Commun. Soc.},
volume = {4},
pages = {2468--2482},
year = {2023},
url = {https://doi.org/10.1109/OJCOMS.2023.3322989},
doi = {10.1109/OJCOMS.2023.3322989},
timestamp = {Thu, 09 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ojcs/WuLWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeCCCC23,
author = {Chi{-}Yuan Lee and
Chia{-}Hung Chen and
Hsian{-}Chun Chuang and
Shan{-}Yu Chen and
Yu{-}Chen Chiang},
title = {Flexible Seven-in-One Microsensor Embedded in High-Pressure Proton
Exchange Membrane Water Electrolyzer for Real-Time Microscopic Monitoring},
journal = {Sensors},
volume = {23},
number = {12},
pages = {5489},
year = {2023},
url = {https://doi.org/10.3390/s23125489},
doi = {10.3390/S23125489},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LeeCCCC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeCCHC23,
author = {Chi{-}Yuan Lee and
Chia{-}Hung Chen and
Hsian{-}Chun Chuang and
Hsiao{-}Te Hsieh and
Yen{-}Chen Chiu},
title = {Long-Acting Real-Time Microscopic Monitoring Inside the Proton Exchange
Membrane Water Electrolyzer},
journal = {Sensors},
volume = {23},
number = {12},
pages = {5595},
year = {2023},
url = {https://doi.org/10.3390/s23125595},
doi = {10.3390/S23125595},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LeeCCHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeJKCH23,
author = {Jeng{-}Dao Lee and
En{-}Shuo Jheng and
Chia{-}Chen Kuo and
Hong{-}Ming Chen and
Ying{-}Hsiu Hung},
title = {Novel Robotic Arm Working-Area {AI} Protection System},
journal = {Sensors},
volume = {23},
number = {5},
pages = {2765},
year = {2023},
url = {https://doi.org/10.3390/s23052765},
doi = {10.3390/S23052765},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/LeeJKCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeSCWLW23,
author = {Chi{-}Yuan Lee and
Jiann{-}Shing Shieh and
Jerry Chen and
Xin{-}Wen Wang and
Chen{-}Kai Liu and
Chia{-}Hsin Wei},
title = {The Application of a Self-Made Integrated Three-in-One Microsensor
and Commercially Available Wind Speed Sensor to the Cold Air Pipe
of the Heating, Ventilation, and Air Conditioning in a Factory for
Real-Time Wireless Measurement},
journal = {Sensors},
volume = {23},
number = {9},
pages = {4471},
year = {2023},
url = {https://doi.org/10.3390/s23094471},
doi = {10.3390/S23094471},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LeeSCWLW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LinLHHWLH23,
author = {Yi{-}Jia Lin and
Chia{-}Chien Lee and
Tzu{-}Wei Huang and
Wei{-}Chun Hsu and
Li{-}Wei Wu and
Chen{-}Chun Lin and
Hsin Hsiu},
title = {Using Arterial Pulse and Laser Doppler Analyses to Discriminate between
the Cardiovascular Effects of Different Running Levels},
journal = {Sensors},
volume = {23},
number = {8},
pages = {3855},
year = {2023},
url = {https://doi.org/10.3390/s23083855},
doi = {10.3390/S23083855},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LinLHHWLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sj/HuLL23,
author = {Chia{-}Chang Hu and
Wei{-}Chen Lin and
Chi{-}Jui Lee},
title = {Generalized Spatial Modulation Aided mmWave Massive {MIMO} Systems
With Switch-and-Inverter Hybrid Precoding Design},
journal = {{IEEE} Syst. J.},
volume = {17},
number = {1},
pages = {536--545},
year = {2023},
url = {https://doi.org/10.1109/JSYST.2022.3179867},
doi = {10.1109/JSYST.2022.3179867},
timestamp = {Sat, 11 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sj/HuLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/XieGHSLWLCZ23,
author = {Wangdong Xie and
Liangyu Gan and
Leilei Huang and
Chunqi Shi and
Boxiao Liu and
Chia{-}Hsin Wu and
Yueh{-}Ting Lee and
Jinghong Chen and
Runxi Zhang},
title = {A Real-Time Respiration Monitoring System Using WiFi Sensing Based
on the Concentric Circle Model},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {17},
number = {2},
pages = {157--168},
year = {2023},
url = {https://doi.org/10.1109/TBCAS.2022.3229435},
doi = {10.1109/TBCAS.2022.3229435},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/XieGHSLWLCZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/YangWCLHY23,
author = {Chung{-}Hsuan Yang and
Yi{-}Chung Wu and
Yen{-}Lung Chen and
Chao{-}Hsi Lee and
Jui{-}Hung Hung and
Chia{-}Hsiang Yang},
title = {An FM-Index Based High-Throughput Memory-Efficient {FPGA} Accelerator
for Paired-End Short-Read Mapping},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {17},
number = {6},
pages = {1331--1341},
year = {2023},
url = {https://doi.org/10.1109/TBCAS.2023.3293721},
doi = {10.1109/TBCAS.2023.3293721},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbcas/YangWCLHY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/YenCWCLKWC23,
author = {Chia{-}Heng Yen and
Chun{-}Teng Chen and
Cheng{-}Yen Wen and
Ying{-}Yen Chen and
Jih{-}Nung Lee and
Shu{-}Yi Kao and
Kai{-}Chiang Wu and
Mango Chia{-}Tso Chao},
title = {CNN-Based Stochastic Regression for {IDDQ} Outlier Identification},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {42},
number = {11},
pages = {4282--4295},
year = {2023},
url = {https://doi.org/10.1109/TCAD.2023.3253043},
doi = {10.1109/TCAD.2023.3253043},
timestamp = {Thu, 09 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcad/YenCWCLKWC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasII/ChunLRCMM23,
author = {Alexander Choo Chia Chun and
Yi Chen Lee and
Harikrishnan Ramiah and
Yong Chen and
Pui{-}In Mak and
Rui Paulo Martins},
title = {A High-PCE Range-Extension {CMOS} Rectifier Employing Advanced Topology
Amalgamation Technique for Ambient {RF} Energy Harvesting},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {70},
number = {10},
pages = {3747--3751},
year = {2023},
url = {https://doi.org/10.1109/TCSII.2023.3285977},
doi = {10.1109/TCSII.2023.3285977},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcasII/ChunLRCMM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/MorawskiLACC23,
author = {Igor Morawski and
Wen{-}Nung Lie and
Lee Aing and
Jui{-}Chiu Chiang and
Kuan{-}Ting Chen},
title = {Deep-Learning Technique for Risk-Based Action Prediction Using Extremely
Low-Resolution Thermopile Sensor Array},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {33},
number = {6},
pages = {2852--2863},
year = {2023},
url = {https://doi.org/10.1109/TCSVT.2022.3229059},
doi = {10.1109/TCSVT.2022.3229059},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcsv/MorawskiLACC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tem/ChungLWL23,
author = {Pi{-}Hui Chung and
Chia{-}Jung Lee and
Hsueh{-}Liang Wu and
Cheng{-}Yu Lee},
title = {Innovation Promoter or Inhibitor? Non-Family CEO's Effect on Innovation
in Family Businesses},
journal = {{IEEE} Trans. Engineering Management},
volume = {70},
number = {9},
pages = {3143--3155},
year = {2023},
url = {https://doi.org/10.1109/TEM.2021.3080115},
doi = {10.1109/TEM.2021.3080115},
timestamp = {Fri, 21 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tem/ChungLWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tem/LeeGC23,
author = {Hang Lee and
Ruey{-}Shan Guo and
Chialin Chen},
title = {E-Learning in the Postpandemic Era: {A} Case Study in Taiwan},
journal = {{IEEE} Trans. Engineering Management},
volume = {70},
number = {10},
pages = {3526--3538},
year = {2023},
url = {https://doi.org/10.1109/TEM.2021.3098605},
doi = {10.1109/TEM.2021.3098605},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tem/LeeGC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmlr/SrivastavaRRSAF23,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023},
url = {https://openreview.net/forum?id=uyTL5Bvosj},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmlr/SrivastavaRRSAF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/ChangLCL23,
author = {Chia{-}Ming Chang and
Yi{-}Jheng Lin and
Cheng{-}Shang Chang and
Duan{-}Shin Lee},
title = {On the Stability Regions of Coded Poisson Receivers With Multiple
Classes of Users and Receivers},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {31},
number = {1},
pages = {234--247},
year = {2023},
url = {https://doi.org/10.1109/TNET.2022.3188757},
doi = {10.1109/TNET.2022.3188757},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ton/ChangLCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/HsuLCH23,
author = {Pai{-}Hsiang Hsu and
Yueh{-}Ru Lee and
Chia{-}Hung Chen and
Chung{-}Chih Hung},
title = {A Low-Noise Area-Efficient Column-Parallel {ADC} With an Input Triplet
for a 120-dB High Dynamic Range {CMOS} Image Sensor},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {31},
number = {12},
pages = {1939--1949},
year = {2023},
url = {https://doi.org/10.1109/TVLSI.2023.3323363},
doi = {10.1109/TVLSI.2023.3323363},
timestamp = {Wed, 13 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/HsuLCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/uais/TsaiLTLH23,
author = {Chia{-}Wen Tsai and
Lan{-}Yu Lee and
Hui{-}Wen Tang and
Chih{-}Hsien Lin and
Lynne Cheng Hsu},
title = {Applying web-mediated co-curricular learning and phenomenon-based
learning to improve students' programming skills and self-efficacy
in an online programming course},
journal = {Univers. Access Inf. Soc.},
volume = {22},
number = {2},
pages = {555--568},
year = {2023},
url = {https://doi.org/10.1007/s10209-021-00860-w},
doi = {10.1007/S10209-021-00860-W},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/uais/TsaiLTLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vlsisp/ChenLL23,
author = {Kuan{-}Hsun Chen and
Yung{-}Chia Lin and
Jenq{-}Kuen Lee},
title = {Guest Editorial: Special Issue on Systems Optimizations for {DSP}
and {AI} Applications},
journal = {J. Signal Process. Syst.},
volume = {95},
number = {5},
pages = {569--570},
year = {2023},
url = {https://doi.org/10.1007/s11265-023-01854-y},
doi = {10.1007/S11265-023-01854-Y},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vlsisp/ChenLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/LeeMCW23,
author = {Hao{-}Wei Lee and
Abdelkader Medles and
Chun{-}Chia Chen and
Hung{-}Yu Wei},
title = {Feasibility and Opportunities of Terrestrial Network and Non-Terrestrial
Network Spectrum Sharing},
journal = {{IEEE} Wirel. Commun.},
volume = {30},
number = {6},
pages = {36--42},
year = {2023},
url = {https://doi.org/10.1109/MWC.001.2300209},
doi = {10.1109/MWC.001.2300209},
timestamp = {Wed, 03 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wc/LeeMCW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ChiangL23,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {Can Large Language Models Be an Alternative to Human Evaluations?},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {15607--15631},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.870},
doi = {10.18653/V1/2023.ACL-LONG.870},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ChiangL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ChiangL23a,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {Are Synonym Substitution Attacks Really Synonym Substitution Attacks?},
booktitle = {Findings of the Association for Computational Linguistics: {ACL} 2023,
Toronto, Canada, July 9-14, 2023},
pages = {1853--1878},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-acl.117},
doi = {10.18653/V1/2023.FINDINGS-ACL.117},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ChiangL23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/HsiaoTLLCLWLGL23,
author = {Hung{-}Chang Hsiao and
Chia{-}Ping Tsai and
Zheng{-}Xian Li and
Chao{-}Heng Lee and
Jia{-}Sheng Chen and
Yu{-}Chen Lai and
Jia{-}Chi Wang and
Shao{-}Chi Li and
Jhih{-}Cyuan Gao and
Yi{-}Huan Lee},
editor = {Jingrui He and
Themis Palpanas and
Xiaohua Hu and
Alfredo Cuzzocrea and
Dejing Dou and
Dominik Slezak and
Wei Wang and
Aleksandra Gruca and
Jerry Chun{-}Wei Lin and
Rakesh Agrawal},
title = {Load Balancing Algorithms and Their Impacts on Apache Kafka},
booktitle = {{IEEE} International Conference on Big Data, BigData 2023, Sorrento,
Italy, December 15-18, 2023},
pages = {1726--1735},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/BigData59044.2023.10386734},
doi = {10.1109/BIGDATA59044.2023.10386734},
timestamp = {Tue, 20 Aug 2024 07:54:43 +0200},
biburl = {https://dblp.org/rec/conf/bigdataconf/HsiaoTLLCLWLGL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/HsuCLCL23,
author = {Chia Hung Hsu and
Yu Chen and
Yu{-}Jung Liu and
Yu Cheng Chang and
Min{-}Jui Lee},
editor = {Albrecht Schmidt and
Kaisa V{\"{a}}{\"{a}}n{\"{a}}nen and
Tesh Goyal and
Per Ola Kristensson and
Anicia Peters},
title = {Spelland: Situated Language Learning with a Mixed-Reality Spelling
Game through Everyday Objects},
booktitle = {Extended Abstracts of the 2023 {CHI} Conference on Human Factors in
Computing Systems, {CHI} {EA} 2023, Hamburg, Germany, April 23-28,
2023},
pages = {597:1--597:6},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3544549.3583830},
doi = {10.1145/3544549.3583830},
timestamp = {Mon, 24 Apr 2023 09:50:16 +0200},
biburl = {https://dblp.org/rec/conf/chi/HsuCLCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cloudcom/LiWL23,
author = {Chia{-}Chang Li and
Po{-}Cheng Wu and
Che{-}Rung Lee},
title = {{GSLAC:} {GPU} Software Level Access Control for Information Isolation
on Cloud Platforms},
booktitle = {{IEEE} International Conference on Cloud Computing Technology and
Science, CloudCom 2023, Naples, Italy, December 4-6, 2023},
pages = {34--41},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CloudCom59040.2023.00019},
doi = {10.1109/CLOUDCOM59040.2023.00019},
timestamp = {Thu, 11 Apr 2024 16:38:29 +0200},
biburl = {https://dblp.org/rec/conf/cloudcom/LiWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/CondeZTMLZPLGZCLHYZLSKBPDTABLZFSSLGLYX23,
author = {Marcos V. Conde and
Eduard Zamfir and
Radu Timofte and
Daniel Motilla and
Cen Liu and
Zexin Zhang and
Yunbo Peng and
Yue Lin and
Jiaming Guo and
Xueyi Zou and
Yuyi Chen and
Yi Liu and
Jia Hao and
Youliang Yan and
Yuanfan Zhang and
Gen Li and
Lei Sun and
Lingshun Kong and
Haoran Bai and
Jinshan Pan and
Jiangxin Dong and
Jinhui Tang and
Mustafa Ayazoglu and
Bahri Batuhan Bilecen and
Mingxi Li and
Yuhang Zhang and
Xianjun Fan and
Yankai Sheng and
Long Sun and
Zibin Liu and
Weiran Gou and
Shaoqing Li and
Ziyao Yi and
Yan Xiang and
Dehui Kong and
Ke Xu and
Ganzorig Gankhuyag and
Kihwan Yoon and
Jin Zhang and
Gaocheng Yu and
Feng Zhang and
Hongbin Wang and
Zhou Zhou and
Jiahao Chao and
Hongfan Gao and
Jiali Gong and
Zhengfeng Yang and
Zhenbing Zeng and
Chengpeng Chen and
Zichao Guo and
Anjin Park and
Yuqing Liu and
Qi Jia and
Hongyuan Yu and
Xuanwu Yin and
Dongyang Zhang and
Ting Fu and
Zhengxue Cheng and
Shiai Zhu and
Dajiang Zhou and
Weichen Yu and
Lin Ge and
Jiahua Dong and
Yajun Zou and
Zhuoyuan Wu and
Binnan Han and
Xiaolin Zhang and
Heng Zhang and
Ben Shao and
Shaolong Zheng and
Daheng Yin and
Baijun Chen and
Mengyang Liu and
Marian{-}Sergiu Nistor and
Yi{-}Chung Chen and
Zhi{-}Kai Huang and
Yuan{-}Chun Chiang and
Wei{-}Ting Chen and
Hao{-}Hsiang Yang and
Hua{-}En Chang and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Tu Vo and
Qingsen Yan and
Yun Zhu and
Jinqiu Su and
Yanning Zhang and
Cheng Zhang and
Jiaying Luo and
Youngsun Cho and
Nakyung Lee and
Kunlong Zuo},
title = {Efficient Deep Models for Real-Time 4K Image Super-Resolution. {NTIRE}
2023 Benchmark and Report},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1495--1521},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00154},
doi = {10.1109/CVPRW59228.2023.00154},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/CondeZTMLZPLGZCLHYZLSKBPDTABLZFSSLGLYX23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ShutovaEPEBTCETZRBBSLWWLFSWWLXZWGSLDKO23,
author = {Alina Shutova and
Egor I. Ershov and
Georgy Perevozchikov and
Ivan Ermakov and
Nikola Banic and
Radu Timofte and
Richard Collins and
Maria Efimova and
Arseniy P. Terekhin and
Simone Zini and
Claudio Rota and
Marco Buzzelli and
Simone Bianco and
Raimondo Schettini and
Chunxia Lei and
Tingniao Wang and
Song Wang and
Shuai Liu and
Chaoyu Feng and
Guangqi Shao and
Hao Wang and
Xiaotao Wang and
Lei Lei and
Lu Xu and
Chao Zhang and
Yasi Wang and
Jin Guo and
Yangfan Sun and
Tianli Liu and
Hao Dejun and
Furkan Kinli and
Baris {\"{O}}zcan and
Furkan Kira{\c{c}} and
Hyerin Chung and
Nakyung Lee and
Sungkeun Kwak and
Marcos V. Conde and
Tim Seizinger and
Florin{-}Alexandru Vasluianu and
Omar Elezabi and
Chia{-}Hsuan Hsieh and
Wei{-}Ting Chen and
Hao{-}Hsiang Yang and
Zhi{-}Kai Huang and
Hua{-}En Chang and
I{-}Hsiang Chen and
Yi{-}Chung Chen and
Yuan{-}Chun Chiang},
title = {{NTIRE} 2023 Challenge on Night Photography Rendering},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1982--1993},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00192},
doi = {10.1109/CVPRW59228.2023.00192},
timestamp = {Wed, 31 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ShutovaEPEBTCETZRBBSLWWLFSWWLXZWGSLDKO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/VasluianuSTCHTFZZWWLGZSSDZLLYOLRLJHWLY23,
author = {Florin{-}Alexandru Vasluianu and
Tim Seizinger and
Radu Timofte and
Shuhao Cui and
Junshi Huang and
Shuman Tian and
Mingyuan Fan and
Jiaqi Zhang and
Li Zhu and
Xiaoming Wei and
Xiaolin Wei and
Ziwei Luo and
Fredrik K. Gustafsson and
Zheng Zhao and
Jens Sj{\"{o}}lund and
Thomas B. Sch{\"{o}}n and
Xiaoyi Dong and
Xi Sheryl Zhang and
Chenghua Li and
Cong Leng and
Woon{-}Ha Yeo and
Wang{-}Taek Oh and
Yeoreum Lee and
Han{-}Cheol Ryu and
Jinting Luo and
Chengzhi Jiang and
Mingyan Han and
Qi Wu and
Wenjie Lin and
Lei Yu and
Xinpeng Li and
Ting Jiang and
Haoqiang Fan and
Shuaicheng Liu and
Shuning Xu and
Binbin Song and
Xiangyu Chen and
Shile Zhang and
Jiantao Zhou and
Zhao Zhang and
Suiyi Zhao and
Huan Zheng and
Yangcheng Gao and
Yanyan Wei and
Bo Wang and
Jiahuan Ren and
Yan Luo and
Yuki Kondo and
Riku Miyata and
Fuma Yasue and
Taito Naruki and
Norimichi Ukita and
Hua{-}En Chang and
Hao{-}Hsiang Yang and
Yi{-}Chung Chen and
Yuan{-}Chun Chiang and
Zhi{-}Kai Huang and
Wei{-}Ting Chen and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Li Xianwei and
Huiyuan Fu and
Chunlin Liu and
Huadong Ma and
Binglan Fu and
Huiming He and
Mengjia Wang and
Wenxuan She and
Yu Liu and
Sabari Nathan and
Priya Kansal and
Zhongjian Zhang and
Huabin Yang and
Yan Wang and
Yanru Zhang and
Shruti S. Phutke and
Ashutosh Kulkarni and
Md Raqib Khan and
Subrahmanyam Murala and
Santosh Kumar Vipparthi and
Heng Ye and
Zixi Liu and
Xingyi Yang and
Songhua Liu and
Yinwei Wu and
Yongcheng Jing and
Qianhao Yu and
Naishan Zheng and
Jie Huang and
Yuhang Long and
Mingde Yao and
Feng Zhao and
Bowen Zhao and
Nan Ye and
Ning Shen and
Yanpeng Cao and
Tong Xiong and
Weiran Xia and
Dingwen Li and
Shuchen Xia},
title = {{NTIRE} 2023 Image Shadow Removal Challenge Report},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1788--1807},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00179},
doi = {10.1109/CVPRW59228.2023.00179},
timestamp = {Mon, 26 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/VasluianuSTCHTFZZWWLGZSSDZLLYOLRLJHWLY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YaoTLTCL23,
author = {Jie{-}En Yao and
Li{-}Yuan Tsao and
Yi{-}Chen Lo and
Roy Tseng and
Chia{-}Che Chang and
Chun{-}Yi Lee},
title = {Local Implicit Normalizing Flow for Arbitrary-Scale Image Super-Resolution},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1776--1785},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPR52729.2023.00177},
doi = {10.1109/CVPR52729.2023.00177},
timestamp = {Mon, 28 Aug 2023 16:14:07 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/YaoTLTCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZhangZCLTZZPMJHZAHQZLLZZLWLKKKYLLLCCHC23,
author = {Yulun Zhang and
Kai Zhang and
Zheng Chen and
Yawei Li and
Radu Timofte and
Junpei Zhang and
Kexin Zhang and
Rui Peng and
Yanbiao Ma and
Licheng Jia and
Huaibo Huang and
Xiaoqiang Zhou and
Yuang Ai and
Ran He and
Yajun Qiu and
Qiang Zhu and
Pengfei Li and
Qianhui Li and
Shuyuan Zhu and
Dafeng Zhang and
Jia Li and
Fan Wang and
Chunmiao Li and
TaeHyung Kim and
Jungkeong Kil and
Eon Kim and
Yeonseung Yu and
Beomyeol Lee and
Subin Lee and
Seokjae Lim and
Somi Chae and
Heungjun Choi and
Zhi{-}Kai Huang and
YiChung Chen and
Yuan{-}Chun Chiang and
Hao{-}Hsiang Yang and
Wei{-}Ting Chen and
Hua{-}En Chang and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Ui{-}Jin Choi and
Marcos V. Conde and
Sunder Ali Khowaja and
Jiseok Yoon and
Ik Hyun Lee and
Garas Gendy and
Nabil Sabor and
Jingchao Hou and
Guanghui He and
Zhao Zhang and
Baiang Li and
Huan Zheng and
Suiyi Zhao and
Yangcheng Gao and
Yanyan Wei and
Jiahuan Ren and
Jiayu Wei and
Yanfeng Li and
Jia Sun and
Zhanyi Cheng and
Zhiyuan Li and
Xu Yao and
Xinyi Wang and
Danxu Li and
Xuan Cui and
Jun Cao and
Cheng Li and
Jianbin Zheng and
Anjali Sarvaiya and
Kalpesh Prajapati and
Ratnadeep Patra and
Pragnesh Barik and
Chaitanya Rathod and
Kishor P. Upla and
Kiran B. Raja and
Raghavendra Ramachandra and
Christoph Busch},
title = {{NTIRE} 2023 Challenge on Image Super-Resolution ({\texttimes}4):
Methods and Results},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1865--1884},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00185},
doi = {10.1109/CVPRW59228.2023.00185},
timestamp = {Fri, 06 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ZhangZCLTZZPMJHZAHQZLLZZLWLKKKYLLLCCHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ChiangL23,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {A Closer Look into Using Large Language Models for Automatic Evaluation},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {8928--8942},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.599},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.599},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ChiangL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/essderc/LinHKCLHWMTLCWR23,
author = {W.{-}C. Lin and
H.{-}P. Huang and
Kuo{-}Hsing Kao and
Meng{-}Hsueh Chiang and
Darsen D. Lu and
Wei{-}Chou Hsu and
Yeong{-}Her Wang and
William Cheng{-}Yu Ma and
Hann{-}Huei Tsai and
Y.{-}J. Lee and
H.{-}L. Chiang and
J.{-}F. Wang and
Iuliana P. Radu},
title = {{MOSFET} Characterization with Reduced Supply Voltage at Low Temperatures
for Power Efficiency Maximization},
booktitle = {53rd {IEEE} European Solid-State Device Research Conference, {ESSDERC}
2023, Lisbon, Portugal, September 11-14, 2023},
pages = {9--12},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ESSDERC59256.2023.10268514},
doi = {10.1109/ESSDERC59256.2023.10268514},
timestamp = {Fri, 01 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/essderc/LinHKCLHWMTLCWR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcaiot/ChangLCW23,
author = {Ray{-}I Chang and
Cheng{-}Yen Lee and
Po{-}Wei Chen and
Chia{-}Hui Wang},
title = {Machine Learning of k-Anonymity Data by using Feature Importance and
Margin Preservation},
booktitle = {{IEEE} Global Conference on Artificial Intelligence and Internet of
Things, GCAIoT 2023, Dubai, United Arab Emirates, December 10-11,
2023},
pages = {91--96},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/GCAIoT61060.2023.10385127},
doi = {10.1109/GCAIOT61060.2023.10385127},
timestamp = {Fri, 09 Feb 2024 20:38:48 +0100},
biburl = {https://dblp.org/rec/conf/gcaiot/ChangLCW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/ChenSLSLS23,
author = {Jerry Chen and
Jiann{-}Shing Shieh and
Chi{-}Yuan Lee and
Chuan{-}Jun Su and
Yun{-}Chia Liang and
Tien{-}Lung Sun},
editor = {Constantine Stephanidis and
Margherita Antona and
Stavroula Ntoa and
Gavriel Salvendy},
title = {Autonomous System with Cyber-Physical Integrating Features on Public
Utility of Chemical Fiber Factory},
booktitle = {{HCI} International 2023 Posters - 25th International Conference on
Human-Computer Interaction, {HCII} 2023, Copenhagen, Denmark, July
23-28, 2023, Proceedings, Part {IV}},
series = {Communications in Computer and Information Science},
volume = {1835},
pages = {454--460},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-36001-5\_58},
doi = {10.1007/978-3-031-36001-5\_58},
timestamp = {Sun, 12 Nov 2023 02:12:38 +0100},
biburl = {https://dblp.org/rec/conf/hci/ChenSLSLS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/WangLLHYC23,
author = {Jen{-}Hang Wang and
Mahesh Liyanawatta and
Chia{-}Ying Lee and
Yu{-}Ling Huang and
Su{-}Hang Yang and
Gwo{-}Dong Chen},
editor = {Maiga Chang and
Nian{-}Shing Chen and
Rita Kuo and
George Rudolph and
Demetrios G. Sampson and
Ahmed Tlili},
title = {Embodied Learning Through Drama-Based Situatedness Using Immersive
Technology in the Classroom},
booktitle = {{IEEE} International Conference on Advanced Learning Technologies,
{ICALT} 2023, Orem, UT, USA, July 10-13, 2023},
pages = {274--276},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICALT58122.2023.00086},
doi = {10.1109/ICALT58122.2023.00086},
timestamp = {Wed, 11 Oct 2023 10:11:29 +0200},
biburl = {https://dblp.org/rec/conf/icalt/WangLLHYC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/HuangCCTL23,
author = {Sung{-}Feng Huang and
Chia{-}Ping Chen and
Zhi{-}Sheng Chen and
Yu{-}Pao Tsai and
Hung{-}Yi Lee},
title = {Personalized Lightweight Text-to-Speech: Voice Cloning with Adaptive
Structured Pruning},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing
{ICASSP} 2023, Rhodes Island, Greece, June 4-10, 2023},
pages = {1--5},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICASSP49357.2023.10097178},
doi = {10.1109/ICASSP49357.2023.10097178},
timestamp = {Sun, 05 Nov 2023 16:51:21 +0100},
biburl = {https://dblp.org/rec/conf/icassp/HuangCCTL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icawst/LeeCLSH23,
author = {Shu{-}Hung Lee and
Chia{-}Hsing Cheng and
Kuan{-}Hsien Lu and
Yeong{-}Long Shiue and
Yung{-}Fa Huang},
title = {A {K-NN} based Area Positioning System in Wireless Sensor Networks},
booktitle = {12th International Conference on Awareness Science and Technology,
iCAST 2023, Taichung, Taiwan, November 9-11, 2023},
pages = {46--49},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/iCAST57874.2023.10359293},
doi = {10.1109/ICAST57874.2023.10359293},
timestamp = {Mon, 22 Jan 2024 20:34:12 +0100},
biburl = {https://dblp.org/rec/conf/icawst/LeeCLSH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icccm/FengTHHLH23,
author = {Chung{-}Shun Feng and
Chia{-}Wen Tsai and
Tsu{-}Wu Hu and
Ming{-}Yu Hsiao and
Yann{-}Long Lee and
Yu{-}Che Huang},
title = {Research on User Experience and Cognitive Psychology Evaluation of
Augmented Reality facial effects in Meta Spark, Line, and Snapchat
Apps},
booktitle = {Proceedings of the 2023 11th International Conference on Computer
and Communications Management, {ICCCM} 2023, Nagoya, Japan, August
4-6, 2023},
pages = {83--89},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3617733.3617747},
doi = {10.1145/3617733.3617747},
timestamp = {Thu, 09 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icccm/FengTHHLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/ChiangCL23,
author = {Wei{-}Cheng Chiang and
Hsien{-}Sung Chiu and
Jin{-}Shyan Lee},
title = {Road Damage Detection Using Deep Learning and Cloud Platforms},
booktitle = {International Conference on Consumer Electronics - Taiwan, ICCE-Taiwan
2023, PingTung, Taiwan, July 17-19, 2023},
pages = {859--860},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCE-Taiwan58799.2023.10226984},
doi = {10.1109/ICCE-TAIWAN58799.2023.10226984},
timestamp = {Fri, 08 Sep 2023 15:28:17 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/ChiangCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/TzengHLS23,
author = {Jian{-}Wei Tzeng and
Cheng{-}Yu Hsueh and
Chia{-}An Lee and
Wei{-}Yun Shih},
title = {Identifying the Correlation Between Online Exam Answer Trajectory
and Test Behavior Based on Artificial Intelligence and Eye Movement
Detection Technology},
booktitle = {International Conference on Consumer Electronics - Taiwan, ICCE-Taiwan
2023, PingTung, Taiwan, July 17-19, 2023},
pages = {503--504},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCE-Taiwan58799.2023.10226745},
doi = {10.1109/ICCE-TAIWAN58799.2023.10226745},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/TzengHLS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/TsaiLBXS23,
author = {Chi{-}An Tsai and
Pei{-}Jun Lee and
Trong{-}An Bui and
Guo{-}Cheng Xu and
Meng{-}Lieh Sheu},
title = {Moving Object Detection for Remote Sensing Video with Satellite Jitter},
booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2023,
Las Vegas, NV, USA, January 6-8, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCE56470.2023.10043483},
doi = {10.1109/ICCE56470.2023.10043483},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccel/TsaiLBXS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icemt/LeeWCCY23,
author = {Huang{-}Liang Lee and
Jung{-}Hua Wu and
Yu{-}Chen Chien and
Chia{-}Yun Chung and
Wei{-}Chieh Yeh},
title = {Research on the Location Selection of Healing Parks - {A} Case Research
of Nantun District, Taichung City, Taiwan},
booktitle = {Proceedings of the 7th International Conference on Education and Multimedia
Technology, {ICEMT} 2023, Tokyo, Japan, August 29-31, 2023},
pages = {391--396},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3625704.3625739},
doi = {10.1145/3625704.3625739},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icemt/LeeWCCY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmhi/IzgudenEBKLPCSB23,
author = {Dilruba Izguden and
Ramazan Erdem and
Sedat Bostan and
Hao{-}Yun Kao and
Yen{-}Chiao Angel Lu and
Bolormaa Purevdorj and
Chalong Cheewakriangkrai and
Kaung Myat Shwe and
Jargalsaikhan Badarch and
Chiu{-}Hsiang Lee and
Chi{-}Chang Chang},
title = {Attitudes towards the Covid-19 Vaccine among Healthcare Workers in
Asia: {A} Cross-Sectional Multi-Country Comparison},
booktitle = {The 7th International Conference on Medical and Health Informatics,
{ICMHI} 2023, Kyoto, Japan, May 12-14, 2023},
pages = {365--371},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3608298.3608366},
doi = {10.1145/3608298.3608366},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmhi/IzgudenEBKLPCSB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsse/LeeSCC23,
author = {Ya{-}Ting Lee and
Chao{-}Hung Sun and
Chian{-}Song Chiu and
Yu{-}Ting Chen},
title = {Design of {A} Hand Back Acupoint Massage Aid},
booktitle = {International Conference on System Science and Engineering, {ICSSE}
2023, Ho Chi Minh, Vietnam, July 27-28, 2023},
pages = {508--513},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICSSE58758.2023.10227180},
doi = {10.1109/ICSSE58758.2023.10227180},
timestamp = {Fri, 08 Sep 2023 15:28:11 +0200},
biburl = {https://dblp.org/rec/conf/icsse/LeeSCC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imis/Lee0LH23,
author = {Shu{-}Hung Lee and
Chia{-}Hsin Cheng and
Chien{-}Chih Lin and
Yung{-}Fa Huang},
editor = {Leonard Barolli},
title = {Applications of Artificial Fish Swarm Algorithms for Indoor Positioning
and Target Tracking},
booktitle = {Innovative Mobile and Internet Services in Ubiquitous Computing -
Proceedings of the 17th International Conference on Innovative Mobile
and Internet Services in Ubiquitous Computing (IMIS-2023), Toronto,
ON, Canada, 5-7 July 2023},
series = {Lecture Notes on Data Engineering and Communications Technologies},
volume = {177},
pages = {229--239},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-35836-4\_25},
doi = {10.1007/978-3-031-35836-4\_25},
timestamp = {Tue, 20 Jun 2023 15:24:35 +0200},
biburl = {https://dblp.org/rec/conf/imis/Lee0LH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ChiangHL23,
author = {Cheng{-}Han Chiang and
Wei{-}Ping Huang and
Hung{-}yi Lee},
editor = {Naomi Harte and
Julie Carson{-}Berndsen and
Gareth Jones},
title = {Why We Should Report the Details in Subjective Evaluation of {TTS}
More Rigorously},
booktitle = {24th Annual Conference of the International Speech Communication Association,
Interspeech 2023, Dublin, Ireland, August 20-24, 2023},
pages = {5551--5555},
publisher = {{ISCA}},
year = {2023},
url = {https://doi.org/10.21437/Interspeech.2023-416},
doi = {10.21437/INTERSPEECH.2023-416},
timestamp = {Fri, 14 Jun 2024 14:12:12 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/ChiangHL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ShihTHLL23,
author = {Huang{-}Chia Shih and
Shih{-}Kai Tai and
Cheng{-}You Hu and
Wei{-}Syuan Lee and
Hsuan{-}Yu Liu},
title = {PhotoSaver: Group Photographing Guidance System Using Multi-Task Cascaded
Convolutional Networks},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2023,
Monterey, CA, USA, May 21-25, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISCAS46773.2023.10181414},
doi = {10.1109/ISCAS46773.2023.10181414},
timestamp = {Mon, 31 Jul 2023 09:04:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ShihTHLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChenYWLCLCLCHY23,
author = {Yen{-}Lung Chen and
Chung{-}Hsuan Yang and
Yi{-}Chung Wu and
Chao{-}Hsi Lee and
Wen{-}Ching Chen and
Liang{-}Yi Lin and
Nian{-}Shyang Chang and
Chun{-}Pin Lin and
Chi{-}Shi Chen and
Jui{-}Hung Hung and
Chia{-}Hsiang Yang},
title = {A Fully Integrated End-to-End Genome Analysis Accelerator for Next-Generation
Sequencing},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {44--45},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067532},
doi = {10.1109/ISSCC42615.2023.10067532},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChenYWLCLCLCHY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HsiehWXLTCYCLLLLLCK23,
author = {Sung{-}En Hsieh and
Chun{-}Hao Wei and
Cheng{-}Xin Xue and
Hung{-}Wei Lin and
Wei{-}Hsuan Tu and
En{-}Jui Chang and
Kai{-}Taing Yang and
Po{-}Heng Chen and
Wei{-}Nan Liao and
Li Lian Low and
Chia{-}Da Lee and
Allen{-}Cl Lu and
Jenwei Liang and
Chih{-}Chung Cheng and
Tzung{-}Hung Kang},
title = {A 70.85-86.27TOPS/W PVT-Insensitive 8b Word-Wise {ACIM} with Post-Processing
Relaxation},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {136--137},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067335},
doi = {10.1109/ISSCC42615.2023.10067335},
timestamp = {Fri, 28 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HsiehWXLTCYCLLLLLCK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LeeLSLCLCLCKCWWWCWCC23,
author = {Po{-}Hao Lee and
Chia{-}Fu Lee and
Yi{-}Chun Shih and
Hon{-}Jarn Lin and
Yen{-}An Chang and
Cheng{-}Han Lu and
Yu{-}Lin Chen and
Chieh{-}Pu Lo and
Chung{-}Chieh Chen and
Cheng{-}Hsiung Kuo and
Tan{-}Li Chou and
Chia{-}Yu Wang and
J. J. Wu and
Roger Wang and
Harry Chuang and
Yih Wang and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang},
title = {A 16nm 32Mb Embedded {STT-MRAM} with a 6ns Read-Access Time, a 1M-Cycle
Write Endurance, 20-Year Retention at 150{\textdegree}C and {MTJ-OTP}
Solutions for Magnetic Immunity},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {494--495},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067837},
doi = {10.1109/ISSCC42615.2023.10067837},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/LeeLSLCLCLCKCWWWCWCC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/MoriZLLHCHTLWACFWCCLC23,
author = {Haruki Mori and
Wei{-}Chang Zhao and
Cheng{-}En Lee and
Chia{-}Fu Lee and
Yu{-}Hao Hsu and
Chao{-}Kai Chuang and
Takeshi Hashizume and
Hao{-}Chun Tung and
Yao{-}Yi Liu and
Shin{-}Rung Wu and
Kerem Akarvardar and
Tan{-}Li Chou and
Hidehiro Fujiwara and
Yih Wang and
Yu{-}Der Chih and
Yen{-}Huei Chen and
Hung{-}Jen Liao and
Tsung{-}Yung Jonathan Chang},
title = {A 4nm 6163-TOPS/W/b {\textdollar}{\textbackslash}mathbf\{4790-TOPS/mm\{2\}/b\}{\textdollar}
{SRAM} Based Digital-Computing-in-Memory Macro Supporting Bit-Width
Flexibility and Simultaneous {MAC} and Weight Update},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {132--133},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067555},
doi = {10.1109/ISSCC42615.2023.10067555},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/MoriZLLHCHTLWACFWCCLC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ParkACENGLKLKRSACZWTCPHA23,
author = {Henry Park and
Mohammed Abdullatif and
Ehung Chen and
Ahmed Elmallah and
Qaiser Nehal and
Miguel Gandara and
Tsz{-}Bin Liu and
Amr Khashaba and
Joonyeong Lee and
Chih{-}Yi Kuan and
Dhinessh Ramachandran and
Ruey{-}Bo Sun and
Atharav Atharav and
Yusang Chun and
Mantian Zhang and
Deng{-}Fu Weng and
Chung{-}Hsien Tsai and
Chen{-}Hao Chang and
Chia{-}Sheng Peng and
Sheng{-}Tsung Hsu and
Tamer A. Ali},
title = {A 4.63pJ/b 112Gb/s DSP-Based {PAM-4} Transceiver for a Large-Scale
Switch in 5nm FinFET},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {110--111},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067613},
doi = {10.1109/ISSCC42615.2023.10067613},
timestamp = {Wed, 29 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ParkACENGLKLKRSACZWTCPHA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iv/ChenHCLW23,
author = {Kuan{-}Chen Chen and
Chung{-}Chian Hsu and
Teng{-}Wen Chang and
Chang{-}Franw Lee and
Cheng{-}Gang Wang},
editor = {Ebad Banissi and
Harri Siirtola and
Anna Ursyn and
Jo{\~{a}}o Moura Pires and
Nuno Datia and
Kawa Nazemi and
Boris Kovalerchuk and
Razvan Andonie and
Minoru Nakayama and
Marco Temperini and
Filippo Sciarrone and
Quang Vinh Nguyen and
Mabule Samuel Mabakane and
Adrian Rusu and
Urska Cvek and
Marjan Trutschl and
Heimo M{\"{u}}ller and
Rita Francese and
Fatma Bouali and
Gilles Venturini},
title = {Relational Structure Visualization in Composition},
booktitle = {27th International Conference Information Visualisation, {IV} 2023,
Tampere, Finland, July 25-28, 2023},
pages = {23--28},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IV60283.2023.00015},
doi = {10.1109/IV60283.2023.00015},
timestamp = {Fri, 17 Nov 2023 08:57:24 +0100},
biburl = {https://dblp.org/rec/conf/iv/ChenHCLW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mva/HouSHHHXWL23,
author = {Hao{-}Yu Hou and
Mu{-}Yi Shen and
Chia{-}Chi Hsu and
En{-}Ming Huang and
Yu{-}Chen Huang and
Yu{-}Cheng Xia and
Chien{-}Yao Wang and
Chun{-}Yi Lee},
title = {Ensemble Fusion for Small Object Detection},
booktitle = {18th International Conference on Machine Vision and Applications,
{MVA} 2023, Hamamatsu, Japan, July 23-25, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/MVA57639.2023.10215748},
doi = {10.23919/MVA57639.2023.10215748},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mva/HouSHHHXWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mva/KondoUYHSHHHXWLHKLKHKISLLY23,
author = {Yuki Kondo and
Norimichi Ukita and
Takayuki Yamaguchi and
Hao{-}Yu Hou and
Mu{-}Yi Shen and
Chia{-}Chi Hsu and
En{-}Ming Huang and
Yu{-}Chen Huang and
Yu{-}Cheng Xia and
Chien{-}Yao Wang and
Chun{-}Yi Lee and
Da Huo and
Marc A. Kastner and
Tingwei Liu and
Yasutomo Kawanishi and
Takatsugu Hirayama and
Takahiro Komamizu and
Ichiro Ide and
Yosuke Shinya and
Xinyao Liu and
Guang Liang and
Syusuke Yasui},
title = {{MVA2023} Small Object Detection Challenge for Spotting Birds: Dataset,
Methods, and Results},
booktitle = {18th International Conference on Machine Vision and Applications,
{MVA} 2023, Hamamatsu, Japan, July 23-25, 2023},
pages = {1--11},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/MVA57639.2023.10215935},
doi = {10.23919/MVA57639.2023.10215935},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mva/KondoUYHSHHHXWLHKLKHKISLLY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ram/DingKHAKR23,
author = {Tan Jian Ding and
Chia Chao Kang and
Wang Han and
Mohammadmahdi Ariannejad and
Lee Yan Kang and
Cheng Khai Ren},
title = {Advancements and Challenges of Information Integration in Swarm Robotics},
booktitle = {{IEEE} International Conference on Cybernetics and Intelligent Systems,
{CIS} 2023 and {IEEE} Conference on Robotics, Automation and Mechatronics,
{RAM} 2023, Penang, Malaysia, June 9-12, 2023},
pages = {89--95},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CIS-RAM55796.2023.10370011},
doi = {10.1109/CIS-RAM55796.2023.10370011},
timestamp = {Tue, 16 Jan 2024 21:01:23 +0100},
biburl = {https://dblp.org/rec/conf/ram/DingKHAKR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ram/DingKHAKR23a,
author = {Tan Jian Ding and
Chia Chao Kang and
Wang Han and
Mohammadmahdi Ariannejad and
Lee Yan Kang and
Cheng Khai Ren},
title = {Development Trend of Robotic Exoskeletons},
booktitle = {{IEEE} International Conference on Cybernetics and Intelligent Systems,
{CIS} 2023 and {IEEE} Conference on Robotics, Automation and Mechatronics,
{RAM} 2023, Penang, Malaysia, June 9-12, 2023},
pages = {114--121},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CIS-RAM55796.2023.10370016},
doi = {10.1109/CIS-RAM55796.2023.10370016},
timestamp = {Tue, 16 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ram/DingKHAKR23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rep4nlp/ChiangLCG23,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee and
Yung{-}Sung Chuang and
James R. Glass},
editor = {Burcu Can and
Maximilian Mozes and
Samuel Cahyawijaya and
Naomi Saphra and
Nora Kassner and
Shauli Ravfogel and
Abhilasha Ravichander and
Chen Zhao and
Isabelle Augenstein and
Anna Rogers and
Kyunghyun Cho and
Edward Grefenstette and
Lena Voita},
title = {Revealing the Blind Spot of Sentence Encoder Evaluation by {HEROS}},
booktitle = {Proceedings of the 8th Workshop on Representation Learning for NLP,
RepL4NLP@ACL 2023, Toronto, Canada, July 13, 2023},
pages = {289--302},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.repl4nlp-1.24},
doi = {10.18653/V1/2023.REPL4NLP-1.24},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rep4nlp/ChiangLCG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smartcloud/LawTFWCCLLL23,
author = {Po Ying Law and
Chia{-}Cheng Tsai and
Tsz Wun Fok and
Ching{-}Ting Wang and
Chi{-}Hsien Chang and
Tsung{-}Yu Chin and
Yi{-}Chen Liao and
Jen{-}Kuang Lee and
Chung{-}Wei Lin},
title = {Secure Medical Data Management Based on Homomorphic Encryption and
Secret Sharing},
booktitle = {8th {IEEE} International Conference on Smart Cloud, SmartCloud 2023,
Tokyo, Japan, September 16-18, 2023},
pages = {95--98},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SmartCloud58862.2023.00025},
doi = {10.1109/SMARTCLOUD58862.2023.00025},
timestamp = {Mon, 29 Jan 2024 10:01:33 +0100},
biburl = {https://dblp.org/rec/conf/smartcloud/LawTFWCCLLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/ChangXDJLCLLKJG23,
author = {En{-}Jui Chang and
Cheng{-}Xin Xue and
Chetan Deshpande and
Gajanan Jedhe and
Jenwei Liang and
Chih{-}Chung Cheng and
Hung{-}Wei Lin and
Chia{-}Da Lee and
Sushil Kumar and
Kim Soon Jway and
Zijie Guo and
Ritesh Garg and
Allen{-}Cl Lu and
Chien{-}Hung Lin and
Meng{-}Han Hsieh and
Tsung{-}Yao Lin and
Chih{-}Cheng Chen},
title = {A 12-nm 0.62-1.61 mW Ultra-Low Power Digital CIM-based Deep-Learning
System for End-to-End Always-on Vision},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185296},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185296},
timestamp = {Fri, 28 Jul 2023 10:40:41 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/ChangXDJLCLLKJG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/LuLCLCWYCCCCCHL23,
author = {C. A. Lu and
H. P. Lee and
H. C. Chen and
Y. C. Lin and
Y. H. Chung and
S. H. Wang and
J. Y. Yeh and
V. S. Chang and
M. C. Chiang and
W. Chang and
H. C. Chung and
C. F. Cheng and
H. H. Hsu and
H. H. Liu and
William P. N. Chen and
C. Y. Lin},
title = {Characterizing and Reducing the Layout Dependent Effect and Gate Resistance
to Enable Multiple-Vt Scaling for a 3nm {CMOS} Technology},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185282},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185282},
timestamp = {Fri, 28 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/LuLCLCWYCCCCCHL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-02731,
author = {Hsuan{-}Kung Yang and
Yu{-}Ying Chen and
Tsung{-}Chih Chiang and
Chia{-}Chuan Hsu and
Chun{-}Chia Huang and
Chun{-}Wei Huang and
Jou{-}Min Liu and
Ting{-}Ru Liu and
Tsu{-}Ching Hsiao and
Chun{-}Yi Lee},
title = {Vision based Virtual Guidance for Navigation},
journal = {CoRR},
volume = {abs/2303.02731},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.02731},
doi = {10.48550/ARXIV.2303.02731},
eprinttype = {arXiv},
eprint = {2303.02731},
timestamp = {Tue, 14 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-02731.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-05156,
author = {Jie{-}En Yao and
Li{-}Yuan Tsao and
Yi{-}Chen Lo and
Roy Tseng and
Chia{-}Che Chang and
Chun{-}Yi Lee},
title = {Local Implicit Normalizing Flow for Arbitrary-Scale Image Super-Resolution},
journal = {CoRR},
volume = {abs/2303.05156},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.05156},
doi = {10.48550/ARXIV.2303.05156},
eprinttype = {arXiv},
eprint = {2303.05156},
timestamp = {Wed, 15 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-05156.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-06274,
author = {Simon Graham and
Quoc Dang Vu and
Mostafa Jahanifar and
Martin Weigert and
Uwe Schmidt and
Wenhua Zhang and
Jun Zhang and
Sen Yang and
Jinxi Xiang and
Xiyue Wang and
Josef Lorenz Rumberger and
Elias Baumann and
Peter Hirsch and
Lihao Liu and
Chenyang Hong and
Angelica I. Avil{\'{e}}s{-}Rivero and
Ayushi Jain and
Heeyoung Ahn and
Yiyu Hong and
Hussam Azzuni and
Min Xu and
Mohammad Yaqub and
Marie{-}Claire Blache and
Beno{\^{\i}}t Pi{\'{e}}gu and
Bertrand Vernay and
Tim Scherr and
Moritz B{\"{o}}hland and
Katharina L{\"{o}}ffler and
Jiachen Li and
Weiqin Ying and
Chixin Wang and
Dagmar Kainmueller and
Carola{-}Bibiane Sch{\"{o}}nlieb and
Shuolin Liu and
Dhairya Talsania and
Yughender Meda and
Prakash Mishra and
Muhammad Ridzuan and
Oliver Neumann and
Marcel P. Schilling and
Markus Reischl and
Ralf Mikut and
Banban Huang and
Hsiang{-}Chin Chien and
Ching{-}Ping Wang and
Chia{-}Yen Lee and
Hong{-}Kun Lin and
Zaiyi Liu and
Xipeng Pan and
Chu Han and
Jijun Cheng and
Muhammad Dawood and
Srijay Deshpande and
Raja Muhammad Saad Bashir and
Adam Shephard and
Pedro Costa and
Jo{\~{a}}o D. Nunes and
Aur{\'{e}}lio Campilho and
Jaime S. Cardoso and
Hrishikesh P. S and
Densen Puthussery and
Devika R. G and
Jiji C V and
Ye Zhang and
Zijie Fang and
Zhifan Lin and
Yongbing Zhang and
Chunhui Lin and
Liukun Zhang and
Lijian Mao and
Min Wu and
Thi Tuong Vi Vo and
Soo{-}Hyung Kim and
Taebum Lee and
Satoshi Kondo and
Satoshi Kasai and
Pranay Dumbhare and
Vedant Phuse and
Yash Dubey and
Ankush Jamthikar and
Trinh Thi Le Vuong and
Jin Tae Kwak and
Dorsa Ziaei and
Hyun Jung and
Tianyi Miao and
David R. J. Snead and
Shan{-}E{-}Ahmed Raza and
Fayyaz Minhas and
Nasir M. Rajpoot},
title = {CoNIC Challenge: Pushing the Frontiers of Nuclear Detection, Segmentation,
Classification and Counting},
journal = {CoRR},
volume = {abs/2303.06274},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.06274},
doi = {10.48550/ARXIV.2303.06274},
eprinttype = {arXiv},
eprint = {2303.06274},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-06274.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-07456,
author = {Wanshi Chen and
Xingqin Lin and
Juho Lee and
Antti Toskala and
Shu Sun and
Carla{-}Fabiana Chiasserini and
Lingjia Liu},
title = {5G-Advanced Towards 6G: Past, Present, and Future},
journal = {CoRR},
volume = {abs/2303.07456},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.07456},
doi = {10.48550/ARXIV.2303.07456},
eprinttype = {arXiv},
eprint = {2303.07456},
timestamp = {Mon, 20 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-07456.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-11816,
author = {Sung{-}Feng Huang and
Chia{-}Ping Chen and
Zhi{-}Sheng Chen and
Yu{-}Pao Tsai and
Hung{-}yi Lee},
title = {Personalized Lightweight Text-to-Speech: Voice Cloning with Adaptive
Structured Pruning},
journal = {CoRR},
volume = {abs/2303.11816},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.11816},
doi = {10.48550/ARXIV.2303.11816},
eprinttype = {arXiv},
eprint = {2303.11816},
timestamp = {Wed, 22 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-11816.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-01937,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
title = {Can Large Language Models Be an Alternative to Human Evaluations?},
journal = {CoRR},
volume = {abs/2305.01937},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.01937},
doi = {10.48550/ARXIV.2305.01937},
eprinttype = {arXiv},
eprint = {2305.01937},
timestamp = {Fri, 05 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-01937.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-05083,
author = {David Cheng{-}Han Chiang and
Yung{-}Sung Chuang and
James R. Glass and
Hung{-}yi Lee},
title = {Revealing the Blind Spot of Sentence Encoder Evaluation by {HEROS}},
journal = {CoRR},
volume = {abs/2306.05083},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.05083},
doi = {10.48550/ARXIV.2306.05083},
eprinttype = {arXiv},
eprint = {2306.05083},
timestamp = {Wed, 14 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-05083.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-16740,
author = {Anthony G. Francis and
Claudia P{\'{e}}rez{-}D'Arpino and
Chengshu Li and
Fei Xia and
Alexandre Alahi and
Rachid Alami and
Aniket Bera and
Abhijat Biswas and
Joydeep Biswas and
Rohan Chandra and
Hao{-}Tien Lewis Chiang and
Michael Everett and
Sehoon Ha and
Justin W. Hart and
Jonathan P. How and
Haresh Karnan and
Tsang{-}Wei Edward Lee and
Luis J. Manso and
Reuth Mirsky and
S{\"{o}}ren Pirk and
Phani{-}Teja Singamaneni and
Peter Stone and
Ada V. Taylor and
Peter Trautman and
Nathan Tsoi and
Marynel V{\'{a}}zquez and
Xuesu Xiao and
Peng Xu and
Naoki Yokoyama and
Alexander Toshev and
Roberto Martin Martin},
title = {Principles and Guidelines for Evaluating Social Robot Navigation Algorithms},
journal = {CoRR},
volume = {abs/2306.16740},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.16740},
doi = {10.48550/ARXIV.2306.16740},
eprinttype = {arXiv},
eprint = {2306.16740},
timestamp = {Mon, 03 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-16740.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-07047,
author = {Bo{-}Ru Lu and
Nikita Haduong and
Chia{-}Hsuan Lee and
Zeqiu Wu and
Hao Cheng and
Paul Koester and
Jean Utke and
Tao Yu and
Noah A. Smith and
Mari Ostendorf},
title = {{DIALGEN:} Collaborative Human-LM Generated Dialogues for Improved
Understanding of Human-Human Conversations},
journal = {CoRR},
volume = {abs/2307.07047},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.07047},
doi = {10.48550/ARXIV.2307.07047},
eprinttype = {arXiv},
eprint = {2307.07047},
timestamp = {Mon, 24 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-07047.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-09143,
author = {Yuki Kondo and
Norimichi Ukita and
Takayuki Yamaguchi and
Hao{-}Yu Hou and
Mu{-}Yi Shen and
Chia{-}Chi Hsu and
En{-}Ming Huang and
Yu{-}Chen Huang and
Yu{-}Cheng Xia and
Chien{-}Yao Wang and
Chun{-}Yi Lee and
Da Huo and
Marc A. Kastner and
Tingwei Liu and
Yasutomo Kawanishi and
Takatsugu Hirayama and
Takahiro Komamizu and
Ichiro Ide and
Yosuke Shinya and
Xinyao Liu and
Guang Liang and
Syusuke Yasui},
title = {{MVA2023} Small Object Detection Challenge for Spotting Birds: Dataset,
Methods, and Results},
journal = {CoRR},
volume = {abs/2307.09143},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.09143},
doi = {10.48550/ARXIV.2307.09143},
eprinttype = {arXiv},
eprint = {2307.09143},
timestamp = {Tue, 25 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-09143.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-05657,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
title = {A Closer Look into Automatic Evaluation Using Large Language Models},
journal = {CoRR},
volume = {abs/2310.05657},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.05657},
doi = {10.48550/ARXIV.2310.05657},
eprinttype = {arXiv},
eprint = {2310.05657},
timestamp = {Tue, 24 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-05657.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-04241,
author = {Li{-}Hsiang Shen and
Kai{-}Ten Feng and
Ta{-}Sung Lee and
Yuan{-}Chun Lin and
Shih{-}Cheng Lin and
Chia{-}Chan Chang and
Sheng{-}Fuh Chang},
title = {AI-Enabled Unmanned Vehicle-Assisted Reconfigurable Intelligent Surfaces:
Deployment, Prototyping, Experiments, and Opportunities},
journal = {CoRR},
volume = {abs/2311.04241},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.04241},
doi = {10.48550/ARXIV.2311.04241},
eprinttype = {arXiv},
eprint = {2311.04241},
timestamp = {Thu, 16 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-04241.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-09758,
author = {Chia{-}Hsuan Lee and
Hao Cheng and
Mari Ostendorf},
title = {OrchestraLLM: Efficient Orchestration of Language Models for Dialogue
State Tracking},
journal = {CoRR},
volume = {abs/2311.09758},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.09758},
doi = {10.48550/ARXIV.2311.09758},
eprinttype = {arXiv},
eprint = {2311.09758},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-09758.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/BuiLCCLL22,
author = {Trong{-}An Bui and
Pei{-}Jun Lee and
Kuan{-}Yu Chen and
Chia{-}Ray Chen and
Cynthia S. J. Liu and
Hsin{-}Chia Lin},
title = {Edge Computing-Based SAT-Video Coding for Remote Sensing},
journal = {{IEEE} Access},
volume = {10},
pages = {52840--52852},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3174553},
doi = {10.1109/ACCESS.2022.3174553},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/BuiLCCLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChenLTYYKC22,
author = {Mei{-}Juan Chen and
Cheng{-}An Lee and
Yu{-}Hsiang Tsai and
Chieh{-}Ming Yang and
Chia{-}Hung Yeh and
Lih{-}Jen Kau and
Chuan{-}Yu Chang},
title = {Efficient Partition Decision Based on Visual Perception and Machine
Learning for H.266/Versatile Video Coding},
journal = {{IEEE} Access},
volume = {10},
pages = {42127--42136},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3168155},
doi = {10.1109/ACCESS.2022.3168155},
timestamp = {Fri, 20 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChenLTYYKC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChengHLL22,
author = {Chung{-}Kuan Cheng and
Chia{-}Tung Ho and
Daeyeal Lee and
Bill Lin},
title = {Monolithic 3D Semiconductor Footprint Scaling Exploration Based on
{VFET} Standard Cell Layout Methodology, Design Flow, and {EDA} Platform},
journal = {{IEEE} Access},
volume = {10},
pages = {65971--65981},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3184008},
doi = {10.1109/ACCESS.2022.3184008},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChengHLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HuangLLCLY22,
author = {Ching{-}Lon Huang and
Feng{-}Chi Lee and
Chia{-}Jung Liu and
Jyun{-}You Chen and
Yi{-}Jen Lin and
Shih{-}Chin Yang},
title = {Torque Ripple Reduction for {BLDC} Permanent Magnet Motor Drive Using
DC-Link Voltage and Current Modulation},
journal = {{IEEE} Access},
volume = {10},
pages = {51272--51284},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3173325},
doi = {10.1109/ACCESS.2022.3173325},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/HuangLLCLY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/KhanCPZHLCLLFS22,
author = {Zuhaib Khan and
Yung{-}Hao Chang and
Te{-}Lieh Pan and
Yaung{-}Cheng Zhao and
Yen{-}Yu Huang and
Chia{-}Hung Lee and
Jui{-}Sheng Chang and
Cheng{-}Yi Liu and
Cheng{-}Yuan Lee and
Chao{-}Yi Fang and
Jin{-}Wei Shi},
title = {High-Brightness, High-Speed, and Low-Noise {VCSEL} Arrays for Optical
Wireless Communication},
journal = {{IEEE} Access},
volume = {10},
pages = {2303--2317},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2021.3133436},
doi = {10.1109/ACCESS.2021.3133436},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/KhanCPZHLCLLFS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LeeCYCWHC22,
author = {Ko{-}Feng Lee and
Xiu{-}Zhi Chen and
Chao{-}Wei Yu and
Kai{-}Yi Chin and
Yih{-}Chen Wang and
Chia{-}Yu Hsiao and
Yen{-}Lin Chen},
title = {An Intelligent Driving Assistance System Based on Lightweight Deep
Learning Models},
journal = {{IEEE} Access},
volume = {10},
pages = {111888--111900},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3213328},
doi = {10.1109/ACCESS.2022.3213328},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/LeeCYCWHC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aei/LeeCH22,
author = {Chia{-}Yen Lee and
Bai{-}Jian Chou and
Chen{-}Feng Huang},
title = {Data science and reinforcement learning for price forecasting and
raw material procurement in petrochemical industry},
journal = {Adv. Eng. Informatics},
volume = {51},
pages = {101443},
year = {2022},
url = {https://doi.org/10.1016/j.aei.2021.101443},
doi = {10.1016/J.AEI.2021.101443},
timestamp = {Fri, 18 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aei/LeeCH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/apin/ChiuCL22,
author = {Sheng{-}Min Chiu and
Yi{-}Chung Chen and
Chiang Lee},
title = {Estate price prediction system based on temporal and spatial features
and lightweight deep learning model},
journal = {Appl. Intell.},
volume = {52},
number = {1},
pages = {808--834},
year = {2022},
url = {https://doi.org/10.1007/s10489-021-02472-6},
doi = {10.1007/S10489-021-02472-6},
timestamp = {Tue, 08 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/apin/ChiuCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/LinLCMK22,
author = {Yu{-}Da Lin and
Yi{-}Chen Lee and
Chih{-}Po Chiang and
Sin{-}Hua Moi and
Jung{-}Yu Kan},
title = {{MOAI:} a multi-outcome interaction identification approach reveals
an interaction between vaspin and carcinoembryonic antigen on colorectal
cancer prognosis},
journal = {Briefings Bioinform.},
volume = {23},
number = {1},
year = {2022},
url = {https://doi.org/10.1093/bib/bbab427},
doi = {10.1093/BIB/BBAB427},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bib/LinLCMK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/KungLHTCLLCWL22,
author = {Yi{-}Chia Kung and
Chia{-}Wei Li and
Fan{-}Chi Hsiao and
Pei{-}Jung Tsai and
Shuo Chen and
Ming{-}Kang Li and
Hsin{-}Chien Lee and
Chun{-}Yen Chang and
Changwei W. Wu and
Ching{-}Po Lin},
title = {Cross-Scale Dynamicity of Entropy and Connectivity in the Sleeping
Brain},
journal = {Brain Connect.},
volume = {12},
number = {9},
pages = {835--845},
year = {2022},
url = {https://doi.org/10.1089/brain.2021.0174},
doi = {10.1089/BRAIN.2021.0174},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/brain/KungLHTCLLCWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/ShihLCLHWTCW22,
author = {Ming{-}Lang Shih and
Jih{-}Chin Lee and
Sheng{-}Yao Cheng and
Bashir Lawal and
Ching{-}Liang Ho and
Cheng{-}Chia Wu and
David T. W. Tzeng and
Jia{-}Hong Chen and
Alexander T. H. Wu},
title = {Transcriptomic discovery of a theranostic signature (S\emph{ERPINE1/MMP3/COL1A1/SPP1})
for head and neck squamous cell carcinomas and identification of antrocinol
as a candidate drug},
journal = {Comput. Biol. Medicine},
volume = {150},
pages = {106185},
year = {2022},
url = {https://doi.org/10.1016/j.compbiomed.2022.106185},
doi = {10.1016/J.COMPBIOMED.2022.106185},
timestamp = {Tue, 31 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cbm/ShihLCLHWTCW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmig/GharleghiAEOECG22,
author = {Ramtin Gharleghi and
Dona Adikari and
Katy Ellenberger and
Sze{-}Yuan Ooi and
Chris Ellis and
Chung{-}Ming Chen and
Ruochen Gao and
Yuting He and
Raabid Hussain and
Chia{-}Yen Lee and
Jun Li and
Jun Ma and
Ziwei Nie and
Bruno Oliveira and
Yaolei Qi and
Youssef Skandarani and
Jo{\~{a}}o L. Vila{\c{c}}a and
Xiyue Wang and
Sen Yang and
Arcot Sowmya and
Susann Beier},
title = {Automated segmentation of normal and diseased coronary arteries -
The {ASOCA} challenge},
journal = {Comput. Medical Imaging Graph.},
volume = {97},
pages = {102049},
year = {2022},
url = {https://doi.org/10.1016/j.compmedimag.2022.102049},
doi = {10.1016/J.COMPMEDIMAG.2022.102049},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmig/GharleghiAEOECG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/electronicmarkets/HuangCHL22,
author = {Cheng{-}Kui Huang and
Shin{-}Horng Chen and
Chia{-}Chen Hu and
Ming{-}Ching Lee},
title = {Understanding the adoption of the mask-supply information platforms
during the {COVID-19}},
journal = {Electron. Mark.},
volume = {32},
number = {4},
pages = {2405--2427},
year = {2022},
url = {https://doi.org/10.1007/s12525-022-00602-7},
doi = {10.1007/S12525-022-00602-7},
timestamp = {Fri, 17 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/electronicmarkets/HuangCHL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-cds/ChangLCL22,
author = {Jui{-}Hung Chang and
Chia{-}Lun Lee and
Fu{-}Hsing Chen and
Chih{-}Lung Lin},
title = {Optical properties of a-Si: {H} thin-film transistors by illumination
by white light with different colour temperatures},
journal = {{IET} Circuits Devices Syst.},
volume = {16},
number = {5},
pages = {399--409},
year = {2022},
url = {https://doi.org/10.1049/cds2.12114},
doi = {10.1049/CDS2.12114},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-cds/ChangLCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/LinCCLW22,
author = {Yen{-}Hsun Lin and
Yi{-}Chung Chen and
Sheng{-}Min Chiu and
Chiang Lee and
Fu{-}Cheng Wang},
title = {Applying Check-in Data and User Profiles to Identify Optimal Store
Locations in a Road Network},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {11},
number = {5},
pages = {314},
year = {2022},
url = {https://doi.org/10.3390/ijgi11050314},
doi = {10.3390/IJGI11050314},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/LinCCLW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijira/WangLCL22,
author = {Jen{-}Wei Wang and
Chia{-}Lien Li and
Jian{-}Lun Chen and
Jyh{-}Jone Lee},
title = {Robot grasping in dense clutter via view-based experience transfer},
journal = {Int. J. Intell. Robotics Appl.},
volume = {6},
number = {1},
pages = {23--37},
year = {2022},
url = {https://doi.org/10.1007/s41315-021-00179-y},
doi = {10.1007/S41315-021-00179-Y},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijira/WangLCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijst/KwekTLTA22,
author = {Lee{-}Chung Kwek and
Alan Wee{-}Chiat Tan and
Heng{-}Siong Lim and
Cheah Heng Tan and
Khaled A. Alaghbari},
title = {Sparse representation and reproduction of speech signals in complex
Fourier basis},
journal = {Int. J. Speech Technol.},
volume = {25},
number = {1},
pages = {211--217},
year = {2022},
url = {https://doi.org/10.1007/s10772-021-09941-w},
doi = {10.1007/S10772-021-09941-W},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijst/KwekTLTA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/LeeCCLH22,
author = {Chi{-}Han Lee and
Ronald Y. Chang and
Shin{-}Ming Cheng and
Chia{-}Hsiang Lin and
Chiu{-}Han Hsiao},
title = {Joint Beamforming and Power Allocation for {M2M/H2H} Co-Existence
in Green Dynamic {TDD} Networks: Low-Complexity Optimal Designs},
journal = {{IEEE} Internet Things J.},
volume = {9},
number = {6},
pages = {4799--4815},
year = {2022},
url = {https://doi.org/10.1109/JIOT.2021.3109697},
doi = {10.1109/JIOT.2021.3109697},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/LeeCCLH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/istr/LinPSLHLLLC22,
author = {Ying{-}Dar Lin and
Jehoshua{-}Hanky Pratama and
Didik Sudyana and
Yuan{-}Cheng Lai and
Ren{-}Hung Hwang and
Po{-}Ching Lin and
Hsuan{-}Yu Lin and
Wei{-}Bin Lee and
Chen{-}Kuo Chiang},
title = {{ELAT:} Ensemble Learning with Adversarial Training in defending against
evaded intrusions},
journal = {J. Inf. Secur. Appl.},
volume = {71},
pages = {103348},
year = {2022},
url = {https://doi.org/10.1016/j.jisa.2022.103348},
doi = {10.1016/J.JISA.2022.103348},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/istr/LinPSLHLLLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itp/HungCL22,
author = {Shiu{-}Wan Hung and
Min{-}Jhih Cheng and
Chia{-}Jung Lee},
title = {A new mechanism for purchasing through personal interactions: fairness,
trust and social influence in online group buying},
journal = {Inf. Technol. People},
volume = {35},
number = {5},
pages = {1563--1589},
year = {2022},
url = {https://doi.org/10.1108/ITP-05-2020-0329},
doi = {10.1108/ITP-05-2020-0329},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/itp/HungCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/WangCKL22,
author = {San{-}Fu Wang and
Hua{-}Pin Chen and
Yitsen Ku and
Chia{-}Ling Lee},
title = {Voltage-Mode Biquad Filter Using Four OTAs and Its Application in
Quadrature Oscillator with Noninteractive Control of the Oscillation
Condition and Frequency},
journal = {J. Circuits Syst. Comput.},
volume = {31},
number = {4},
pages = {2250078:1--2250078:21},
year = {2022},
url = {https://doi.org/10.1142/S0218126622500785},
doi = {10.1142/S0218126622500785},
timestamp = {Thu, 05 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcsc/WangCKL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jim/LeeC22,
author = {Chia{-}Yen Lee and
Chen{-}Fu Chien},
title = {Pitfalls and protocols of data science in manufacturing practice},
journal = {J. Intell. Manuf.},
volume = {33},
number = {5},
pages = {1189--1207},
year = {2022},
url = {https://doi.org/10.1007/s10845-020-01711-w},
doi = {10.1007/S10845-020-01711-W},
timestamp = {Tue, 04 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jim/LeeC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeASZKVCFGCMOL22,
author = {Sae Kyu Lee and
Ankur Agrawal and
Joel Silberman and
Matthew M. Ziegler and
Mingu Kang and
Swagath Venkataramani and
Nianzheng Cao and
Bruce M. Fleischer and
Michael Guillorn and
Matthew Cohen and
Silvia M. Mueller and
Jinwook Oh and
Martin Lutz and
Jinwook Jung and
Siyu Koswatta and
Ching Zhou and
Vidhi Zalani and
Monodeep Kar and
James Bonanno and
Robert Casatuta and
Chia{-}Yu Chen and
Jungwook Choi and
Howard Haynie and
Alyssa Herbert and
Radhika Jain and
Kyu{-}Hyoun Kim and
Yulong Li and
Zhibin Ren and
Scot Rider and
Marcel Schaal and
Kerstin Schelm and
Michael Scheuermann and
Xiao Sun and
Hung Tran and
Naigang Wang and
Wei Wang and
Xin Zhang and
Vinay Shah and
Brian W. Curran and
Vijayalakshmi Srinivasan and
Pong{-}Fei Lu and
Sunil Shukla and
Kailash Gopalakrishnan and
Leland Chang},
title = {A 7-nm Four-Core Mixed-Precision {AI} Chip With 26.2-TFLOPS Hybrid-FP8
Training, 104.9-TOPS {INT4} Inference, and Workload-Aware Throttling},
journal = {{IEEE} J. Solid State Circuits},
volume = {57},
number = {1},
pages = {182--197},
year = {2022},
url = {https://doi.org/10.1109/JSSC.2021.3120113},
doi = {10.1109/JSSC.2021.3120113},
timestamp = {Sat, 19 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeASZKVCFGCMOL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/HsuLLY22,
author = {Chih{-}Chung Hsu and
Chia{-}Yen Lee and
Cheng{-}Jhong Lin and
Hung Yeh},
title = {A comprehensive study of age-related macular degeneration detection},
journal = {Multim. Tools Appl.},
volume = {81},
number = {9},
pages = {11897--11916},
year = {2022},
url = {https://doi.org/10.1007/s11042-021-11896-8},
doi = {10.1007/S11042-021-11896-8},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/HsuLLY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/HuangLCHTXBLWZW22,
author = {Hsi{-}Yuan Huang and
Yang{-}Chi{-}Dung Lin and
Shi{-}Dong Cui and
Yixian Huang and
Yun Tang and
Jia{-}Tong Xu and
Jiayang Bao and
Yulin Li and
Jia Wen and
Hua{-}Li Zuo and
Weijuan Wang and
Jing Li and
Jie Ni and
Yini Ruan and
Liping Li and
Yidan Chen and
Yue{-}Yang Xie and
Zihao Zhu and
Xiao{-}Xuan Cai and
Xin{-}Yi Chen and
Lantian Yao and
Yi{-}Gang Chen and
Yijun Luo and
Shupeng Luxu and
Mengqi Luo and
Chih{-}Min Chiu and
Kun Ma and
Lizhe Zhu and
Gui{-}Juan Cheng and
Chen Bai and
Ying{-}Chih Chiang and
Liping Wang and
Feng{-}Xiang Wei and
Tzong{-}Yi Lee and
Hsien{-}Da Huang},
title = {miRTarBase update 2022: an informative resource for experimentally
validated miRNA-target interactions},
journal = {Nucleic Acids Res.},
volume = {50},
number = {{D1}},
pages = {222--230},
year = {2022},
url = {https://doi.org/10.1093/nar/gkab1079},
doi = {10.1093/NAR/GKAB1079},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/HuangLCHTXBLWZW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/JhongYPLCWLLLMH22,
author = {Jhih{-}Hua Jhong and
Lantian Yao and
Yuxuan Pang and
Zhongyan Li and
Chia{-}Ru Chung and
Rulan Wang and
Shangfu Li and
Wenshuo Li and
Mengqi Luo and
Renfei Ma and
Yuqi Huang and
Xiaoning Zhu and
Jiahong Zhang and
Hexiang Feng and
Qifan Cheng and
Chunxuan Wang and
Kun Xi and
Li{-}Ching Wu and
Tzu{-}Hao Chang and
Jorng{-}Tzong Horng and
Lizhe Zhu and
Ying{-}Chih Chiang and
Zhuo Wang and
Tzong{-}Yi Lee},
title = {dbAMP 2.0: updated resource for antimicrobial peptides with an enhanced
scanning method for genomic and proteomic data},
journal = {Nucleic Acids Res.},
volume = {50},
number = {{D1}},
pages = {460--470},
year = {2022},
url = {https://doi.org/10.1093/nar/gkab1080},
doi = {10.1093/NAR/GKAB1080},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/JhongYPLCWLLLMH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/LeeCYCLC22,
author = {Ming{-}Che Lee and
Jia{-}Wei Chang and
Sheng{-}Cheng Yeh and
Tsorng{-}Lin Chia and
Jie{-}Shan Liao and
Xu{-}Ming Chen},
title = {Applying attention-based BiLSTM and technical indicators in the design
and performance analysis of stock trading strategies},
journal = {Neural Comput. Appl.},
volume = {34},
number = {16},
pages = {13267--13279},
year = {2022},
url = {https://doi.org/10.1007/s00521-021-06828-4},
doi = {10.1007/S00521-021-06828-4},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nca/LeeCYCLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/MaffeiGSAAZWMHS22,
author = {Chiara Maffei and
Gabriel Girard and
Kurt G. Schilling and
Dogu Baran Aydogan and
Nagesh Adluru and
Andrey Zhylka and
Ye Wu and
Matteo Mancini and
Andac Hamamci and
Alessia Sarica and
Achille Teillac and
Steven H. Baete and
Davood Karimi and
Fang{-}Cheng Yeh and
Mert E. Yildiz and
Ali Gholipour and
Yann Bihan{-}Poudec and
Bassem Hiba and
Andrea Quattrone and
Aldo Quattrone and
Tommy Boshkovski and
Nikola Stikov and
Pew{-}Thian Yap and
Alberto De Luca and
Josien P. W. Pluim and
Alexander Leemans and
Vivek Prabhakaran and
Barbara B. Bendlin and
Andrew L. Alexander and
Bennett A. Landman and
Erick Jorge Canales{-}Rodr{\'{\i}}guez and
Muhamed Barakovic and
Jonathan Rafael{-}Patino and
Thomas Yu and
Ga{\"{e}}tan Rensonnet and
Simona Schiavi and
Alessandro Daducci and
Marco Pizzolato and
Elda Fischi Gomez and
Jean{-}Philippe Thiran and
George Dai and
Giorgia Grisot and
Nikola Lazovski and
Santi Puch and
Marc Ramos and
Paulo Rodrigues and
Vesna Prckovska and
Robert Jones and
Julia Lehman and
Suzanne N. Haber and
Anastasia Yendiki},
title = {Insights from the IronTract challenge: Optimal methods for mapping
brain pathways from multi-shell diffusion {MRI}},
journal = {NeuroImage},
volume = {257},
pages = {119327},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2022.119327},
doi = {10.1016/J.NEUROIMAGE.2022.119327},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/MaffeiGSAAZWMHS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/LinCLSFLLTWL22,
author = {Chin Lin and
Tom Chau and
Chin{-}Sheng Lin and
Hung{-}Sheng Shang and
Wen{-}Hui Fang and
Ding{-}Jie Lee and
Chia{-}Cheng Lee and
Shi{-}Hung Tsai and
Chih{-}Hung Wang and
Shih{-}Hua Lin},
title = {Point-of-care artificial intelligence-enabled {ECG} for dyskalemia:
a retrospective cohort analysis for accuracy and outcome prediction},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-021-00550-0},
doi = {10.1038/S41746-021-00550-0},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/LinCLSFLLTWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/WuTLCYCCHPHCLSL22,
author = {I{-}Wen Wu and
Tsung{-}Hsien Tsai and
Chi{-}Jen Lo and
Yi{-}Ju Chou and
Chi{-}Hsiao Yeh and
Yun{-}Hsuan Chan and
Jun{-}Hong Chen and
Paul Wei{-}Che Hsu and
Heng{-}Chih Pan and
Heng{-}Jung Hsu and
Chun{-}Yu Chen and
Chin{-}Chan Lee and
Yu{-}Chiau Shyu and
Chih{-}Lang Lin and
Mei{-}Ling Cheng and
Chi{-}Chun Lai and
Huey{-}Kang Sytwu and
Ting{-}Fen Tsai},
title = {Discovering a trans-omics biomarker signature that predisposes high
risk diabetic patients to diabetic kidney disease},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-022-00713-7},
doi = {10.1038/S41746-022-00713-7},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/WuTLCYCCHPHCLSL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qre/ChiangHCCL22,
author = {Chi{-}Lun Chiang and
Chin{-}Yu Huang and
Chang{-}Yu Chiu and
Kai{-}Wen Chen and
Chen{-}Hua Lee},
title = {Analysis and assessment of weighted combinatorial criterion for test
suite reduction},
journal = {Qual. Reliab. Eng. Int.},
volume = {38},
number = {1},
pages = {358--388},
year = {2022},
url = {https://doi.org/10.1002/qre.2984},
doi = {10.1002/QRE.2984},
timestamp = {Wed, 23 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qre/ChiangHCCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/ShenLL22,
author = {Po{-}Cheng Shen and
Meng{-}Xiu Lu and
Chia{-}Yen Lee},
title = {Spatio-Temporal Anomaly Detection for Substrate Strip Bin Map in Semiconductor
Assembly Process},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {7},
number = {4},
pages = {9493--9500},
year = {2022},
url = {https://doi.org/10.1109/LRA.2022.3191185},
doi = {10.1109/LRA.2022.3191185},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ral/ShenLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChengSKYLCL22,
author = {Kuo{-}Sheng Cheng and
Ya{-}Ling Su and
Li{-}Chieh Kuo and
Tai{-}Hua Yang and
Chia{-}Lin Lee and
Wenxi Chen and
Shing{-}Hong Liu},
title = {Muscle Mass Measurement Using Machine Learning Algorithms with Electrical
Impedance Myography},
journal = {Sensors},
volume = {22},
number = {8},
pages = {3087},
year = {2022},
url = {https://doi.org/10.3390/s22083087},
doi = {10.3390/S22083087},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ChengSKYLCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChuangLSYC22,
author = {Chia{-}Chun Chuang and
Chien{-}Ching Lee and
Edmund Cheung So and
Chia{-}Hong Yeng and
Yeou{-}Jiunn Chen},
title = {Multi-Task Learning-Based Deep Neural Network for Steady-State Visual
Evoked Potential-Based Brain-Computer Interfaces},
journal = {Sensors},
volume = {22},
number = {21},
pages = {8303},
year = {2022},
url = {https://doi.org/10.3390/s22218303},
doi = {10.3390/S22218303},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ChuangLSYC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/HsiuLWHCLC22,
author = {Hsin Hsiu and
Shun{-}Ku Lin and
Wan{-}Ling Weng and
Chaw{-}Mew Hung and
Che{-}Kai Chang and
Chia{-}Chien Lee and
Chao{-}Tsung Chen},
title = {Discrimination of the Cognitive Function of Community Subjects Using
the Arterial Pulse Spectrum and Machine-Learning Analysis},
journal = {Sensors},
volume = {22},
number = {3},
pages = {806},
year = {2022},
url = {https://doi.org/10.3390/s22030806},
doi = {10.3390/S22030806},
timestamp = {Wed, 23 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/HsiuLWHCLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/TsaiHCWDHSKLHLK22,
author = {Cheng{-}Yu Tsai and
Huei{-}Tyng Huang and
Hsueh{-}Chien Cheng and
Jieni Wang and
Ping{-}Jung Duh and
Wen{-}Hua Hsu and
Marc Stettler and
Yi{-}Chun Kuan and
Yin{-}Tzu Lin and
Chia{-}Rung Hsu and
Kang{-}Yun Lee and
Jiunn{-}Horng Kang and
Dean Wu and
Hsin{-}Chien Lee and
Cheng{-}Jung Wu and
Arnab Majumdar and
Wen{-}Te Liu},
title = {Screening for Obstructive Sleep Apnea Risk by Using Machine Learning
Approaches and Anthropometric Features},
journal = {Sensors},
volume = {22},
number = {22},
pages = {8630},
year = {2022},
url = {https://doi.org/10.3390/s22228630},
doi = {10.3390/S22228630},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/TsaiHCWDHSKLHLK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/ChenLCC22,
author = {Yi{-}Hui Chen and
Jia{-}Ye Lee and
Min{-}Hsien Chiang and
Shih{-}Hsin Chen},
title = {Verifiable (2, n) Image Secret Sharing Scheme Using Sudoku Matrix},
journal = {Symmetry},
volume = {14},
number = {7},
pages = {1445},
year = {2022},
url = {https://doi.org/10.3390/sym14071445},
doi = {10.3390/SYM14071445},
timestamp = {Thu, 25 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/ChenLCC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tase/ChengLHMML22,
author = {Fan{-}Tien Cheng and
Chia{-}Yen Lee and
Min{-}Hsiung Hung and
Lars M{\"{o}}nch and
James R. Morrison and
Kaibo Liu},
title = {Special Issue on Automation Analytics Beyond Industry 4.0: From Hybrid
Strategy to Zero-Defect Manufacturing},
journal = {{IEEE} Trans Autom. Sci. Eng.},
volume = {19},
number = {3},
pages = {1472--1476},
year = {2022},
url = {https://doi.org/10.1109/TASE.2022.3180525},
doi = {10.1109/TASE.2022.3180525},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tase/ChengLHMML22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/LeeLKSC22,
author = {Shuenn{-}Yuh Lee and
Hao{-}Yun Lee and
Chia{-}Ho Kung and
Po{-}Han Su and
Ju{-}Yi Chen},
title = {A 0.8-{\(\mu\)}W and 74-dB High-Pass Sigma-Delta Modulator With {OPAMP}
Sharing and Noise-Coupling Techniques for Biomedical Signal Acquisition},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {16},
number = {5},
pages = {742--751},
year = {2022},
url = {https://doi.org/10.1109/TBCAS.2022.3201328},
doi = {10.1109/TBCAS.2022.3201328},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbcas/LeeLKSC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/LuLWHCCHOLCCLLL22,
author = {Ting{-}Heng Lu and
Chi{-}Wei Liu and
Chuan{-}Yi Wu and
Cong{-}Sheng Huang and
Jing{-}Siang Chen and
Ling{-}Chia Chen and
Yao{-}Wei Huang and
I{-}Che Ou and
Sook{-}Kuan Lee and
Yen{-}Chi Chen and
Po{-}Hung Chen and
Chi{-}Te Liu and
Ying{-}Chih Liao and
Yu{-}Te Liao},
title = {A Wireless Soil pH and Conductance Monitoring Chip Powered by Soil
Microbial and Photovoltaic Energy Cells},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {16},
number = {6},
pages = {1008--1020},
year = {2022},
url = {https://doi.org/10.1109/TBCAS.2022.3222089},
doi = {10.1109/TBCAS.2022.3222089},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbcas/LuLWHCCHOLCCLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/NienWLCCCLKC22,
author = {Yu{-}Teng Nien and
Kai{-}Chiang Wu and
Dong{-}Zhen Lee and
Ying{-}Yen Chen and
Po{-}Lin Chen and
Mason Chern and
Jih{-}Nung Lee and
Shu{-}Yi Kao and
Mango Chia{-}Tso Chao},
title = {Methodology of Generating Timing-Slack-Based Cell-Aware Tests},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {41},
number = {11},
pages = {5057--5070},
year = {2022},
url = {https://doi.org/10.1109/TCAD.2021.3135785},
doi = {10.1109/TCAD.2021.3135785},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcad/NienWLCCCLKC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasI/ChiuDLCWHLCLTCL22,
author = {Ching{-}Te Chiu and
Yu{-}Chun Ding and
Wei{-}Chen Lin and
Wei{-}Jyun Chen and
Shu{-}Yun Wu and
Chao{-}Tsung Huang and
Chun{-}Yeh Lin and
Chia{-}Yu Chang and
Meng{-}Jui Lee and
Shimazu Tatsunori and
Tsung Chen and
Fan{-}Yi Lin and
Yuan{-}Hao Huang},
title = {Chaos LiDAR Based {RGB-D} Face Classification System With Embedded
{CNN} Accelerator on FPGAs},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {69},
number = {12},
pages = {4847--4859},
year = {2022},
url = {https://doi.org/10.1109/TCSI.2022.3190430},
doi = {10.1109/TCSI.2022.3190430},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcasI/ChiuDLCWHLCLTCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tecs/ChenSHBLLMC22,
author = {Kuan{-}Hsun Chen and
Chiahui Su and
Christian Hakert and
Sebastian Buschj{\"{a}}ger and
Chao{-}Lin Lee and
Jenq{-}Kuen Lee and
Katharina Morik and
Jian{-}Jia Chen},
title = {Efficient Realization of Decision Trees for Real-Time Inference},
journal = {{ACM} Trans. Embed. Comput. Syst.},
volume = {21},
number = {6},
pages = {68:1--68:26},
year = {2022},
url = {https://doi.org/10.1145/3508019},
doi = {10.1145/3508019},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tecs/ChenSHBLLMC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ChiuCKHHCL22,
author = {Sheng{-}Min Chiu and
Yi{-}Chung Chen and
Cheng{-}Ju Kuo and
Li{-}Chun Hung and
Min{-}Hsiung Hung and
Chao{-}Chun Chen and
Chiang Lee},
title = {Development of Lightweight {RBF-DRNN} and Automated Framework for
{CNC} Tool-Wear Prediction},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--11},
year = {2022},
url = {https://doi.org/10.1109/TIM.2022.3164063},
doi = {10.1109/TIM.2022.3164063},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/ChiuCKHHCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/ChenTWCLCTSY22,
author = {Chun{-}Chuan Chen and
Meng{-}Chang Tsai and
Eric Hsiao{-}Kuang Wu and
Chia{-}Ru Chung and
Yuchi Lee and
Po{-}Ru Chiu and
Po{-}Yi Tsai and
Shao{-}Rong Sheng and
Shih{-}Ching Yeh},
title = {Neuronal Abnormalities Induced by an Intelligent Virtual Reality System
for Methamphetamine Use Disorder},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {26},
number = {7},
pages = {3458--3465},
year = {2022},
url = {https://doi.org/10.1109/JBHI.2022.3154759},
doi = {10.1109/JBHI.2022.3154759},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/ChenTWCLCTSY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/FangLFSCLSKQMSC22,
author = {Huihui Fang and
Fei Li and
Huazhu Fu and
Xu Sun and
Xingxing Cao and
Fengbin Lin and
Jaemin Son and
Sunho Kim and
Gwenol{\'{e}} Quellec and
Sarah Matta and
Sharath M. Shankaranarayana and
Yi{-}Ting Chen and
Chuen{-}heng Wang and
Nisarg A. Shah and
Chia{-}Yen Lee and
Chih{-}Chung Hsu and
Hai Xie and
Baiying Lei and
Ujjwal Baid and
Shubham Innani and
Kang Dang and
Wenxiu Shi and
Ravi Kamble and
Nitin Singhal and
Ching{-}Wei Wang and
Shih{-}Chang Lo and
Jos{\'{e}} Ignacio Orlando and
Hrvoje Bogunovic and
Xiulan Zhang and
Yanwu Xu},
title = {{ADAM} Challenge: Detecting Age-Related Macular Degeneration From
Fundus Images},
journal = {{IEEE} Trans. Medical Imaging},
volume = {41},
number = {10},
pages = {2828--2847},
year = {2022},
url = {https://doi.org/10.1109/TMI.2022.3172773},
doi = {10.1109/TMI.2022.3172773},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/FangLFSCLSKQMSC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/LiuYLCCL22,
author = {Tzu{-}Hsuan Liu and
Che{-}Hao Yu and
Yi{-}Jheng Lin and
Chia{-}Ming Chang and
Cheng{-}Shang Chang and
Duan{-}Shin Lee},
title = {{ALOHA} Receivers: {A} Network Calculus Approach for Analyzing Coded
Multiple Access With {SIC}},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {30},
number = {2},
pages = {840--854},
year = {2022},
url = {https://doi.org/10.1109/TNET.2021.3123685},
doi = {10.1109/TNET.2021.3123685},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ton/LiuYLCCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/ChengHHLL22,
author = {Chung{-}Kuan Cheng and
Chia{-}Tung Ho and
Chester Holtz and
Daeyeal Lee and
Bill Lin},
title = {Machine Learning Prediction for Design and System Technology Co-Optimization
Sensitivity Analysis},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {30},
number = {8},
pages = {1059--1072},
year = {2022},
url = {https://doi.org/10.1109/TVLSI.2022.3172938},
doi = {10.1109/TVLSI.2022.3172938},
timestamp = {Mon, 08 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvlsi/ChengHHLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ChiangL22,
author = {David Cheng{-}Han Chiang and
Hung{-}Yi Lee},
title = {On the Transferability of Pre-trained Language Models: {A} Study from
Artificial Datasets},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {10518--10525},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i10.21295},
doi = {10.1609/AAAI.V36I10.21295},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ChiangL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmvc/LiaoLYYTLCCCLL22,
author = {Ting{-}Hsuan Liao and
Huang{-}Ru Liao and
Shan{-}Ya Yang and
Jie{-}En Yao and
Li{-}Yuan Tsao and
Hsu{-}Shen Liu and
Chen{-}Hao Chao and
Bo{-}Wun Cheng and
Chia{-}Che Chang and
Yi{-}Chen Lo and
Chun{-}Yi Lee},
title = {{ELDA:} Using Edges to Have an Edge on Semantic Segmentation Based
{UDA}},
booktitle = {33rd British Machine Vision Conference 2022, {BMVC} 2022, London,
UK, November 21-24, 2022},
pages = {108},
publisher = {{BMVA} Press},
year = {2022},
url = {https://bmvc2022.mpi-inf.mpg.de/108/},
timestamp = {Thu, 16 Feb 2023 16:15:04 +0100},
biburl = {https://dblp.org/rec/conf/bmvc/LiaoLYYTLCCCLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/LinLHCYC22,
author = {Fang{-}Yu Lin and
Chia{-}Yi Lee and
Yi{-}Ting Ho and
Yao{-}Kuang Chen and
Yu{-}Chun (Grace) Yen and
Yung{-}Ju Chang},
editor = {Simone D. J. Barbosa and
Cliff Lampe and
Caroline Appert and
David A. Shamma},
title = {What Kinds of Experiences Do You Desire? {A} Preliminary Study of
the Desired Experiences of Contributors to Location-Based Mobile Crowdsourcing},
booktitle = {{CHI} '22: {CHI} Conference on Human Factors in Computing Systems,
New Orleans, LA, USA, 29 April 2022 - 5 May 2022, Extended Abstracts},
pages = {220:1--220:7},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3491101.3519744},
doi = {10.1145/3491101.3519744},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/LinLHCYC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csci/ChiangLHCP22,
author = {Yen{-}Han Chiang and
Hsin{-}Yu Lee and
Yi{-}Wei Huang and
Hui{-}Shan Chen and
Yi{-}Lun Pan},
title = {Cloud-Based Sepsis Prediction System with Neural Architecture Search
Service},
booktitle = {International Conference on Computational Science and Computational
Intelligence, {CSCI} 2022, Las Vegas, NV, USA, December 14-16, 2022},
pages = {19--25},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CSCI58124.2022.00011},
doi = {10.1109/CSCI58124.2022.00011},
timestamp = {Mon, 22 Apr 2024 15:12:51 +0200},
biburl = {https://dblp.org/rec/conf/csci/ChiangLHCP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/LeeCWC22,
author = {Dong{-}Zhen Lee and
Ying{-}Yen Chen and
Kai{-}Chiang Wu and
Mango C.{-}T. Chao},
editor = {Cristiana Bolchini and
Ingrid Verbauwhede and
Ioana Vatajelu},
title = {Improving Cell-Aware Test for Intra-Cell Short Defects},
booktitle = {2022 Design, Automation {\&} Test in Europe Conference {\&}
Exhibition, {DATE} 2022, Antwerp, Belgium, March 14-23, 2022},
pages = {436--441},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.23919/DATE54114.2022.9774502},
doi = {10.23919/DATE54114.2022.9774502},
timestamp = {Wed, 25 May 2022 22:56:19 +0200},
biburl = {https://dblp.org/rec/conf/date/LeeCWC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/IgnatovTCKXLLCCYSCJXZBSZGLWZZLWSWLZYDZ22,
author = {Andrey Ignatov and
Radu Timofte and
Cheng{-}Ming Chiang and
Hsien{-}Kai Kuo and
Yu{-}Syuan Xu and
Man{-}Yu Lee and
Allen Lu and
Chia{-}Ming Cheng and
Chih{-}Cheng Chen and
Jia{-}Ying Yong and
Hong{-}Han Shuai and
Wen{-}Huang Cheng and
Zhuang Jia and
Tianyu Xu and
Yijian Zhang and
Long Bao and
Heng Sun and
Diankai Zhang and
Si Gao and
Shaoli Liu and
Biao Wu and
Xiaofeng Zhang and
Chengjian Zheng and
Kaidi Lu and
Ning Wang and
Xiao Sun and
Haodong Wu and
Xuncheng Liu and
Weizhan Zhang and
Caixia Yan and
Haipeng Du and
Qinghua Zheng and
Qi Wang and
Wangdu Chen and
Ran Duan and
Mengdi Sun and
Dan Zhu and
Guannan Chen and
Hojin Cho and
Steve Kim and
Shijie Yue and
Chenghua Li and
Zhengyang Zhuge and
Wei Chen and
Wenxu Wang and
Yufeng Zhou and
Xiaochen Cai and
Hengxing Cai and
Kele Xu and
Li Liu and
Zehua Cheng and
Wenyi Lian and
Wenjing Lian},
editor = {Leonid Karlinsky and
Tomer Michaeli and
Ko Nishino},
title = {Power Efficient Video Super-Resolution on Mobile NPUs with Deep Learning,
Mobile {AI} {\&} {AIM} 2022 Challenge: Report},
booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
23-27, 2022, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {13803},
pages = {130--152},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-25066-8\_6},
doi = {10.1007/978-3-031-25066-8\_6},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eccv/IgnatovTCKXLLCCYSCJXZBSZGLWZZLWSWLZYDZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcce/ChangCCHSLO22,
author = {Wan{-}Jung Chang and
Ming{-}Che Chen and
Tsung{-}Sheng Cheng and
Chia{-}Hao Hsu and
Jian{-}Ping Su and
Shih{-}Hsiung Lee and
Yang{-}Kun Ou},
title = {ThermalPose: {A} Real-Time 2D Human Skeleton Recognition System Using
Thermal Imaging},
booktitle = {11th {IEEE} Global Conference on Consumer Electronics, {GCCE} 2022,
Osaka, Japan, October 18-21, 2022},
pages = {290--291},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/GCCE56475.2022.10014222},
doi = {10.1109/GCCE56475.2022.10014222},
timestamp = {Sat, 28 Jan 2023 23:52:06 +0100},
biburl = {https://dblp.org/rec/conf/gcce/ChangCCHSLO22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcce/ChiuCLJ22,
author = {C. L. Chiu and
Ting{-}Rong Chen and
Chia{-}Wei Lee and
Jau{-}Ji Jou},
title = {The Study of 60 GHz Wideband Conductor-Backed Coplanar Waveguide on
a {TGV} Substrate},
booktitle = {11th {IEEE} Global Conference on Consumer Electronics, {GCCE} 2022,
Osaka, Japan, October 18-21, 2022},
pages = {816--817},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/GCCE56475.2022.10014135},
doi = {10.1109/GCCE56475.2022.10014135},
timestamp = {Sat, 28 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gcce/ChiuCLJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iasam/LeeLCC22,
author = {Sheng{-}Huei Lee and
Jian{-}Hong Liu and
Bin{-}Yi Chen and
Chia{-}Chi Chu},
title = {A Two-Stage Data-Driven Algorithm to Estimate the System Inertia Utilizing
Event-Driven Disturbed {PMU} Measurements},
booktitle = {{IEEE} Industry Applications Society Annual Meeting, {IAS} 2022, Detroit,
MI, USA, October 9-14, 2022},
pages = {1--8},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IAS54023.2022.9939958},
doi = {10.1109/IAS54023.2022.9939958},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iasam/LeeLCC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdh/ChenHCHHLCKLW22,
author = {Chi{-}Yu Chen and
Po{-}Chien Hsu and
Tang{-}Chen Chang and
Huan Ho and
Min{-}Chun Hu and
Chi{-}Chun Lee and
Hui{-}Ju Chen and
Mary Hsin{-}Ju Ko and
Chia{-}Fan Lee and
Pei{-}Yi Wang},
editor = {Sheikh Iqbal Ahamed and
Claudio Agostino Ardagna and
Hongyi Bian and
Mario A. Bochicchio and
Carl K. Chang and
Rong N. Chang and
Ernesto Damiani and
Lin Liu and
Misha Pavel and
Corrado Priami and
Hossain Shahriar and
Robert Ward and
Fatos Xhafa and
Jia Zhang and
Farhana H. Zulkernine},
title = {Computer Vision Based Cognition Assessment for Developmental-Behavioral
Screening},
booktitle = {{IEEE} International Conference on Digital Health, {ICDH} 2022, Barcelona,
Spain, July 10-16, 2022},
pages = {151--156},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICDH55609.2022.00031},
doi = {10.1109/ICDH55609.2022.00031},
timestamp = {Tue, 20 Aug 2024 07:54:45 +0200},
biburl = {https://dblp.org/rec/conf/icdh/ChenHCHHLCKLW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceit/ChenHTLHH22,
author = {Yi{-}Hsien Chen and
Nen{-}Fu Huang and
Jian{-}Wei Tzeng and
Chia{-}An Lee and
You{-}Xuan Huang and
Hao{-}Hsuan Huang},
title = {A Personalized Learning Path Recommender System with {LINE} Bot in
MOOCs Based on {LSTM}},
booktitle = {11th International Conference on Educational and Information Technology,
{ICEIT} 2022, Chengdu, China, January 6-8, 2022},
pages = {40--45},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICEIT54416.2022.9690754},
doi = {10.1109/ICEIT54416.2022.9690754},
timestamp = {Fri, 18 Feb 2022 10:36:39 +0100},
biburl = {https://dblp.org/rec/conf/iceit/ChenHTLHH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChaoSCLCLCCL22,
author = {Chen{-}Hao Chao and
Wei{-}Fang Sun and
Bo{-}Wun Cheng and
Yi{-}Chen Lo and
Chia{-}Che Chang and
Yu{-}Lun Liu and
Yu{-}Lin Chang and
Chia{-}Ping Chen and
Chun{-}Yi Lee},
title = {Denoising Likelihood Score Matching for Conditional Score-based Data
Generation},
booktitle = {The Tenth International Conference on Learning Representations, {ICLR}
2022, Virtual Event, April 25-29, 2022},
publisher = {OpenReview.net},
year = {2022},
url = {https://openreview.net/forum?id=LcF-EEt8cCC},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ChaoSCLCLCCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/NiTCCKLCHHKHG22,
author = {Yu{-}Shu Ni and
Chia{-}Chi Tsai and
Chih{-}Cheng Chen and
Po{-}Yu Chen and
Hsien{-}Kai Kuo and
Man{-}Yu Lee and
Kuo Chin{-}Chuan and
Zhe{-}Ln Hu and
Po{-}Chi Hu and
Ted T. Kuo and
Jenq{-}Neng Hwang and
Jiun{-}In Guo},
title = {Summary of the 2022 Low-Power Deep Learning Semantic Segmentation
Model Compression Competition for Traffic Scene In Asian Countries},
booktitle = {{IEEE} International Conference on Multimedia and Expo Workshops,
{ICME} Workshops 2022, Taipei, Taiwan, July 18-22, 2022},
pages = {1--6},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICMEW56448.2022.9859367},
doi = {10.1109/ICMEW56448.2022.9859367},
timestamp = {Wed, 31 Aug 2022 10:57:44 +0200},
biburl = {https://dblp.org/rec/conf/icmcs/NiTCCKLCHHKHG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icphys/LeeC22,
author = {Wei{-}chen Lee and
Wei{-}hsun Chiang},
title = {Development of a Leaf-Sweeping Robot},
booktitle = {5th {IEEE} International Conference on Industrial Cyber-Physical Systems,
{ICPS} 2022, Coventry, United Kingdom, May 24-26, 2022},
pages = {1--5},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICPS51978.2022.9816868},
doi = {10.1109/ICPS51978.2022.9816868},
timestamp = {Mon, 06 Nov 2023 13:38:03 +0100},
biburl = {https://dblp.org/rec/conf/icphys/LeeC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intcompsymp/ChenWCLL22,
author = {Chia{-}Mei Chen and
Yu{-}Xuan Wang and
Zheng{-}Xun Cai and
Boyi Lee and
Gu{-}Hsin Lai},
editor = {Sun{-}Yuan Hsieh and
Ling{-}Ju Hung and
Ralf Klasing and
Chia{-}Wei Lee and
Sheng{-}Lung Peng},
title = {Automatic Summarization of Critical Threat Intelligence Using Transfer
Learning},
booktitle = {New Trends in Computer Technologies and Applications - 25th International
Computer Symposium, {ICS} 2022, Taoyuan, Taiwan, December 15-17, 2022,
Proceedings},
series = {Communications in Computer and Information Science},
volume = {1723},
pages = {343--348},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-981-19-9582-8\_30},
doi = {10.1007/978-981-19-9582-8\_30},
timestamp = {Wed, 15 Feb 2023 15:44:27 +0100},
biburl = {https://dblp.org/rec/conf/intcompsymp/ChenWCLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LeeKSCL22,
author = {Hao{-}Yun Lee and
Chia{-}Ho Kung and
Po{-}Han Su and
Ju{-}Yi Chen and
Shuenn{-}Yuh Lee},
title = {High-Pass Sigma-Delta Modulator with Operational Amplifier Sharing
and Noise-Coupling Technique for Biomedical Signal Acquisition},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2022,
Austin, TX, USA, May 27 - June 1, 2022},
pages = {2580--2583},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISCAS48785.2022.9937857},
doi = {10.1109/ISCAS48785.2022.9937857},
timestamp = {Thu, 17 Nov 2022 15:59:17 +0100},
biburl = {https://dblp.org/rec/conf/iscas/LeeKSCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispd/ChenKLTKLLCLC22,
author = {Po{-}Yan Chen and
Bing{-}Ting Ke and
Tai{-}Cheng Lee and
I{-}Ching Tsai and
Tai{-}Wei Kung and
Li{-}Yi Lin and
En{-}Cheng Liu and
Yun{-}Chih Chang and
Yih{-}Lang Li and
Mango C.{-}T. Chao},
editor = {Laleh Behjat and
Stephen Yang},
title = {A Reinforcement Learning Agent for Obstacle-Avoiding Rectilinear Steiner
Tree Construction},
booktitle = {{ISPD} 2022: International Symposium on Physical Design, Virtual Event,
Canada, March 27 - 30, 2022},
pages = {107--115},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3505170.3506721},
doi = {10.1145/3505170.3506721},
timestamp = {Thu, 14 Apr 2022 14:53:52 +0200},
biburl = {https://dblp.org/rec/conf/ispd/ChenKLTKLLCLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/ChenSLLCTKLC22,
author = {Li{-}Wei Chen and
Yao{-}Nien Sui and
Tai{-}Cheng Lee and
Yih{-}Lang Li and
Mango C.{-}T. Chao and
I{-}Ching Tsai and
Tai{-}Wei Kung and
En{-}Cheng Liu and
Yun{-}Chih Chang},
title = {Path-Based Pre-Routing Timing Prediction for Modern Very Large-Scale
Integration Designs},
booktitle = {23rd International Symposium on Quality Electronic Design, {ISQED}
2022, Santa Clara, CA, USA, April 6-7, 2022},
pages = {1--6},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISQED54688.2022.9806225},
doi = {10.1109/ISQED54688.2022.9806225},
timestamp = {Mon, 04 Jul 2022 17:06:19 +0200},
biburl = {https://dblp.org/rec/conf/isqed/ChenSLLCTKLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/FujiwaraMZCNCHS22,
author = {Hidehiro Fujiwara and
Haruki Mori and
Wei{-}Chang Zhao and
Mei{-}Chen Chuang and
Rawan Naous and
Chao{-}Kai Chuang and
Takeshi Hashizume and
Dar Sun and
Chia{-}Fu Lee and
Kerem Akarvardar and
Saman Adham and
Tan{-}Li Chou and
Mahmut Ersin Sinangil and
Yih Wang and
Yu{-}Der Chih and
Yen{-}Huei Chen and
Hung{-}Jen Liao and
Tsung{-}Yung Jonathan Chang},
title = {A 5-nm 254-TOPS/W 221-TOPS/mm\({}^{\mbox{2}}\) Fully-Digital Computing-in-Memory
Macro Supporting Wide-Range Dynamic-Voltage-Frequency Scaling and
Simultaneous {MAC} and Write Operations},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {1--3},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731754},
doi = {10.1109/ISSCC42614.2022.9731754},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/FujiwaraMZCNCHS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HuWCLLWLLHHLC0L22,
author = {Han{-}Wen Hu and
Wei{-}Chen Wang and
Chung Kuang Chen and
Yung{-}Chun Lee and
Bo{-}Rong Lin and
Huai{-}Mu Wang and
Yen{-}Po Lin and
Yu{-}Chao Lin and
Chih{-}Chang Hsieh and
Chia{-}Ming Hu and
Yi{-}Ting Lai and
Han{-}Sung Chen and
Yuan{-}Hao Chang and
Hsiang{-}Pang Li and
Tei{-}Wei Kuo and
Keh{-}Chung Wang and
Meng{-}Fan Chang and
Chun{-}Hsiung Hung and
Chih{-}Yuan Lu},
title = {A 512Gb In-Memory-Computing 3D-NAND Flash Supporting Similar-Vector-Matching
Operations on Edge-AI Devices},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {138--140},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731775},
doi = {10.1109/ISSCC42614.2022.9731775},
timestamp = {Wed, 04 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HuWCLLWLLHHLC0L22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/VermaBSWNLYEJSZ22,
author = {Ashutosh Verma and
Venumadhav Bhagavatula and
Amitoj Singh and
Wanghua Wu and
Hariharan Nagarajan and
Pak{-}Kim Lau and
Xiaohua Yu and
Omar Elsayed and
Ajaypat Jain and
Anirban Sarkar and
Fan Zhang and
Che{-}Chun Kuo and
Patrick McElwee and
Pei{-}Yuan Chiang and
Chengkai Guo and
Zhanjun Bai and
Tienyu Chang and
Abishek Mann and
Andreas Rydin and
Xingliang Zhao and
Jeiyoung Lee and
Daeyoung Yoon and
Chih{-}Wei Yao and
Siuchuang{-}Ivan Lu and
Sang Won Son and
Thomas Byunghak Cho},
title = {A 16-Channel, 28/39GHz Dual-Polarized 5G {FR2} Phased-Array Transceiver
{IC} with a Quad-Stream {IF} Transceiver Supporting Non-Contiguous
Carrier Aggregation up to 1.6GHz {BW}},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {1--3},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731664},
doi = {10.1109/ISSCC42614.2022.9731664},
timestamp = {Tue, 02 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/VermaBSWNLYEJSZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WuLCHLCOLCCLLL22,
author = {Chuan{-}Yi Wu and
Chi{-}Wei Liu and
Jing{-}Siang Chen and
Cong{-}Sheng Huang and
Ting{-}Heng Lu and
Ling{-}Chia Chen and
I{-}Che Ou and
Sook{-}Kuan Lee and
Yen{-}Chi Chen and
Po{-}Hung Chen and
Chi{-}Te Liu and
Ying{-}Chih Liao and
Yu{-}Te Liao},
title = {A Self-powering Wireless Soil-pH and Electrical Conductance Monitoring
{IC} with Hybrid Microbial Electrochemical and Photovoltaic Energy
Harvesting},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {1--3},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731723},
doi = {10.1109/ISSCC42614.2022.9731723},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/WuLCHLCOLCCLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/YanHYLZYMYYLCH22,
author = {Bonan Yan and
Jeng{-}Long Hsu and
Pang{-}Cheng Yu and
Chia{-}Chi Lee and
Yaojun Zhang and
Wenshuo Yue and
Guoqiang Mei and
Yuchao Yang and
Yue Yang and
Hai Li and
Yiran Chen and
Ru Huang},
title = {A 1.041-Mb/mm\({}^{\mbox{2}}\) 27.38-TOPS/W Signed-INT8 Dynamic-Logic-Based
ADC-less {SRAM} Compute-in-Memory Macro in 28nm with Reconfigurable
Bitwise Operation for {AI} and Embedded Applications},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {188--190},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731545},
doi = {10.1109/ISSCC42614.2022.9731545},
timestamp = {Tue, 04 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/YanHYLZYMYYLCH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/HuW0LLWLHLSHHLC22,
author = {Han{-}Wen Hu and
Wei{-}Chen Wang and
Yuan{-}Hao Chang and
Yung{-}Chun Lee and
Bo{-}Rong Lin and
Huai{-}Mu Wang and
Yen{-}Po Lin and
Yu{-}Ming Huang and
Chong{-}Ying Lee and
Tzu{-}Hsiang Su and
Chih{-}Chang Hsieh and
Chia{-}Ming Hu and
Yi{-}Ting Lai and
Chung Kuang Chen and
Han{-}Sung Chen and
Hsiang{-}Pang Li and
Tei{-}Wei Kuo and
Meng{-}Fan Chang and
Keh{-}Chung Wang and
Chun{-}Hsiung Hung and
Chih{-}Yuan Lu},
title = {{ICE:} An Intelligent Cognition Engine with 3D NAND-based In-Memory
Computing for Vector Similarity Search Acceleration},
booktitle = {55th {IEEE/ACM} International Symposium on Microarchitecture, {MICRO}
2022, Chicago, IL, USA, October 1-5, 2022},
pages = {763--783},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/MICRO56248.2022.00058},
doi = {10.1109/MICRO56248.2022.00058},
timestamp = {Wed, 04 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micro/HuW0LLWLHLSHHLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/misnc/ChangCCL22,
author = {Ting{-}Hsuan Chang and
Sheng{-}Min Chiu and
Yi{-}Chung Chen and
Chiang Lee},
title = {Using spatial, temporal, and external factors to enhance prediction
of shared-transport users},
booktitle = {The 9th Multidisciplinary International Social Networks Conference,
{MISNC} 2022, Matsuyama, Japan, October 29-31, 2022},
pages = {5--11},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3561278.3561282},
doi = {10.1145/3561278.3561282},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/misnc/ChangCCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ps/ChengL0WKLL22,
author = {Chih{-}Hsien Cheng and
Shao{-}Yung Lee and
Xin Chen and
Chia{-}Hsuan Wang and
Hao{-}Chung Kuo and
Ming{-}Jun Li and
Gong{-}Ru Lin},
title = {Beyond 66-Gbps Error-Free {NRZ-OOK} Encoded Dual-Mode {VCSEL} Back-to-Back
Data Link},
booktitle = {2022 27th OptoElectronics and Communications Conference {(OECC)} and
2022 International Conference on Photonics in Switching and Computing
(PSC), Toyama, Japan, July 3-6, 2022},
pages = {1--3},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.23919/OECC/PSC53152.2022.9850167},
doi = {10.23919/OECC/PSC53152.2022.9850167},
timestamp = {Tue, 04 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ps/ChengL0WKLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/JainCQLCHRC22,
author = {Vivek A. Jain and
Hao{-}Tse Chu and
Shixiong Qi and
Chia{-}An Lee and
Hung{-}Cheng Chang and
Cheng{-}Ying Hsieh and
K. K. Ramakrishnan and
Jyh{-}Cheng Chen},
editor = {Fernando Kuipers and
Ariel Orda},
title = {L\({}^{\mbox{2}}\)5GC: a low latency 5G core network based on high-performance
{NFV} platforms},
booktitle = {{SIGCOMM} '22: {ACM} {SIGCOMM} 2022 Conference, Amsterdam, The Netherlands,
August 22 - 26, 2022},
pages = {143--157},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3544216.3544267},
doi = {10.1145/3544216.3544267},
timestamp = {Mon, 15 Aug 2022 15:08:50 +0200},
biburl = {https://dblp.org/rec/conf/sigcomm/JainCQLCHRC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slt/KaoWCCTL22,
author = {Wei{-}Tsung Kao and
Yuan{-}Kuei Wu and
Chia{-}Ping Chen and
Zhi{-}Sheng Chen and
Yu{-}Pao Tsai and
Hung{-}Yi Lee},
title = {On the Efficiency of Integrating Self-Supervised Learning and Meta-Learning
for User-Defined Few-Shot Keyword Spotting},
booktitle = {{IEEE} Spoken Language Technology Workshop, {SLT} 2022, Doha, Qatar,
January 9-12, 2023},
pages = {414--421},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/SLT54892.2023.10022697},
doi = {10.1109/SLT54892.2023.10022697},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/slt/KaoWCCTL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/ChangTHLCC0G22,
author = {Ruei{-}Che Chang and
Chao{-}Hsien Ting and
Chia{-}Sheng Hung and
Wan{-}Chen Lee and
Liang{-}Jin Chen and
Yu{-}Tzu Chao and
Bing{-}Yu Chen and
Anhong Guo},
editor = {Maneesh Agrawala and
Jacob O. Wobbrock and
Eytan Adar and
Vidya Setlur},
title = {OmniScribe: Authoring Immersive Audio Descriptions for 360{\textdegree}
Videos},
booktitle = {The 35th Annual {ACM} Symposium on User Interface Software and Technology,
{UIST} 2022, Bend, OR, USA, 29 October 2022 - 2 November 2022},
pages = {15:1--15:14},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3526113.3545613},
doi = {10.1145/3526113.3545613},
timestamp = {Mon, 31 Oct 2022 17:28:09 +0100},
biburl = {https://dblp.org/rec/conf/uist/ChangTHLCC0G22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/LeeLYCW022,
author = {Chi{-}Jung Lee and
Rong{-}Hao Liang and
Ling{-}Chien Yang and
Chi{-}Huan Chiang and
Te{-}Yen Wu and
Bing{-}Yu Chen},
editor = {Maneesh Agrawala and
Jacob O. Wobbrock and
Eytan Adar and
Vidya Setlur},
title = {NFCStack: Identifiable Physical Building Blocks that Support Concurrent
Construction and Frictionless Interaction},
booktitle = {The 35th Annual {ACM} Symposium on User Interface Software and Technology,
{UIST} 2022, Bend, OR, USA, 29 October 2022 - 2 November 2022},
pages = {26:1--26:12},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3526113.3545658},
doi = {10.1145/3526113.3545658},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uist/LeeLYCW022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/ChiangWLNWHCCZL22,
author = {H.{-}L. Chiang and
J.{-}F. Wang and
K.{-}H. Lin and
C.{-}H. Nien and
J.{-}J. Wu and
Kuo{-}Yu Hsiang and
C.{-}P. Chuu and
Y.{-}W. Chen and
X. W. Zhang and
C. W. Liu and
Tahui Wang and
C. C. Wang and
Min{-}Hung Lee and
M.{-}F. Chang and
C.{-}S. Chang and
T. C. Chen},
title = {Interfacial-Layer Design for Hf1-xZrxO2-Based {FTJ} Devices: From
Atom to Array},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {361--362},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830462},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830462},
timestamp = {Wed, 03 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsit/ChiangWLNWHCCZL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/LeeLCLHHWLSC22,
author = {Shuenn{-}Yuh Lee and
Hao{-}Yun Lee and
Ding{-}Siang Ciou and
Zhan{-}Xian Liao and
Peng{-}Wei Huang and
Yi{-}Ting Hsieh and
Yi{-}Chieh Wei and
Chia{-}Yu Lin and
Meng{-}Dar Shieh and
Ju{-}Yi Chen},
title = {A Wireless Urine Detection System and Platform with Power-Efficient
Electrochemical Readout {ASIC} and {ABTS-CNT} Biosensor},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {246--247},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830325},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830325},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsit/LeeLCLHHWLSC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/LeeLLMFSCCC22,
author = {Chia{-}Fu Lee and
Cheng{-}Han Lu and
Cheng{-}En Lee and
Haruki Mori and
Hidehiro Fujiwara and
Yi{-}Chun Shih and
Tan{-}Li Chou and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang},
title = {A 12nm 121-TOPS/W 41.6-TOPS/mm2 All Digital Full Precision SRAM-based
Compute-in-Memory with Configurable Bit-width For {AI} Edge Applications},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {24--25},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830438},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830438},
timestamp = {Thu, 04 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/LeeLLMFSCCC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-07983,
author = {Huihui Fang and
Fei Li and
Huazhu Fu and
Xu Sun and
Xingxing Cao and
Fengbin Lin and
Jaemin Son and
Sunho Kim and
Gwenol{\'{e}} Quellec and
Sarah Matta and
Sharath M. Shankaranarayana and
Yi{-}Ting Chen and
Chuen{-}heng Wang and
Nisarg A. Shah and
Chia{-}Yen Lee and
Chih{-}Chung Hsu and
Hai Xie and
Baiying Lei and
Ujjwal Baid and
Shubham Innani and
Kang Dang and
Wenxiu Shi and
Ravi Kamble and
Nitin Singhal and
Jos{\'{e}} Ignacio Orlando and
Hrvoje Bogunovic and
Xiulan Zhang and
Yanwu Xu},
title = {{ADAM} Challenge: Detecting Age-related Macular Degeneration from
Fundus Images},
journal = {CoRR},
volume = {abs/2202.07983},
year = {2022},
url = {https://arxiv.org/abs/2202.07983},
eprinttype = {arXiv},
eprint = {2202.07983},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-07983.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-14206,
author = {Chen{-}Hao Chao and
Wei{-}Fang Sun and
Bo{-}Wun Cheng and
Yi{-}Chen Lo and
Chia{-}Che Chang and
Yu{-}Lun Liu and
Yu{-}Lin Chang and
Chia{-}Ping Chen and
Chun{-}Yi Lee},
title = {Denoising Likelihood Score Matching for Conditional Score-based Data
Generation},
journal = {CoRR},
volume = {abs/2203.14206},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.14206},
doi = {10.48550/ARXIV.2203.14206},
eprinttype = {arXiv},
eprint = {2203.14206},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-14206.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-00352,
author = {Wei{-}Tsung Kao and
Yuen{-}Kwei Wu and
Chia{-}Ping Chen and
Zhi{-}Sheng Chen and
Yu{-}Pao Tsai and
Hung{-}Yi Lee},
title = {On the Efficiency of Integrating Self-supervised Learning and Meta-learning
for User-defined Few-shot Keyword Spotting},
journal = {CoRR},
volume = {abs/2204.00352},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.00352},
doi = {10.48550/ARXIV.2204.00352},
eprinttype = {arXiv},
eprint = {2204.00352},
timestamp = {Wed, 06 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-00352.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-04458,
author = {David Cheng{-}Han Chiang and
Hung{-}Yi Lee},
title = {Understanding, Detecting, and Separating Out-of-Distribution Samples
and Adversarial Samples in Text Classification},
journal = {CoRR},
volume = {abs/2204.04458},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.04458},
doi = {10.48550/ARXIV.2204.04458},
eprinttype = {arXiv},
eprint = {2204.04458},
timestamp = {Wed, 13 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-04458.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-04580,
author = {David Cheng{-}Han Chiang and
Hung{-}Yi Lee},
title = {Re-Examining Human Annotations for Interpretable {NLP}},
journal = {CoRR},
volume = {abs/2204.04580},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.04580},
doi = {10.48550/ARXIV.2204.04580},
eprinttype = {arXiv},
eprint = {2204.04580},
timestamp = {Wed, 13 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-04580.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-02758,
author = {Cheng{-}Chun Lee and
Akhil Rajput and
Chia{-}Wei Hsu and
Chao Fan and
Faxi Yuan and
Shangjia Dong and
Amir Esmalian and
Hamed Farahmand and
Flavia Ioana Patrascu and
Chia{-}Fu Liu and
Bo Li and
Junwei Ma and
Ali Mostafavi},
title = {Quantitative Measures for Integrating Resilience into Transportation
Planning Practice: Study in Texas},
journal = {CoRR},
volume = {abs/2205.02758},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.02758},
doi = {10.48550/ARXIV.2205.02758},
eprinttype = {arXiv},
eprint = {2205.02758},
timestamp = {Thu, 12 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-02758.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04615,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {CoRR},
volume = {abs/2206.04615},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.04615},
doi = {10.48550/ARXIV.2206.04615},
eprinttype = {arXiv},
eprint = {2206.04615},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-04615.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-13969,
author = {Hsiang{-}Chin Chien and
Ching{-}Ping Wang and
Jung{-}Chih Chen and
Chia{-}Yen Lee},
title = {Airway Tree Modeling Using Dual-channel 3D UNet 3+ with Vesselness
Prior},
journal = {CoRR},
volume = {abs/2208.13969},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.13969},
doi = {10.48550/ARXIV.2208.13969},
eprinttype = {arXiv},
eprint = {2208.13969},
timestamp = {Thu, 01 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-13969.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-02844,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
title = {How Far Are We from Real Synonym Substitution Attacks?},
journal = {CoRR},
volume = {abs/2210.02844},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.02844},
doi = {10.48550/ARXIV.2210.02844},
eprinttype = {arXiv},
eprint = {2210.02844},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-02844.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-05256,
author = {Andrey Ignatov and
Radu Timofte and
Cheng{-}Ming Chiang and
Hsien{-}Kai Kuo and
Yu{-}Syuan Xu and
Man{-}Yu Lee and
Allen Lu and
Chia{-}Ming Cheng and
Chih{-}Cheng Chen and
Jia{-}Ying Yong and
Hong{-}Han Shuai and
Wen{-}Huang Cheng and
Zhuang Jia and
Tianyu Xu and
Yijian Zhang and
Long Bao and
Heng Sun and
Diankai Zhang and
Si Gao and
Shaoli Liu and
Biao Wu and
Xiaofeng Zhang and
Chengjian Zheng and
Kaidi Lu and
Ning Wang and
Xiao Sun and
Haodong Wu and
Xuncheng Liu and
Weizhan Zhang and
Caixia Yan and
Haipeng Du and
Qinghua Zheng and
Qi Wang and
Wangdu Chen and
Ran Duan and
Ran Duan and
Mengdi Sun and
Dan Zhu and
Guannan Chen and
Hojin Cho and
Steve Kim and
Shijie Yue and
Chenghua Li and
Zhengyang Zhuge and
Wei Chen and
Wenxu Wang and
Yufeng Zhou and
Xiaochen Cai and
Hengxing Cai and
Kele Xu and
Li Liu and
Zehua Cheng and
Wenyi Lian and
Wenjing Lian},
title = {Power Efficient Video Super-Resolution on Mobile NPUs with Deep Learning,
Mobile {AI} {\&} {AIM} 2022 challenge: Report},
journal = {CoRR},
volume = {abs/2211.05256},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.05256},
doi = {10.48550/ARXIV.2211.05256},
eprinttype = {arXiv},
eprint = {2211.05256},
timestamp = {Thu, 01 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-05256.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-08888,
author = {Ting{-}Hsuan Liao and
Huang{-}Ru Liao and
Shan{-}Ya Yang and
Jie{-}En Yao and
Li{-}Yuan Tsao and
Hsu{-}Shen Liu and
Bo{-}Wun Cheng and
Chen{-}Hao Chao and
Chia{-}Che Chang and
Yi{-}Chen Lo and
Chun{-}Yi Lee},
title = {{ELDA:} Using Edges to Have an Edge on Semantic Segmentation Based
{UDA}},
journal = {CoRR},
volume = {abs/2211.08888},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.08888},
doi = {10.48550/ARXIV.2211.08888},
eprinttype = {arXiv},
eprint = {2211.08888},
timestamp = {Wed, 23 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-08888.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AhmadLKCCNLHCCG21,
author = {Zohauddin Ahmad and
Yan{-}Min Liao and
Sheng{-}I Kuo and
You{-}Chia Chang and
Rui{-}Lin Chao and
Naseem and
Yi{-}Shan Lee and
Yung{-}Jr Hung and
Huang{-}Ming Chen and
Jyehong Chen and
Jiun{-}In Guo and
Jin{-}Wei Shi},
title = {High-Power and High-Responsivity Avalanche Photodiodes for Self-Heterodyne
{FMCW} Lidar System Applications},
journal = {{IEEE} Access},
volume = {9},
pages = {85661--85671},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3089082},
doi = {10.1109/ACCESS.2021.3089082},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/AhmadLKCCNLHCCG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/TinTYKTLTTP21,
author = {Tze Chiang Tin and
Saw Chin Tan and
Hing Yong and
Jimmy Ook Hyun Kim and
Eric Ken Yong Teo and
Ching Kwang Lee and
Peter Than and
Angela Pei San Tan and
Siew Chee Phang},
title = {A Realizable Overlay Virtual Metrology System in Semiconductor Manufacturing:
Proposal, Challenges and Future Perspective},
journal = {{IEEE} Access},
volume = {9},
pages = {65418--65439},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3076193},
doi = {10.1109/ACCESS.2021.3076193},
timestamp = {Sun, 16 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/TinTYKTLTTP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/TinTYKTWLTTP21,
author = {Tze Chiang Tin and
Saw Chin Tan and
Hing Yong and
Jimmy Ook Hyun Kim and
Eric Ken Yong Teo and
Joanne Ching Yee Wong and
Ching Kwang Lee and
Peter Than and
Angela Pei San Tan and
Siew Chee Phang},
title = {The Implementation of a Smart Sampling Scheme {C2O} Utilizing Virtual
Metrology in Semiconductor Manufacturing},
journal = {{IEEE} Access},
volume = {9},
pages = {114255--114266},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3103235},
doi = {10.1109/ACCESS.2021.3103235},
timestamp = {Thu, 02 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/TinTYKTWLTTP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/axioms/ChenCL21,
author = {Yu{-}Ting Chen and
Chian{-}Song Chiu and
Ya{-}Ting Lee},
title = {Grey Estimator-Based Tracking Controller Applied to Swarm Robot Formation},
journal = {Axioms},
volume = {10},
number = {4},
pages = {298},
year = {2021},
url = {https://doi.org/10.3390/axioms10040298},
doi = {10.3390/AXIOMS10040298},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/axioms/ChenCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ChenLLPHL21,
author = {Ping{-}Nan Chen and
Chia{-}Chiang Lee and
Chang{-}Min Liang and
Shu{-}I Pao and
Ke{-}Hao Huang and
Ke{-}Feng Lin},
title = {General deep learning model for detecting diabetic retinopathy},
journal = {{BMC} Bioinform.},
volume = {22-S},
number = {5},
pages = {84},
year = {2021},
url = {https://doi.org/10.1186/s12859-021-04005-x},
doi = {10.1186/S12859-021-04005-X},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/ChenLLPHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/YangBLC21,
author = {Fan Pei Gloria Yang and
Sukhdeep Singh Bal and
Jia{-}Fu Lee and
Chia{-}Chi Chen},
title = {White Matter Differences in Networks in Elders with Mild Cognitive
Impairment and Alzheimer's Disease},
journal = {Brain Connect.},
volume = {11},
number = {3},
pages = {180--188},
year = {2021},
url = {https://doi.org/10.1089/brain.2020.0767},
doi = {10.1089/BRAIN.2020.0767},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/brain/YangBLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/TanCLST21,
author = {Alvin Pengshi Tan and
Chee Hoong Cheong and
Tong Lee and
Kok{-}Yong Seng and
Chiang Juay Teo},
title = {Computer modelling of heat strain responses of exercising personnel
in tropical climate},
journal = {Comput. Biol. Medicine},
volume = {134},
pages = {104530},
year = {2021},
url = {https://doi.org/10.1016/j.compbiomed.2021.104530},
doi = {10.1016/J.COMPBIOMED.2021.104530},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/TanCLST21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LinHLLLLPSF21,
author = {Ching{-}Heng Lin and
Kai{-}Cheng Hsu and
Chih{-}Kuang Liang and
Tsong{-}Hai Lee and
Chia{-}Wei Liou and
Jiann{-}Der Lee and
Tsung{-}I Peng and
Ching{-}Sen Shih and
Yang C. Fann},
title = {A disease-specific language representation model for cerebrovascular
disease research},
journal = {Comput. Methods Programs Biomed.},
volume = {211},
pages = {106446},
year = {2021},
url = {https://doi.org/10.1016/j.cmpb.2021.106446},
doi = {10.1016/J.CMPB.2021.106446},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/LinHLLLLPSF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LinCPYL21,
author = {Shih{-}Wei Lin and
Chen{-}Yang Cheng and
Pourya Pourhejazy and
Kuo{-}Ching Ying and
Chia{-}Hui Lee},
title = {New benchmark algorithm for hybrid flowshop scheduling with identical
machines},
journal = {Expert Syst. Appl.},
volume = {183},
pages = {115422},
year = {2021},
url = {https://doi.org/10.1016/j.eswa.2021.115422},
doi = {10.1016/J.ESWA.2021.115422},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/LinCPYL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcon/ChengL21,
author = {Chih{-}Chiang Cheng and
Jyun{-}Jie Lee},
title = {Design of adaptive terminal super-twisting controllers for nonlinear
systems with mismatched perturbations},
journal = {Int. J. Control},
volume = {94},
number = {8},
pages = {2021--2031},
year = {2021},
url = {https://doi.org/10.1080/00207179.2019.1690692},
doi = {10.1080/00207179.2019.1690692},
timestamp = {Tue, 27 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcon/ChengL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/ChenHCL21,
author = {Yi{-}Chung Chen and
Hsi{-}Ho Huang and
Sheng{-}Min Chiu and
Chiang Lee},
title = {Joint Promotion Partner Recommendation Systems Using Data from Location-Based
Social Networks},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {10},
number = {2},
pages = {57},
year = {2021},
url = {https://doi.org/10.3390/ijgi10020057},
doi = {10.3390/IJGI10020057},
timestamp = {Wed, 07 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/ChenHCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijimai/JuanWLCYCS21,
author = {Chun{-}Jung Juan and
Chen{-}Shu Wang and
Bo{-}Yi Lee and
Shang{-}Yu Chiang and
Chun{-}Chang Yeh and
Der{-}Yang Cho and
Wu{-}Chung Shen},
title = {Integration of Genetic Programming and {TABU} Search Mechanism for
Automatic Detection of Magnetic Resonance Imaging in Cervical Spondylosis},
journal = {Int. J. Interact. Multim. Artif. Intell.},
volume = {6},
number = {7},
pages = {109},
year = {2021},
url = {https://doi.org/10.9781/ijimai.2021.08.006},
doi = {10.9781/IJIMAI.2021.08.006},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijimai/JuanWLCYCS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpe/LiangDCLCZH21,
author = {Wen{-}Hsuan Liang and
Dun{-}Wei Cheng and
Chih{-}Wei Hsu and
Chia{-}Wei Lee and
Chih{-}Heng Ke and
Albert Y. Zomaya and
Sun{-}Yuan Hsieh},
title = {Dynamic Flow Scheduling Technique for Load Balancing in Fat-Tree Data
Center Networks},
journal = {Int. J. Perform. Eng.},
volume = {17},
number = {6},
pages = {491},
year = {2021},
url = {https://doi.org/10.23940/ijpe.21.06.p1.491503},
doi = {10.23940/IJPE.21.06.P1.491503},
timestamp = {Tue, 14 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijpe/LiangDCLCZH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsn/ChenLCCL21,
author = {Chia{-}Mei Chen and
Gu Hsin Lai and
Zheng{-}Xun Cai and
Tzu{-}Ching Chang and
Boyi Lee},
title = {Detecting {PE} infection-based malware},
journal = {Int. J. Secur. Networks},
volume = {16},
number = {3},
pages = {191--199},
year = {2021},
url = {https://doi.org/10.1504/IJSN.2021.117871},
doi = {10.1504/IJSN.2021.117871},
timestamp = {Mon, 08 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijsn/ChenLCCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isj/LeeCC21a,
author = {Jung{-}Chieh Lee and
I{-}Chia Chou and
Chung{-}Yang Chen},
title = {The effect of process tailoring on software project performance: The
role of team absorptive capacity and its knowledge-based enablers},
journal = {Inf. Syst. J.},
volume = {31},
number = {1},
pages = {120--147},
year = {2021},
url = {https://doi.org/10.1111/isj.12303},
doi = {10.1111/ISJ.12303},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isj/LeeCC21a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/MaLLCL21,
author = {Shang{-}Pin Ma and
Chi{-}Chia Li and
Shin{-}Jie Lee and
Hsi{-}Min Chen and
Wen{-}Tin Lee},
title = {Cache-Enabled and Context-Aware Approach to Building Composite Mobile
Apps},
journal = {J. Inf. Sci. Eng.},
volume = {37},
number = {1},
pages = {123--138},
year = {2021},
url = {https://jise.iis.sinica.edu.tw/JISESearch/pages/View/PaperView.jsf?keyId=178\_2390},
timestamp = {Fri, 17 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/MaLLCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jitt/LeeCWX21,
author = {Chien{-}Chiang Lee and
Mei{-}Ping Chen and
Wenmin Wu and
Wenwu Xing},
title = {The impacts of ICTs on tourism development: International evidence
based on a panel quantile approach},
journal = {J. Inf. Technol. Tour.},
volume = {23},
number = {4},
pages = {509--547},
year = {2021},
url = {https://doi.org/10.1007/s40558-021-00215-4},
doi = {10.1007/S40558-021-00215-4},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jitt/LeeCWX21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/WangYHLLZ21,
author = {Chun{-}Yi Wang and
Chi{-}Yu You and
Fu{-}Hau Hsu and
Chia{-}Hao Lee and
Che{-}Hao Liu and
YungYu Zhuang},
title = {{SMS} Observer: {A} dynamic mechanism to analyze the behavior of SMS-based
malware},
journal = {J. Parallel Distributed Comput.},
volume = {156},
pages = {25--37},
year = {2021},
url = {https://doi.org/10.1016/j.jpdc.2021.05.004},
doi = {10.1016/J.JPDC.2021.05.004},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/WangYHLLZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangHCTTCLYHLKW21,
author = {Sung{-}Hao Wang and
Yu{-}Kai Huang and
Ching{-}Yuan Chen and
Li{-}Yang Tang and
Yen{-}Fu Tu and
Po{-}Chih Chang and
Chia{-}Fone Lee and
Chia{-}Hsiang Yang and
Chung{-}Chih Hung and
Chien{-}Hao Liu and
Ming{-}Dou Ker and
Chung{-}Yu Wu},
title = {Design of a Bone-Guided Cochlear Implant Microsystem With Monopolar
Biphasic Multiple Stimulations and Evoked Compound Action Potential
Acquisition and Its In Vivo Verification},
journal = {{IEEE} J. Solid State Circuits},
volume = {56},
number = {10},
pages = {3062--3076},
year = {2021},
url = {https://doi.org/10.1109/JSSC.2021.3087629},
doi = {10.1109/JSSC.2021.3087629},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WangHCTTCLYHLKW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WuCYLYCCCLCCHY21,
author = {Yi{-}Chung Wu and
Yen{-}Lung Chen and
Chung{-}Hsuan Yang and
Chao{-}Hsi Lee and
Chao{-}Yang Yu and
Nian{-}Shyang Chang and
Ling{-}Chien Chen and
Jia{-}Rong Chang and
Chun{-}Pin Lin and
Hung{-}Lieh Chen and
Chi{-}Shi Chen and
Jui{-}Hung Hung and
Chia{-}Hsiang Yang},
title = {A 975-mW Fully Integrated Genetic Variant Discovery System-on-Chip
in 28 nm for Next-Generation Sequencing},
journal = {{IEEE} J. Solid State Circuits},
volume = {56},
number = {1},
pages = {123--135},
year = {2021},
url = {https://doi.org/10.1109/JSSC.2020.3031183},
doi = {10.1109/JSSC.2020.3031183},
timestamp = {Sat, 09 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/WuCYLYCCCLCCHY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/ShihCL21,
author = {Chiao{-}Yin Shih and
Ya{-}Hsuan Chen and
Tong{-}Yee Lee},
title = {Map art style transfer with multi-stage framework},
journal = {Multim. Tools Appl.},
volume = {80},
number = {3},
pages = {4279--4293},
year = {2021},
url = {https://doi.org/10.1007/s11042-020-09788-4},
doi = {10.1007/S11042-020-09788-4},
timestamp = {Tue, 19 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mta/ShihCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/LinLAJYLCK21,
author = {Fa{-}Hsuan Lin and
Hsin{-}Ju Lee and
Jyrki Ahveninen and
Iiro P. J{\"{a}}{\"{a}}skel{\"{a}}inen and
Hsiang{-}Yu Yu and
Cheng{-}Chia Lee and
Chien{-}Chen Chou and
Wen{-}Jui Kuo},
title = {Distributed source modeling of intracranial stereoelectro-encephalographic
measurements},
journal = {NeuroImage},
volume = {230},
pages = {117746},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.117746},
doi = {10.1016/J.NEUROIMAGE.2021.117746},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/LinLAJYLCK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SchillingRPHNYG21,
author = {Kurt G. Schilling and
Fran{\c{c}}ois Rheault and
Laurent Petit and
Colin B. Hansen and
Vishwesh Nath and
Fang{-}Cheng Yeh and
Gabriel Girard and
Muhamed Barakovic and
Jonathan Rafael{-}Patino and
Thomas Yu and
Elda Fischi Gomez and
Marco Pizzolato and
Mario Ocampo{-}Pineda and
Simona Schiavi and
Erick Jorge Canales{-}Rodr{\'{\i}}guez and
Alessandro Daducci and
Cristina Granziera and
Giorgio M. Innocenti and
Jean{-}Philippe Thiran and
Laura Mancini and
Stephen J. Wastling and
Sirio Cocozza and
Maria Petracca and
Giuseppe Pontillo and
Matteo Mancini and
Sjoerd B. Vos and
Vejay N. Vakharia and
John S. Duncan and
Helena Melero and
Lidia Manzanedo and
Emilio Sanz{-}Morales and
{\'{A}}ngel Pe{\~{n}}a{-}Meli{\'{a}}n and
Fernando Calamante and
Arnaud Attye and
Ryan P. Cabeen and
Laura Korobova and
Arthur W. Toga and
Anupa Ambili Vijayakumari and
Drew Parker and
Ragini Verma and
Ahmed M. Radwan and
Stefan Sunaert and
Louise Emsell and
Alberto De Luca and
Alexander Leemans and
Claude J. Bajada and
Hamied A. Haroon and
Hojjatollah Azadbakht and
Maxime Chamberland and
Sila Genc and
Chantal M. W. Tax and
Ping Hong Yeh and
Rujirutana Srikanchana and
Colin D. Mcknight and
Joseph Yuan{-}Mou Yang and
Jian Chen and
Claire E. Kelly and
Chun{-}Hung Yeh and
J{\'{e}}r{\^{o}}me Cochereau and
Jerome J. Maller and
Thomas Welton and
Fabien Almairac and
Kiran K. Seunarine and
Chris A. Clark and
Fan Zhang and
Nikos Makris and
Alexandra J. Golby and
Yogesh Rathi and
Lauren J. O'Donnell and
Yihao Xia and
Dogu Baran Aydogan and
Yonggang Shi and
Francisco Guerreiro Fernandes and
Mathijs Raemaekers and
Shaun Warrington and
Stijn Michielse and
Alonso Ramirez{-}Manzanares and
Luis Concha and
Ram{\'{o}}n Aranda and
Mariano Rivera Meraz and
Garikoitz Lerma{-}Usabiaga and
Lucas Roitman and
Lucius S. Fekonja and
Navona Calarco and
Michael Joseph and
Hajer Nakua and
Aristotle N. Voineskos and
Philippe Karan and
Gabrielle Grenier and
Jon Haitz Legarreta and
Nagesh Adluru and
Veena A. Nair and
Vivek Prabhakaran and
Andrew L. Alexander and
Koji Kamagata and
Yuya Saito and
Wataru Uchida and
Christina Andica and
Masahiro Abe and
Roza G. Bayrak and
Claudia A. M. Gandini Wheeler{-}Kingshott and
Egidio D'Angelo and
Fulvia Palesi and
Giovanni Savini and
Nicol{\`{o}} Rolandi and
Pamela Guevara and
Josselin Houenou and
Narciso L{\'{o}}pez{-}L{\'{o}}pez and
Jean{-}Fran{\c{c}}ois Mangin and
Cyril Poupon and
Claudio Rom{\'{a}}n and
Andrea V{\'{a}}zquez and
Chiara Maffei and
Mavilde Arantes and
Jos{\'{e}} Paulo Andrade and
Susana Maria Silva and
Vince D. Calhoun and
Eduardo Caverzasi and
Simone Sacco and
Michael Lauricella and
Franco Pestilli and
Daniel Bullock and
Yang Zhan and
Edith Brignoni{-}P{\'{e}}rez and
Catherine Lebel and
Jess E Reynolds and
Igor Nestrasil and
Ren{\'{e}} Labounek and
Christophe Lenglet and
Amy Paulson and
Stefania Aulicka and
Sarah R. Heilbronner and
Katja Heuer and
Bramsh Qamar Chandio and
Javier Guaje and
Wei Tang and
Eleftherios Garyfallidis and
Rajikha Raja and
Adam W. Anderson and
Bennett A. Landman and
Maxime Descoteaux},
title = {Tractography dissection variability: What happens when 42 groups dissect
14 white matter bundles on the same dataset?},
journal = {NeuroImage},
volume = {243},
pages = {118502},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118502},
doi = {10.1016/J.NEUROIMAGE.2021.118502},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/SchillingRPHNYG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LiuLTLHMLLWKLWC21,
author = {Wen{-}Te Liu and
Shang{-}Yang Lin and
Cheng{-}Yu Tsai and
Yi{-}Shin Liu and
Wen{-}Hua Hsu and
Arnab Majumdar and
Chia{-}Mo Lin and
Kang{-}Yun Lee and
Dean Wu and
Yi{-}Chun Kuan and
Hsin{-}Chien Lee and
Cheng{-}Jung Wu and
Wun{-}Hao Cheng and
Ying{-}Shuo Hsu},
title = {Comparison of Hospital-Based and Home-Based Obstructive Sleep Apnoea
Severity Measurements with a Single-Lead Electrocardiogram Patch},
journal = {Sensors},
volume = {21},
number = {23},
pages = {8097},
year = {2021},
url = {https://doi.org/10.3390/s21238097},
doi = {10.3390/S21238097},
timestamp = {Fri, 21 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/LiuLTLHMLLWKLWC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/LeeLCLHHWLSC21,
author = {Shuenn{-}Yuh Lee and
Hao{-}Yun Lee and
Ding{-}Siang Ciou and
Zhan{-}Xian Liao and
Peng{-}Wei Huang and
Yi{-}Ting Hsieh and
Yi{-}Chieh Wei and
Chia{-}Yu Lin and
Meng{-}Dar Shieh and
Ju{-}Yi Chen},
title = {A Portable Wireless Urine Detection System With Power-Efficient Electrochemical
Readout {ASIC} and {ABTS-CNT} Biosensor for {UACR} Detection},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {15},
number = {3},
pages = {537--548},
year = {2021},
url = {https://doi.org/10.1109/TBCAS.2021.3087475},
doi = {10.1109/TBCAS.2021.3087475},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbcas/LeeLCLHHWLSC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/ChenHL21,
author = {Yu{-}Hsiang Chen and
Chia{-}Ming Hsu and
Kuen{-}Jong Lee},
title = {Test Chips With Scan-Based Logic Arrays},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {40},
number = {4},
pages = {790--802},
year = {2021},
url = {https://doi.org/10.1109/TCAD.2020.3010478},
doi = {10.1109/TCAD.2020.3010478},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/ChenHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/LeePHKKGLC21,
author = {Daeyeal Lee and
Dongwon Park and
Chia{-}Tung Ho and
Ilgweon Kang and
Hayoung Kim and
Sicun Gao and
Bill Lin and
Chung{-}Kuan Cheng},
title = {SP{\&}R: SMT-Based Simultaneous Place-and-Route for Standard Cell
Synthesis of Advanced Nodes},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {40},
number = {10},
pages = {2142--2155},
year = {2021},
url = {https://doi.org/10.1109/TCAD.2020.3037885},
doi = {10.1109/TCAD.2020.3037885},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/LeePHKKGLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/HsuLWWTWHLC21,
author = {Yvonne Chiung{-}Fang Hsu and
Hsiao{-}Ting Lee and
Yu{-}Jen Wang and
Miao{-}Ci Wang and
Chiao{-}Ling Tsai and
Jian{-}Kuen Wu and
Tzu{-}Jie Huang and
Chii{-}Wann Lin and
Jason Chia{-}Hsien Cheng},
title = {Using Megavoltage Computed Tomography to Estimate Radiotherapy Dose
for High-Density Metallic Implants},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {70},
pages = {1--11},
year = {2021},
url = {https://doi.org/10.1109/TIM.2021.3061259},
doi = {10.1109/TIM.2021.3061259},
timestamp = {Tue, 23 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/HsuLWWTWHLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/KungHHLYK21,
author = {Bo{-}Han Kung and
Po{-}Yuan Hu and
Chiu{-}Chang Huang and
Cheng{-}Che Lee and
Chia{-}Yu Yao and
Chieh{-}Hsiung Kuan},
title = {An Efficient {ECG} Classification System Using Resource-Saving Architecture
and Random Forest},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {25},
number = {6},
pages = {1904--1914},
year = {2021},
url = {https://doi.org/10.1109/JBHI.2020.3035191},
doi = {10.1109/JBHI.2020.3035191},
timestamp = {Sat, 31 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/KungHHLYK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/ChengHLLP21,
author = {Chung{-}Kuan Cheng and
Chia{-}Tung Ho and
Daeyeal Lee and
Bill Lin and
Dongwon Park},
title = {Complementary-FET {(CFET)} Standard Cell Synthesis Framework for Design
and System Technology Co-Optimization Using {SMT}},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {29},
number = {6},
pages = {1178--1191},
year = {2021},
url = {https://doi.org/10.1109/TVLSI.2021.3065639},
doi = {10.1109/TVLSI.2021.3065639},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvlsi/ChengHLLP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aicas/HuCCSHXWPSTLLWL21,
author = {Xiao Hu and
Ming{-}Ching Chang and
Yuwei Chen and
Rahul Sridhar and
Zhenyu Hu and
Yunhe Xue and
Zhenyu Wu and
Pengcheng Pi and
Jiayi Shen and
Jianchao Tan and
Xiangru Lian and
Ji Liu and
Zhangyang Wang and
Chia{-}Hsiang Liu and
Yu{-}Shin Han and
Yuan{-}Yao Sung and
Yi Lee and
Kai{-}Chiang Wu and
Wei{-}Xiang Guo and
Rick Lee and
Shengwen Liang and
Zerun Wang and
Guiguang Ding and
Gang Zhang and
Teng Xi and
Yubei Chen and
Han Cai and
Ligeng Zhu and
Zhekai Zhang and
Song Han and
Seonghwan Jeong and
YoungMin Kwon and
Tianzhe Wang and
Jeffery Pan},
title = {The 2020 Low-Power Computer Vision Challenge},
booktitle = {3rd {IEEE} International Conference on Artificial Intelligence Circuits
and Systems, {AICAS} 2021, Washington, DC, USA, June 6-9, 2021},
pages = {1--4},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/AICAS51828.2021.9458522},
doi = {10.1109/AICAS51828.2021.9458522},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aicas/HuCCSHXWPSTLLWL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/KanCLL21,
author = {Yao{-}Chiang Kan and
Kuan{-}Tzu Chen and
Hsueh{-}Chun Lin and
Junghsi Lee},
title = {A Parking Monitoring System Using {FMCW} Radars},
booktitle = {Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} {ASC} 2021, Tokyo, Japan, December
14-17, 2021},
pages = {1931--1934},
publisher = {{IEEE}},
year = {2021},
url = {https://ieeexplore.ieee.org/document/9689577},
timestamp = {Wed, 09 Feb 2022 09:03:08 +0100},
biburl = {https://dblp.org/rec/conf/apsipa/KanCLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/ChenCLZY21,
author = {Po{-}Shao Chen and
Yen{-}Lung Chen and
Yu{-}Chi Lee and
Zih{-}Sing Fu and
Chia{-}Hsiang Yang},
title = {A 28.8mW Accelerator {IC} for Dark Channel Prior Based Blind Image
Deblurring},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2021, Busan,
Korea, Republic of, November 7-10, 2021},
pages = {1--3},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/A-SSCC53895.2021.9634738},
doi = {10.1109/A-SSCC53895.2021.9634738},
timestamp = {Thu, 04 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/ChenCLZY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/ChiangCLFWLYC21,
author = {Chia{-}En Chiang and
Yu{-}Chun Chen and
Fang{-}Yu Lin and
Felicia Feng and
Hao{-}An Wu and
Hao{-}Ping Lee and
Chang{-}Hsuan Yang and
Yung{-}Ju Chang},
editor = {Yoshifumi Kitamura and
Aaron Quigley and
Katherine Isbister and
Takeo Igarashi and
Pernille Bj{\o}rn and
Steven Mark Drucker},
title = {"I Got Some Free Time": Investigating Task-execution and Task-effort
Metrics in Mobile Crowdsourcing Tasks},
booktitle = {{CHI} '21: {CHI} Conference on Human Factors in Computing Systems,
Virtual Event / Yokohama, Japan, May 8-13, 2021},
pages = {648:1--648:14},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3411764.3445477},
doi = {10.1145/3411764.3445477},
timestamp = {Mon, 17 May 2021 13:31:38 +0200},
biburl = {https://dblp.org/rec/conf/chi/ChiangCLFWLYC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csci/LeeLC21,
author = {Greg C. Lee and
Yu{-}Che Lee and
Cheng{-}Chieh Chiang},
title = {Low-Resolution Face Recognition in Multi-person Indoor Environments
Using Convolutional Neural Networks},
booktitle = {International Conference on Computational Science and Computational
Intelligence, {CSCI} 2021, Las Vegas, NV, USA, December 15-17, 2021},
pages = {1629--1633},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CSCI54926.2021.00313},
doi = {10.1109/CSCI54926.2021.00313},
timestamp = {Tue, 23 Apr 2024 12:44:18 +0200},
biburl = {https://dblp.org/rec/conf/csci/LeeLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/desec/LeeLHHCS21,
author = {Shan{-}Hsin Lee and
Shen{-}Chieh Lan and
Hsiu{-}Chuan Huang and
Chia{-}Wei Hsu and
Yung{-}Shiu Chen and
Shiuhpyng Shieh},
title = {EC-Model: An Evolvable Malware Classification Model},
booktitle = {{IEEE} Conference on Dependable and Secure Computing, {DSC} 2021,
Aizuwakamatsu, Japan, January 30 - February 2, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/DSC49826.2021.9346248},
doi = {10.1109/DSC49826.2021.9346248},
timestamp = {Wed, 17 Feb 2021 11:46:28 +0100},
biburl = {https://dblp.org/rec/conf/desec/LeeLHHCS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ei-iss/ChangLTLCWWT21,
author = {Yu{-}Chi Chang and
Cheng{-}Hsuan Lin and
Zong{-}Ru Tu and
Jing{-}Hua Lee and
Sheng Chuan Cheng and
Ching{-}Chiang Wu and
Ken Wu and
H. J. Tsai},
editor = {Jon S. McElvain and
Arnaud Peizerat and
Nitin Sampat and
Ralf Widenhorn},
title = {0.8 um Color Pixels with Wave-Guiding Structures for Low Optical Crosstalk
Image Sensors},
booktitle = {Imaging Sensors and Systems 2021, online, January 11-28, 2021},
pages = {1--5},
publisher = {Society for Imaging Science and Technology},
year = {2021},
url = {https://doi.org/10.2352/ISSN.2470-1173.2021.7.ISS-093},
doi = {10.2352/ISSN.2470-1173.2021.7.ISS-093},
timestamp = {Thu, 20 Jul 2023 16:45:52 +0200},
biburl = {https://dblp.org/rec/conf/ei-iss/ChangLTLCWWT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/KuoLL21,
author = {Pei{-}Hsuan Kuo and
Cheng{-}Chia Lee and
Chia{-}Feng Lu},
title = {Radiomics-based Prediction of Re-hemorrhage in Cerebral Cavernous
Malformation after Gamma Knife Radiosurgery},
booktitle = {43rd Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2021, Mexico, November 1-5,
2021},
pages = {3668--3671},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/EMBC46164.2021.9629762},
doi = {10.1109/EMBC46164.2021.9629762},
timestamp = {Wed, 22 Dec 2021 13:55:55 +0100},
biburl = {https://dblp.org/rec/conf/embc/KuoLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/00010O21,
author = {Chia{-}Hsuan Lee and
Hao Cheng and
Mari Ostendorf},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {Dialogue State Tracking with a Language Model using Schema-Driven
Prompting},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {4937--4949},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.404},
doi = {10.18653/V1/2021.EMNLP-MAIN.404},
timestamp = {Fri, 16 Feb 2024 08:27:36 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/00010O21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iasam/WuLWLCLL21,
author = {Chen{-}Han Wu and
Ching{-}Jung Liao and
Yung{-}Fu Wang and
Chun{-}Feng Lin and
Chia{-}Chi Chu and
Sheng{-}Huei Lee and
Yu{-}Jen Lin},
title = {The Refinement of Generation Scheduling and Underfrequency Load Shedding
Protection Scheme for Nangan-Beigan Power System in Taiwan},
booktitle = {{IEEE} Industry Applications Society Annual Meeting, {IAS} 2021, Vancouver,
BC, Canada, October 10-14, 2021},
pages = {1--7},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IAS48185.2021.9677145},
doi = {10.1109/IAS48185.2021.9677145},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iasam/WuLWLCLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/ChenLLL21,
author = {Kuan{-}Fu Chen and
Chia{-}Hung Lin and
Ming{-}Chun Lee and
Ta{-}Sung Lee},
title = {Deep Learning-Based Multi-Fault Diagnosis for Self-Organizing Networks},
booktitle = {{ICC} 2021 - {IEEE} International Conference on Communications, Montreal,
QC, Canada, June 14-23, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICC42927.2021.9500296},
doi = {10.1109/ICC42927.2021.9500296},
timestamp = {Mon, 09 Aug 2021 11:13:44 +0200},
biburl = {https://dblp.org/rec/conf/icc/ChenLLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/ChiuLC21,
author = {Chen Chiu and
Jin{-}Shyan Lee and
Hsin{-}Han Chiang},
title = {Design and Implementation of Smart Agricultural Systems Based on Networked
{PLC} and Mobile App},
booktitle = {{IEEE} International Conference on Consumer Electronics-Taiwan, {ICCE-TW}
2021, Penghu, Taiwan, September 15-17, 2021},
pages = {1--2},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCE-TW52618.2021.9603185},
doi = {10.1109/ICCE-TW52618.2021.9603185},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/ChiuLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/FangHWLW21,
author = {Tung Jing Fang and
Chen Han and
Chuan Chia Wang and
Lai{-}Chung Lee and
Whei{-}Jane Wei},
title = {Towards Personalized Real-time Cardiodynamic Status Monitoring: Multi-scale
Modeling of the Heart Sound},
booktitle = {{IEEE} International Conference on Consumer Electronics-Taiwan, {ICCE-TW}
2021, Penghu, Taiwan, September 15-17, 2021},
pages = {1--2},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCE-TW52618.2021.9602890},
doi = {10.1109/ICCE-TW52618.2021.9602890},
timestamp = {Tue, 23 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/FangHWLW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/WuLHLSHH21,
author = {Tsung{-}Han Wu and
Yueh{-}Cheng Liu and
Yu{-}Kai Huang and
Hsin{-}Ying Lee and
Hung{-}Ting Su and
Ping{-}Chia Huang and
Winston H. Hsu},
title = {ReDAL: Region-based and Diversity-aware Active Learning for Point
Cloud Semantic Segmentation},
booktitle = {2021 {IEEE/CVF} International Conference on Computer Vision, {ICCV}
2021, Montreal, QC, Canada, October 10-17, 2021},
pages = {15490--15499},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCV48922.2021.01522},
doi = {10.1109/ICCV48922.2021.01522},
timestamp = {Wed, 28 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/WuLHLSHH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icppw/LinLLWH21,
author = {Che{-}Chia Lin and
Chao{-}Lin Lee and
Jenq{-}Kuen Lee and
Howard Wang and
Ming{-}Yu Hung},
editor = {Federico Silla and
Osni Marques},
title = {Accelerate Binarized Neural Networks with Processing-in-Memory Enabled
by {RISC-V} Custom Instructions},
booktitle = {{ICPP} Workshops 2021: 50th International Conference on Parallel Processing,
Virtual Event / Lemont (near Chicago), IL, USA, August 9-12, 2021},
pages = {15:1--15:8},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3458744.3473351},
doi = {10.1145/3458744.3473351},
timestamp = {Tue, 28 Sep 2021 14:37:48 +0200},
biburl = {https://dblp.org/rec/conf/icppw/LinLLWH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icvisp/AparowHWHYHHYW21,
author = {Vimal Rau Aparow and
Cheok Jun Hong and
Ng Yuan Weun and
Chai Chee Huei and
Tiong Kai Yen and
Lee Chen Hong and
Chia Yu Hang and
Teoh Xin Yi and
Khoo Kai Wen},
title = {Scenario based Simulation Testing of Autonomous Vehicle using Malaysian
Road},
booktitle = {5th International Conference on Vision, Image and Signal Processing,
{ICVISP} 2021, Kuala Lumpur, Malaysia, December 18-20, 2021},
pages = {33--38},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICVISP54630.2021.00015},
doi = {10.1109/ICVISP54630.2021.00015},
timestamp = {Mon, 21 Feb 2022 14:42:14 +0100},
biburl = {https://dblp.org/rec/conf/icvisp/AparowHWHYHHYW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeesensors/ChungLRLSY21,
author = {Chiao{-}Teng Jordan Chung and
Chih{-}Cheng Lu and
Wei{-}Shu Rih and
Ching{-}Feng Lee and
Cheng{-}Ming Shih and
Yu{-}Li Yeh},
title = {An Ultra-low Power Voice Interface Design for {MEMS} Microphones Sensor},
booktitle = {2021 {IEEE} Sensors, Sydney, Australia, October 31 - Nov. 3, 2021},
pages = {1--4},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/SENSORS47087.2021.9639861},
doi = {10.1109/SENSORS47087.2021.9639861},
timestamp = {Wed, 14 Dec 2022 15:07:35 +0100},
biburl = {https://dblp.org/rec/conf/ieeesensors/ChungLRLSY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WuHLPHTWT21,
author = {Yi{-}Chiao Wu and
Cheng{-}Hung Hu and
Hung{-}Shin Lee and
Yu{-}Huai Peng and
Wen{-}Chin Huang and
Yu Tsao and
Hsin{-}Min Wang and
Tomoki Toda},
editor = {Hynek Hermansky and
Honza Cernock{\'{y}} and
Luk{\'{a}}s Burget and
Lori Lamel and
Odette Scharenborg and
Petr Motl{\'{\i}}cek},
title = {Relational Data Selection for Data Augmentation of Speaker-Dependent
Multi-Band MelGAN Vocoder},
booktitle = {22nd Annual Conference of the International Speech Communication Association,
Interspeech 2021, Brno, Czechia, August 30 - September 3, 2021},
pages = {3630--3634},
publisher = {{ISCA}},
year = {2021},
url = {https://doi.org/10.21437/Interspeech.2021-806},
doi = {10.21437/INTERSPEECH.2021-806},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/WuHLPHTWT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/LiangL21,
author = {Chia{-}Chun Liang and
Che{-}Rung Lee},
title = {Automatic Selection of Tensor Decomposition for Compressing Convolutional
Neural Networks {A} Case Study on VGG-type Networks},
booktitle = {{IEEE} International Parallel and Distributed Processing Symposium
Workshops, {IPDPS} Workshops 2021, Portland, OR, USA, June 17-21,
2021},
pages = {770--778},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IPDPSW52791.2021.00115},
doi = {10.1109/IPDPSW52791.2021.00115},
timestamp = {Mon, 28 Jun 2021 11:45:26 +0200},
biburl = {https://dblp.org/rec/conf/ipps/LiangL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/VenkataramaniSW21,
author = {Swagath Venkataramani and
Vijayalakshmi Srinivasan and
Wei Wang and
Sanchari Sen and
Jintao Zhang and
Ankur Agrawal and
Monodeep Kar and
Shubham Jain and
Alberto Mannari and
Hoang Tran and
Yulong Li and
Eri Ogawa and
Kazuaki Ishizaki and
Hiroshi Inoue and
Marcel Schaal and
Mauricio J. Serrano and
Jungwook Choi and
Xiao Sun and
Naigang Wang and
Chia{-}Yu Chen and
Allison Allain and
James Bonanno and
Nianzheng Cao and
Robert Casatuta and
Matthew Cohen and
Bruce M. Fleischer and
Michael Guillorn and
Howard Haynie and
Jinwook Jung and
Mingu Kang and
Kyu{-}Hyoun Kim and
Siyu Koswatta and
Sae Kyu Lee and
Martin Lutz and
Silvia M. Mueller and
Jinwook Oh and
Ashish Ranjan and
Zhibin Ren and
Scot Rider and
Kerstin Schelm and
Michael Scheuermann and
Joel Silberman and
Jie Yang and
Vidhi Zalani and
Xin Zhang and
Ching Zhou and
Matthew M. Ziegler and
Vinay Shah and
Moriyoshi Ohara and
Pong{-}Fei Lu and
Brian W. Curran and
Sunil Shukla and
Leland Chang and
Kailash Gopalakrishnan},
title = {RaPiD: {AI} Accelerator for Ultra-low Precision Training and Inference},
booktitle = {48th {ACM/IEEE} Annual International Symposium on Computer Architecture,
{ISCA} 2021, Virtual Event / Valencia, Spain, June 14-18, 2021},
pages = {153--166},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISCA52012.2021.00021},
doi = {10.1109/ISCA52012.2021.00021},
timestamp = {Mon, 19 Feb 2024 07:32:07 +0100},
biburl = {https://dblp.org/rec/conf/isca/VenkataramaniSW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/LeeLCW21,
author = {Hsin{-}Tsung Lee and
Chia{-}Chun Lin and
Yung{-}Chih Chen and
Chun{-}Yao Wang},
title = {On Synthesizing Memristor-Based Logic Circuits in Area-Constrained
Crossbar Arrays},
booktitle = {22nd International Symposium on Quality Electronic Design, {ISQED}
2021, Santa Clara, CA, USA, April 7-9, 2021},
pages = {316},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISQED51717.2021.9424249},
doi = {10.1109/ISQED51717.2021.9424249},
timestamp = {Mon, 17 May 2021 16:05:56 +0200},
biburl = {https://dblp.org/rec/conf/isqed/LeeLCW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/AgrawalLSZKVCFG21,
author = {Ankur Agrawal and
Sae Kyu Lee and
Joel Silberman and
Matthew M. Ziegler and
Mingu Kang and
Swagath Venkataramani and
Nianzheng Cao and
Bruce M. Fleischer and
Michael Guillorn and
Matt Cohen and
Silvia M. Mueller and
Jinwook Oh and
Martin Lutz and
Jinwook Jung and
Siyu Koswatta and
Ching Zhou and
Vidhi Zalani and
James Bonanno and
Robert Casatuta and
Chia{-}Yu Chen and
Jungwook Choi and
Howard Haynie and
Alyssa Herbert and
Radhika Jain and
Monodeep Kar and
Kyu{-}Hyoun Kim and
Yulong Li and
Zhibin Ren and
Scot Rider and
Marcel Schaal and
Kerstin Schelm and
Michael Scheuermann and
Xiao Sun and
Hung Tran and
Naigang Wang and
Wei Wang and
Xin Zhang and
Vinay Shah and
Brian W. Curran and
Vijayalakshmi Srinivasan and
Pong{-}Fei Lu and
Sunil Shukla and
Leland Chang and
Kailash Gopalakrishnan},
title = {A 7nm 4-Core {AI} Chip with 25.6TFLOPS Hybrid {FP8} Training, 102.4TOPS
{INT4} Inference and Workload-Aware Throttling},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {144--146},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365791},
doi = {10.1109/ISSCC42613.2021.9365791},
timestamp = {Sat, 19 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/AgrawalLSZKVCFG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChenLNMMWGHRYMJ21,
author = {HsinChen Chen and
Rolf Lagerquist and
Ashish Nayak and
Hugh Mair and
Gokulakrishnan Manoharan and
Ericbill Wang and
Gordon Gammie and
Efron Ho and
Anand Rajagopalan and
Lee{-}Kee Yong and
Ramu Madhavaram and
Madhur Jagota and
Chi{-}Jui Chung and
Sudhakar Maruthi and
Jenny Wiedemeier and
Tao Chen and
Henry Hsieh and
Daniel Dia and
Amjad Sikiligiri and
Manzur Rahman and
Barry Chen and
Curtis Lin and
Vincent Lin and
Elly Chiang and
Cheng{-}Yuh Wu and
Po{-}Yang Hsu and
Jason Tsai and
Wade Wu and
Achuta Thippana and
S. A. Huang},
title = {A 7nm 5G Mobile SoC Featuring a 3.0GHz Tri-Gear Application Processor
Subsystem},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {54--56},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365774},
doi = {10.1109/ISSCC42613.2021.9365774},
timestamp = {Wed, 10 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/ChenLNMMWGHRYMJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChihLFSLNCLLMZS21,
author = {Yu{-}Der Chih and
Po{-}Hao Lee and
Hidehiro Fujiwara and
Yi{-}Chun Shih and
Chia{-}Fu Lee and
Rawan Naous and
Yu{-}Lin Chen and
Chieh{-}Pu Lo and
Cheng{-}Han Lu and
Haruki Mori and
Wei{-}Cheng Zhao and
Dar Sun and
Mahmut E. Sinangil and
Yen{-}Huei Chen and
Tan{-}Li Chou and
Kerem Akarvardar and
Hung{-}Jen Liao and
Yih Wang and
Meng{-}Fan Chang and
Tsung{-}Yung Jonathan Chang},
title = {An 89TOPS/W and 16.3TOPS/mm\({}^{\mbox{2}}\) All-Digital SRAM-Based
Full-Precision Compute-In Memory Macro in 22nm for Machine-Learning
Edge Applications},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {252--254},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365766},
doi = {10.1109/ISSCC42613.2021.9365766},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChihLFSLNCLLMZS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/misnc/ChiuCLLYLL21,
author = {Sheng{-}Min Chiu and
Yi{-}Chung Chen and
Yow{-}Shin Liou and
Chiang Lee and
Jia{-}Ching Ying and
Chee{-}Hoe Loh and
Jou{-}Wei Lin},
title = {A Fast, Interactive, Location-Based Food Recommendation Application},
booktitle = {{MISNC} 2021: The 8th Multidisciplinary International Social Networks
Conference, Bergen, Norway, November 15 - 17, 2021},
pages = {21--25},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3504006.3504010},
doi = {10.1145/3504006.3504010},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/misnc/ChiuCLLYLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobicom/WangCCTLXC21,
author = {Chia{-}Cheng Wang and
Jyh{-}Cheng Chen and
Yi Chen and
Rui{-}Heng Tu and
Jia{-}Jiun Lee and
Yu{-}Xin Xiao and
Shan{-}Yu Cai},
title = {{MVP:} magnetic vehicular positioning system for GNSS-denied environments},
booktitle = {{ACM} MobiCom '21: The 27th Annual International Conference on Mobile
Computing and Networking, New Orleans, Louisiana, USA, October 25-29,
2021},
pages = {531--544},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3447993.3483264},
doi = {10.1145/3447993.3483264},
timestamp = {Thu, 30 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mobicom/WangCCTLXC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/LeeCLLWTCWKLL21,
author = {Shao{-}Yung Lee and
Xin Chen and
Wei{-}Chi Lo and
Kangmei Li and
Chia{-}Hsuan Wang and
Cheng{-}Ting Tsai and
Chih{-}Hsien Cheng and
Chao{-}Hsin Wu and
Hao{-}Chung Kuo and
Ming{-}Jun Li and
Gong{-}Ru Lin},
title = {850-nm Dual-Mode {VCSEL} Carried 53-Gbps {NRZ-OOK} Transmission in
100-m Graded-Index Single-Mode Fiber},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2021,
San Francisco, CA, USA, June 6-10, 2021},
pages = {1--3},
publisher = {{IEEE}},
year = {2021},
url = {https://ieeexplore.ieee.org/document/9489901},
timestamp = {Tue, 04 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/LeeCLLWTCWKLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/snpd/LuCGLT21,
author = {You Cheng Lu and
Chia Wei Chen and
Xuan Jie Gong and
Kan Rong Lee and
Chung Jen Tseng},
title = {{CFD} Simulations for Thermal Comfort and Energy Saving},
booktitle = {22nd {IEEE/ACIS} International Conference on Software Engineering,
Artificial Intelligence, Networking and Parallel/Distributed Computing,
{SNPD} 2021, Taichung, Taiwan, November 24-26, 2021},
pages = {167--170},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/SNPD51163.2021.9704978},
doi = {10.1109/SNPD51163.2021.9704978},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/snpd/LuCGLT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socc/LinCKLLLLCW21,
author = {Yi{-}Ting Lin and
Chun{-}Jui Chen and
Pei{-}Yi Kuo and
Si{-}Huei Lee and
Chia{-}Chun Lin and
Yun{-}Ju Lee and
Yi{-}Ting Li and
Yung{-}Chih Chen and
Chun{-}Yao Wang},
editor = {Gang Qu and
Jinjun Xiong and
Danella Zhao and
Venki Muthukumar and
Md Farhadur Reza and
Ramalingam Sridhar},
title = {An IMU-aided Fitness System},
booktitle = {34th {IEEE} International System-on-Chip Conference, {SOCC} 2021,
Las Vegas, NV, USA, September 14-17, 2021},
pages = {224--229},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/SOCC52499.2021.9739294},
doi = {10.1109/SOCC52499.2021.9739294},
timestamp = {Wed, 30 Mar 2022 11:02:31 +0200},
biburl = {https://dblp.org/rec/conf/socc/LinCKLLLLCW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/YangYWCCCLKWC21,
author = {Cheng{-}Hao Yang and
Chia{-}Heng Yen and
Ting{-}Rui Wang and
Chun{-}Teng Chen and
Mason Chern and
Ying{-}Yen Chen and
Jih{-}Nung Lee and
Shu{-}Yi Kao and
Kai{-}Chiang Wu and
Mango Chia{-}Tso Chao},
title = {Identifying Good-Dice-in-Bad-Neighborhoods Using Artificial Neural
Networks},
booktitle = {39th {IEEE} {VLSI} Test Symposium, {VTS} 2021, San Diego, CA, USA,
April 25-28, 2021},
pages = {1--7},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/VTS50974.2021.9441055},
doi = {10.1109/VTS50974.2021.9441055},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vts/YangYWCCCLKWC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cocoon/2021,
editor = {Chi{-}Yeh Chen and
Wing{-}Kai Hon and
Ling{-}Ju Hung and
Chia{-}Wei Lee},
title = {Computing and Combinatorics - 27th International Conference, {COCOON}
2021, Tainan, Taiwan, October 24-26, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13025},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-89543-3},
doi = {10.1007/978-3-030-89543-3},
isbn = {978-3-030-89542-6},
timestamp = {Fri, 22 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cocoon/2021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/rocling/2021,
editor = {Lung{-}Hao Lee and
Chia{-}Hui Chang and
Kuan{-}Yu Chen},
title = {Proceedings of the 33rd Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2021, Taoyuan, Taiwan, October 15-16,
2021},
publisher = {The Association for Computational Linguistics and Chinese Language
Processing {(ACLCLP)}},
year = {2021},
url = {https://aclanthology.org/volumes/2021.rocling-1/},
isbn = {978-986-95769-4-9},
timestamp = {Tue, 26 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rocling/2021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-13329,
author = {Fu{-}En Yang and
Jing{-}Cheng Chang and
Yuan{-}Hao Lee and
Yu{-}Chiang Frank Wang},
title = {Dual-MTGAN: Stochastic and Deterministic Motion Transfer for Image-to-Video
Synthesis},
journal = {CoRR},
volume = {abs/2102.13329},
year = {2021},
url = {https://arxiv.org/abs/2102.13329},
eprinttype = {arXiv},
eprint = {2102.13329},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-13329.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-01840,
author = {Chi{-}Shiang Wang and
Fang{-}Yi Su and
Tsung{-}Lu Michael Lee and
Yi{-}Shan Tsai and
Jung{-}Hsien Chiang},
title = {{CUAB:} Convolutional Uncertainty Attention Block Enhanced the Chest
X-ray Image Analysis},
journal = {CoRR},
volume = {abs/2105.01840},
year = {2021},
url = {https://arxiv.org/abs/2105.01840},
eprinttype = {arXiv},
eprint = {2105.01840},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-01840.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-07809,
author = {Andrey Ignatov and
Cheng{-}Ming Chiang and
Hsien{-}Kai Kuo and
Anastasia Sycheva and
Radu Timofte and
Min{-}Hung Chen and
Man{-}Yu Lee and
Yu{-}Syuan Xu and
Yu Tseng and
Shusong Xu and
Jin Guo and
Chao{-}Hung Chen and
Ming{-}Chun Hsyu and
Wen{-}Chia Tsai and
Chao{-}Wei Chen and
Grigory Malivenko and
Minsu Kwon and
Myungje Lee and
Jaeyoon Yoo and
Changbeom Kang and
Shinjo Wang and
Zheng Shaolong and
Hao Dejun and
Xie Fen and
Feng Zhuang and
Yipeng Ma and
Jingyang Peng and
Tao Wang and
Fenglong Song and
Chih{-}Chung Hsu and
Kwan{-}Lin Chen and
Mei{-}Hsuang Wu and
Vishal M. Chudasama and
Kalpesh Prajapati and
Heena Patel and
Anjali Sarvaiya and
Kishor P. Upla and
Kiran B. Raja and
Raghavendra Ramachandra and
Christoph Busch and
Etienne de Stoutz},
title = {Learned Smartphone {ISP} on Mobile NPUs with Deep Learning, Mobile
{AI} 2021 Challenge: Report},
journal = {CoRR},
volume = {abs/2105.07809},
year = {2021},
url = {https://arxiv.org/abs/2105.07809},
eprinttype = {arXiv},
eprint = {2105.07809},
timestamp = {Tue, 18 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-07809.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-10696,
author = {Chia{-}Ming Chang and
Yi{-}Jheng Lin and
Cheng{-}Shang Chang and
Duan{-}Shin Lee},
title = {On the Stability Regions of Coded Poisson Receivers with Multiple
Classes of Users and Receivers},
journal = {CoRR},
volume = {abs/2107.10696},
year = {2021},
url = {https://arxiv.org/abs/2107.10696},
eprinttype = {arXiv},
eprint = {2107.10696},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-10696.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-11769,
author = {Tsung{-}Han Wu and
Yueh{-}Cheng Liu and
Yu{-}Kai Huang and
Hsin{-}Ying Lee and
Hung{-}Ting Su and
Ping{-}Chia Huang and
Winston H. Hsu},
title = {ReDAL: Region-based and Diversity-aware Active Learning for Point
Cloud Semantic Segmentation},
journal = {CoRR},
volume = {abs/2107.11769},
year = {2021},
url = {https://arxiv.org/abs/2107.11769},
eprinttype = {arXiv},
eprint = {2107.11769},
timestamp = {Wed, 28 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-11769.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-03537,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
title = {On the Transferability of Pre-trained Language Models: {A} Study from
Artificial Datasets},
journal = {CoRR},
volume = {abs/2109.03537},
year = {2021},
url = {https://arxiv.org/abs/2109.03537},
eprinttype = {arXiv},
eprint = {2109.03537},
timestamp = {Mon, 20 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-03537.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-07506,
author = {Chia{-}Hsuan Lee and
Hao Cheng and
Mari Ostendorf},
title = {Dialogue State Tracking with a Language Model using Schema-Driven
Prompting},
journal = {CoRR},
volume = {abs/2109.07506},
year = {2021},
url = {https://arxiv.org/abs/2109.07506},
eprinttype = {arXiv},
eprint = {2109.07506},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-07506.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChangYLLK20,
author = {Chih{-}Hung Chang and
Chao{-}Tung Yang and
Jheng{-}Yue Lee and
Chuan{-}Lin Lai and
Chia{-}Chen Kuo},
title = {On Construction and Performance Evaluation of a Virtual Desktop Infrastructure
With {GPU} Accelerated},
journal = {{IEEE} Access},
volume = {8},
pages = {170162--170173},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3023924},
doi = {10.1109/ACCESS.2020.3023924},
timestamp = {Tue, 06 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChangYLLK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HongLLLYMLHGCW20,
author = {Jia{-}Sheng Hong and
Chung{-}Jung Lin and
Yue{-}Hsin Lin and
Cheng{-}Chia Lee and
Huai{-}Che Yang and
Ling{-}Hsuan Meng and
Te{-}Ming Lin and
Yong{-}Sin Hu and
Wan{-}Yuo Guo and
Wei{-}Fa Chu and
Yu{-}Te Wu},
title = {Machine Learning Application With Quantitative Digital Subtraction
Angiography for Detection of Hemorrhagic Brain Arteriovenous Malformations},
journal = {{IEEE} Access},
volume = {8},
pages = {204573--204584},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3036692},
doi = {10.1109/ACCESS.2020.3036692},
timestamp = {Tue, 01 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/HongLLLYMLHGCW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LinCL20a,
author = {Sung{-}Chiang Lin and
Chih{-}Jou Chen and
Tsung{-}Ju Lee},
title = {A Multi-Label Classification With Hybrid Label-Based Meta-Learning
Method in Internet of Things},
journal = {{IEEE} Access},
volume = {8},
pages = {42261--42269},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.2976851},
doi = {10.1109/ACCESS.2020.2976851},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LinCL20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/WangLLLWLHHC20,
author = {Jung{-}Hua Wang and
Shih{-}Kai Lee and
Yi{-}Chung Lai and
Cheng{-}Chun Lin and
Ting{-}Yuan Wang and
Ying{-}Ren Lin and
Te{-}Hua Hsu and
Chang{-}Wen Huang and
Chung{-}Ping Chiang},
title = {Anomalous Behaviors Detection for Underwater Fish Using {AI} Techniques},
journal = {{IEEE} Access},
volume = {8},
pages = {224372--224382},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3043712},
doi = {10.1109/ACCESS.2020.3043712},
timestamp = {Sat, 09 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/WangLLLWLHHC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aci/BaxterGCHOEHCCK20,
author = {Sally L. Baxter and
Helena E. Gali and
Michael F. Chiang and
Michelle R. Hribar and
Lucila Ohno{-}Machado and
Robert El{-}Kareh and
Abigail E. Huang and
Heather E. Chen and
Andrew Camp and
Don O. Kikkawa and
Bobby S. Korn and
Jeffrey E. Lee and
Christopher A. Longhurst and
Marlene Millen},
title = {Promoting Quality Face-to-Face Communication during Ophthalmology
Encounters in the Electronic Health Record Era},
journal = {Appl. Clin. Inform.},
volume = {11},
number = {01},
pages = {130--141},
year = {2020},
url = {https://doi.org/10.1055/s-0040-1701255},
doi = {10.1055/S-0040-1701255},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aci/BaxterGCHOEHCCK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/LeeWLLYHLCWWGW20,
author = {Wei{-}Kai Lee and
Chih{-}Chun Wu and
Cheng{-}Chia Lee and
Chia{-}Feng Lu and
Huai{-}Che Yang and
Tzu{-}Hsuan Huang and
Chun{-}Yi Lin and
Wen{-}Yuh Chung and
Po{-}Shan Wang and
Hsiu{-}Mei Wu and
Wan{-}Yuo Guo and
Yu{-}Te Wu},
title = {Combining analysis of multi-parametric {MR} images into a convolutional
neural network: Precise target delineation for vestibular schwannoma
treatment planning},
journal = {Artif. Intell. Medicine},
volume = {107},
pages = {101911},
year = {2020},
url = {https://doi.org/10.1016/j.artmed.2020.101911},
doi = {10.1016/J.ARTMED.2020.101911},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/artmed/LeeWLLYHLCWWGW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LaiSLCHKYC20,
author = {Nai{-}Hua Lai and
Wan{-}Chen Shen and
Chun{-}Nin Lee and
Jui{-}Chia Chang and
Man{-}Ching Hsu and
Li{-}Na Kuo and
Ming{-}Chih Yu and
Hsiang{-}Yin Chen},
title = {Comparison of the predictive outcomes for anti-tuberculosis drug-induced
hepatotoxicity by different machine learning techniques},
journal = {Comput. Methods Programs Biomed.},
volume = {188},
pages = {105307},
year = {2020},
url = {https://doi.org/10.1016/j.cmpb.2019.105307},
doi = {10.1016/J.CMPB.2019.105307},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/LaiSLCHKYC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/ShihWLCCL20,
author = {Kao{-}Shang Shih and
Pei{-}Wei Weng and
Shang{-}Chih Lin and
Yi{-}Tzu Chen and
Cheng{-}Kung Cheng and
Chian{-}Her Lee},
title = {Corrigendum to "Biomechanical comparison between concentrated, follower,
and muscular loads of the lumbar column" [Computer Methods and Programs
in Biomedicine Volume 135, October 2016, Pages 209-218]},
journal = {Comput. Methods Programs Biomed.},
volume = {189},
pages = {105287},
year = {2020},
url = {https://doi.org/10.1016/j.cmpb.2019.105287},
doi = {10.1016/J.CMPB.2019.105287},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/ShihWLCCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/LeeCJS20,
author = {Chia{-}Hsuan Lee and
Shih{-}Hai Chen and
Bernard C. Jiang and
Tien{-}Lung Sun},
title = {Estimating Postural Stability Using Improved Permutation Entropy via
{TUG} Accelerometer Data for Community-Dwelling Elderly People},
journal = {Entropy},
volume = {22},
number = {10},
pages = {1097},
year = {2020},
url = {https://doi.org/10.3390/e22101097},
doi = {10.3390/E22101097},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/entropy/LeeCJS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijopcd/LeeCFWC20,
author = {Meng{-}Chieh Jeffrey Lee and
Hsiao{-}Yu Chen and
Yi{-}Ming Fang and
Ling{-}Fang Wang and
Chia{-}Yu Chen},
title = {Learning Performance of Teaching Practice of Friendly Senior Care
Space Design},
journal = {Int. J. Online Pedagog. Course Des.},
volume = {10},
number = {4},
pages = {32--44},
year = {2020},
url = {https://doi.org/10.4018/IJOPCD.2020100103},
doi = {10.4018/IJOPCD.2020100103},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijopcd/LeeCFWC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/LeeCH20,
author = {Chia{-}Cheng Lee and
Yu Chin Cheng and
Chin{-}Yun Hsieh},
title = {Composition and Testing of Connection Fault Handling Behaviors in
Programs with {AND/OR} Graph},
journal = {J. Inf. Sci. Eng.},
volume = {36},
number = {1},
pages = {31--52},
year = {2020},
url = {https://jise.iis.sinica.edu.tw/JISESearch/pages/View/PaperView.jsf?keyId=172\_2291},
timestamp = {Fri, 17 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/LeeCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LinHTTHCHHCGFRL20,
author = {Mu{-}Shan Lin and
Tze{-}Chiang Huang and
Chien{-}Chun Tsai and
King{-}Ho Tam and
Kenny Cheng{-}Hsiang Hsieh and
Ching{-}Fang Chen and
Wen{-}Hung Huang and
Chi{-}Wei Hu and
Yu{-}Chi Chen and
Sandeep Kumar Goel and
Chin{-}Ming Fu and
Stefan Rusu and
Chao{-}Chieh Li and
Sheng{-}Yao Yang and
Mei Wong and
Shu{-}Chun Yang and
Frank Lee},
title = {A 7-nm 4-GHz Arm{\({^1}\)}-Core-Based CoWoS{\({^1}\)} Chiplet Design
for High-Performance Computing},
journal = {{IEEE} J. Solid State Circuits},
volume = {55},
number = {4},
pages = {956--966},
year = {2020},
url = {https://doi.org/10.1109/JSSC.2019.2960207},
doi = {10.1109/JSSC.2019.2960207},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LinHTTHCHHCGFRL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/LeeCYW20,
author = {Ming{-}Che Lee and
Shu{-}Yin Chiang and
Sheng{-}Cheng Yeh and
Ting{-}Feng Wen},
title = {Study on emotion recognition and companion Chatbot using deep neural
network},
journal = {Multim. Tools Appl.},
volume = {79},
number = {27-28},
pages = {19629--19657},
year = {2020},
url = {https://doi.org/10.1007/s11042-020-08841-6},
doi = {10.1007/S11042-020-08841-6},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/LeeCYW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/TurroAMGGSASFTS20,
author = {Ernest Turro and
William J. Astle and
Karyn Megy and
Stefan Gr{\"{a}}f and
Daniel Greene and
Olga Shamardina and
Hana Lango Allen and
Alba Sanchis{-}Juan and
Mattia Frontini and
Chantal Thys and
Jonathan Stephens and
Rutendo Mapeta and
Oliver S. Burren and
Kate Downes and
Matthias Haimel and
Salih Tuna and
Sri V. V. Deevi and
Timothy J. Aitman and
David L. H. Bennett and
Paul Calleja and
Keren Carss and
Mark J. Caulfield and
Patrick F. Chinnery and
Peter H. Dixon and
Daniel P. Gale and
Roger James and
Ania Koziell and
Michael A. Laffan and
Adam P. Levine and
Eamonn R. Maher and
Hugh S. Markus and
Joannella Morales and
Nicholas W. Morrell and
Andrew D. Mumford and
Elizabeth Ormondroyd and
Stuart Rankin and
Augusto Rendon and
Sylvia Richardson and
Irene Roberts and
Noemi B. A. Roy and
Moin A. Saleem and
Kenneth G. C. Smith and
Hannah Stark and
Rhea Y. Y. Tan and
Andreas C. Themistocleous and
Adrian J. Thrasher and
Hugh Watkins and
Andrew R. Webster and
Martin R. Wilkins and
Catherine Williamson and
James Whitworth and
Sean Humphray and
David R. Bentley and
Stephen Abbs and
Lara Abulhoul and
Julian Adlard and
Munaza Ahmed and
Hana Alachkar and
David J. Allsup and
Jeff Almeida{-}King and
Philip Ancliff and
Richard Antrobus and
Ruth Armstrong and
Gavin Arno and
Sofie Ashford and
Anthony Attwood and
Paul Aurora and
Christian Babbs and
Chiara Bacchelli and
Tamam Bakchoul and
Siddharth Banka and
Tadbir Bariana and
Julian Barwell and
Joana Batista and
Helen E. Baxendale and
Phil L. Beales and
Agnieszka Bierzynska and
Tina Biss and
Maria A. K. Bitner{-}Glindzicz and
Graeme C. M. Black and
Marta Bleda and
Iulia Blesneac and
Detlef Bockenhauer and
Harm Bogaard and
Christian J. Bourne and
Sara Boyce and
John R. Bradley and
Eugene Bragin and
Gerome Breen and
Paul Brennan and
Carole Brewer and
Matthew Brown and
Andrew C. Browning and
Michael J. Browning and
Rachel J. Buchan and
Matthew S. Buckland and
Teofila Bueser and
Carmen Bugarin Diz and
John Burn and
Siobhan O. Burns and
Nigel Burrows and
Carolyn Campbell and
Gerald Carr{-}White and
Ruth Casey and
Jenny Chambers and
John Chambers and
Melanie M. Y. Chan and
Calvin Cheah and
Floria Cheng and
Manali Chitre and
Martin T. Christian and
Colin Church and
Jill Clayton{-}Smith and
Maureen Cleary and
Naomi Clements Brod and
Gerry Coghlan and
Elizabeth Colby and
Trevor R. P. Cole and
Janine Collins and
Peter W. Collins and
Camilla Colombo and
Cecilia J. Compton and
Robin Condliffe and
Stuart A. Cook and
H. Terence Cook and
Nichola Cooper and
Paul A. Corris and
Abigail Furnell and
Fiona Cunningham and
Nicola S. Curry and
Antony J. Cutler and
Matthew J. Daniels and
Mehul Dattani and
Louise C. Daugherty and
John Davis and
Anthony De Soyza and
Timothy Dent and
Charu Deshpande and
Eleanor F. Dewhurst and
Sofia Douzgou and
Anna M. Drazyk and
Elizabeth Drewe and
Daniel Duarte and
Tina Dutt and
J. David M. Edgar and
Karen Edwards and
William Egner and
Melanie N. Ekani and
Perry Elliott and
Wendy N. Erber and
Marie Erwood and
Maria C. Estiu and
Dafydd Gareth Evans and
Gillian Evans and
Tamara Everington and
M{\'{e}}lanie Eyries and
Hiva Fassihi and
Remi Favier and
Jack Findhammer and
Debra Fletcher and
Frances A. Flinter and
R. Andres Floto and
Tom Fowler and
James Fox and
Amy J. Frary and
Courtney E. French and
Kathleen Freson and
Henning Gall and
Vijeya Ganesan and
Michael Gattens and
Claire Geoghegan and
Terence S. A. Gerighty and
Ali G. Gharavi and
Stefano Ghio and
Hossein{-}Ardeschir Ghofrani and
J. Simon R. Gibbs and
Kate Gibson and
Kimberly C. Gilmour and
Barbara Girerd and
Nicholas S. Gleadall and
Sarah Goddard and
David B. Goldstein and
Keith Gomez and
Pavels Gordins and
David Gosal and
Jodie Graham and
Luigi Grassi and
Lynn Greenhalgh and
Andreas Greinacher and
Paolo Gresele and
Philip Griffiths and
Sofia Grigoriadou and
Russell J. Grocock and
Detelina Grozeva and
Mark Gurnell and
Scott Hackett and
Charaka Hadinnapola and
William M. Hague and
Rosie Hague and
Matthew Hall and
Helen L. Hanson and
Eshika Haque and
Kirsty Harkness and
Andrew R. Harper and
Claire L. Harris and
Daniel Hart and
Ahamad Hassan and
Grant Hayman and
Alex Henderson and
Archana Herwadkar and
Jonathan Hoffman and
Simon Holden and
Rita Horvath and
Henry Houlden and
Arjan C. Houweling and
Luke S. G. E. Howard and
Fengyuan Hu and
Gavin Hudson and
Joseph Hughes and
Aarnoud P. Huissoon and
Marc Humbert and
Sarah Hunter and
Matthew E. Hurles and
Melita Irving and
Louise Izatt and
Sally A. Johnson and
Stephen Jolles and
Jennifer Jolley and
Dragana Josifova and
Neringa Jurkute and
Tim Karten and
Johannes Karten and
Mary A. Kasanicki and
Hanadi Kazkaz and
Rashid Kazmi and
Peter Kelleher and
Anne M. Kelly and
Wilf Kelsall and
Carly Kempster and
David G. Kiely and
Nathalie Kingston and
Robert Klima and
Nils Koelling and
Myrto Kostadima and
Gabor Kovacs and
Roman Kreuzhuber and
Taco W. Kuijpers and
Ajith Kumar and
Dinakantha Kumararatne and
Manju A. Kurian and
Fiona Lalloo and
Michele Lambert and
Allan Lawrie and
D. Mark Layton and
Nick Lench and
Claire Lentaigne and
Tracy Lester and
Rachel Linger and
Hilary Longhurst and
Lorena E. Lorenzo and
Eleni Louka and
Paul A. Lyons and
Rajiv D. Machado and
Robert V. MacKenzie Ross and
Bella Madan and
Jesmeen Maimaris and
Samantha Malka and
Sarah Mangles and
Kevin J. Marchbank and
Stephen Marks and
Hanns{-}Ulrich Marschall and
Andrew G. Marshall and
Jennifer Martin and
Mary Mathias and
Emma Matthews and
Heather Maxwell and
Paul McAlinden and
Mark I. McCarthy and
Harriet McKinney and
Aoife McMahon and
Stuart Meacham and
Adam J. Mead and
Ignacio Medina Castello and
Sarju G. Mehta and
Michel Michaelides and
Carolyn Millar and
Shehla N. Mohammed and
Shahin Moledina and
David Montani and
Anthony T. Moore and
Monika Mozere and
Keith W. Muir and
Andrea H. Nemeth and
William G. Newman and
Michael Newnham and
Sadia Noorani and
Paquita Nurden and
Jennifer O'Sullivan and
Samya Obaji and
Chris Odhams and
Steven Okoli and
Andrea Olschewski and
Horst Olschewski and
Kai Ren Ong and
S. Helen Oram and
Willem H. Ouwehand and
Claire Palles and
Sofia Papadia and
Soo{-}Mi Park and
David Parry and
Smita Patel and
Joan Paterson and
Andrew Peacock and
Simon H. Pearce and
John Peden and
Kathelijne Peerlinck and
Christopher J. Penkett and
Joanna Pepke{-}Zaba and
Romina Petersen and
Clarissa Pilkington and
Kenneth E. S. Poole and
Radhika Prathalingam and
Bethan Psaila and
Angela Pyle and
Richard Quinton and
Shamima Rahman and
Anupama Rao and
F. Lucy Raymond and
Paula J. Rayner{-}Matthews and
Christine Rees and
Tara Renton and
Christopher J. Rhodes and
Andrew S. C. Rice and
Alex Richter and
Leema Robert and
Anthony Rogers and
Sarah J. Rose and
Robert Ross{-}Russell and
Catherine Roughley and
Deborah M. Ruddy and
Omid Sadeghi{-}Alavijeh and
Nilesh J. Samani and
Crina Samarghitean and
Ravishankar B. Sargur and
Robert N. Sarkany and
Simon Satchell and
Sinisa Savic and
John A. Sayer and
Genevieve Sayer and
Laura Scelsi and
Andrew M. Schaefer and
Sol Schulman and
Richard Scott and
Marie Scully and
Claire Searle and
Werner Seeger and
Arjune Sen and
W. A. Carrock Sewell and
Denis Seyres and
Neil Shah and
Susan E. Shapiro and
Adam C. Shaw and
Patrick J. Short and
Keith Sibson and
Lucy Side and
Ilenia Simeoni and
Michael A. Simpson and
Matthew C. Sims and
Suthesh Sivapalaratnam and
Damian Smedley and
Katherine R. Smith and
Katie Snape and
Nicole Soranzo and
Florent Soubrier and
Laura Southgate and
Olivera Spasic{-}Boskovic and
Simon Staines and
Emily Staples and
Charles A. Steward and
Kathleen E. Stirrups and
Alex Stuckey and
Jay Suntharalingam and
Emilia M. Swietlik and
Petros Syrris and
R. Campbell Tait and
Kate Talks and
Katie Tate and
John M. Taylor and
Jenny C. Taylor and
James E. Thaventhiran and
Ellen Thomas and
David Thomas and
Moira J. Thomas and
Patrick Thomas and
Kate Thomson and
Glen Threadgold and
Tobias Tilly and
Marc Tischkowitz and
Catherine Titterton and
John A. Todd and
Cheng{-}Hock Toh and
Bas Tolhuis and
Ian P. Tomlinson and
Mark Toshner and
Matthew Traylor and
Carmen Treacy and
Paul Treadaway and
Richard Trembath and
Wojciech Turek and
Philip Twiss and
Tom Vale and
Chris Van Geet and
Natalie van Zuydam and
Maarten Vandekuilen and
Anthony M. Vandersteen and
Marta Vazquez{-}Lopez and
Julie von Ziegenweidt and
Anton Vonk{-}Noordegraaf and
Annette Wagner and
Quinten Waisfisz and
Suellen M. Walker and
Neil Walker and
Klaudia Walter and
James S. Ware and
Christopher Watt and
Lucy Wedderburn and
Wei Wei and
Steven B. Welch and
Julie Wessels and
Sarah K. Westbury and
John{-}Paul Westwood and
John Wharton and
Deborah Whitehorn and
Andrew O. M. Wilkie and
Brian T. Wilson and
Edwin K. S. Wong and
Nicholas W. Wood and
Yvette Wood and
Christopher Geoffrey Woods and
Emma R. Woodward and
Stephen J. Wort and
Austen Worth and
Michael Wright and
Katherine Yates and
Patrick F. K. Yong and
Timothy Young and
Ping Yu and
Patrick Yu{-}Wai{-}Man and
Eliska Zlamalova},
title = {Whole-genome sequencing of patients with rare diseases in a national
health system},
journal = {Nat.},
volume = {583},
number = {7814},
pages = {96--102},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-2434-2},
doi = {10.1038/S41586-020-2434-2},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/TurroAMGGSASFTS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotics/HuangLCD20,
author = {Jhih{-}Yuan Huang and
Wei{-}Po Lee and
Chen{-}Chia Chen and
Bu{-}Wei Dong},
title = {Developing Emotion-Aware Human-Robot Dialogues for Domain-Specific
and Goal-Oriented Tasks},
journal = {Robotics},
volume = {9},
number = {2},
pages = {31},
year = {2020},
url = {https://doi.org/10.3390/robotics9020031},
doi = {10.3390/ROBOTICS9020031},
timestamp = {Wed, 15 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotics/HuangLCD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChuSYCLL20,
author = {Shao{-}Yu Chu and
Meng{-}Xian Shen and
Tsung{-}Han Yeh and
Chia{-}Hsun Chen and
Ching{-}Ting Lee and
Hsin{-}Ying Lee},
title = {Investigation of Ga2O3-Based Deep Ultraviolet Photodetectors Using
Plasma-Enhanced Atomic Layer Deposition System},
journal = {Sensors},
volume = {20},
number = {21},
pages = {6159},
year = {2020},
url = {https://doi.org/10.3390/s20216159},
doi = {10.3390/S20216159},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ChuSYCLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeCLHCL20,
author = {Chien{-}Ching Lee and
Chia{-}Chun Chuang and
Bo{-}Cheng Lai and
Yi{-}Chia Huang and
Jen{-}Yin Chen and
Bor{-}Shyh Lin},
title = {A Novel Smart Assistance System for Blood Vessel Approaching: {A}
Technical Report Based on Oximetry},
journal = {Sensors},
volume = {20},
number = {7},
pages = {1891},
year = {2020},
url = {https://doi.org/10.3390/s20071891},
doi = {10.3390/S20071891},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LeeCLHCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/ChenLC20,
author = {Liang{-}Chu Chen and
Chia{-}Meng Lee and
Mu{-}Yen Chen},
title = {Exploration of social media for sentiment analysis using deep learning},
journal = {Soft Comput.},
volume = {24},
number = {11},
pages = {8187--8197},
year = {2020},
url = {https://doi.org/10.1007/s00500-019-04402-8},
doi = {10.1007/S00500-019-04402-8},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/soco/ChenLC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/WuGAHBBRKNXLFXT20,
author = {Dufan Wu and
Kuang Gong and
Chiara Daniela Arru and
Fatemeh Homayounieh and
Bernardo Bizzo and
Varun Buch and
Hui Ren and
Kyung Sang Kim and
Nir Neumark and
Pengcheng Xu and
Zhiyuan Liu and
Wei Fang and
Nuobei Xie and
Won Young Tak and
Soo Young Park and
Yu Rim Lee and
Min Kyu Kang and
Jung Gil Park and
Alessandro Carriero and
Luca Saba and
Mahsa Masjedi and
Hamidreza Talari and
Rosa Babaei and
Hadi Karimi Mobin and
Shadi Ebrahimian and
Ittai Dayan and
Mannudeep K. Kalra and
Quanzheng Li},
title = {Severity and Consolidation Quantification of {COVID-19} From {CT}
Images Using Deep Learning Based on Hybrid Weak Labels},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {24},
number = {12},
pages = {3529--3538},
year = {2020},
url = {https://doi.org/10.1109/JBHI.2020.3030224},
doi = {10.1109/JBHI.2020.3030224},
timestamp = {Wed, 06 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/titb/WuGAHBBRKNXLFXT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/YangCCLTCL20,
author = {Chao{-}Tung Yang and
Yuan{-}An Chen and
Yu{-}Wei Chan and
Chia{-}Lin Lee and
Yu{-}Tse Tsan and
Wei{-}Cheng Chan and
Po{-}Yu Liu},
title = {Influenza-like illness prediction using a long short-term memory deep
learning model with multiple open data sources},
journal = {J. Supercomput.},
volume = {76},
number = {12},
pages = {9303--9329},
year = {2020},
url = {https://doi.org/10.1007/s11227-020-03182-5},
doi = {10.1007/S11227-020-03182-5},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tjs/YangCCLTCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tlt/LienLCCL20,
author = {Wan{-}Ching Lien and
Phone Lin and
Hong{-}Wun Chen and
Herman Chih{-}Heng Chang and
Chia{-}Peng Lee},
title = {{MEUS:} {A} Mobile E-Learning Platform for Ultrasound Image Education},
journal = {{IEEE} Trans. Learn. Technol.},
volume = {13},
number = {2},
pages = {367--373},
year = {2020},
url = {https://doi.org/10.1109/TLT.2020.2977627},
doi = {10.1109/TLT.2020.2977627},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tlt/LienLCCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/ChaoWLWC20,
author = {Cheng{-}Chih Chao and
Chih{-}Yu Wang and
Chia{-}Han Lee and
Hung{-}Yu Wei and
Wen{-}Tsuen Chen},
title = {Pair Auction and Matching for Resource Allocation in Full-Duplex Cellular
Systems},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {69},
number = {4},
pages = {4325--4339},
year = {2020},
url = {https://doi.org/10.1109/TVT.2020.2973712},
doi = {10.1109/TVT.2020.2973712},
timestamp = {Thu, 25 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/ChaoWLWC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/WangHCLYHLKW20,
author = {Sung{-}Hao Wang and
Yu{-}Kai Huang and
Ching{-}Yuan Chen and
Chia{-}Fone Lee and
Chia{-}Hsiang Yang and
Chung{-}Chih Hung and
Chien{-}Hao Liu and
Ming{-}Dou Ker and
Chung{-}Yu Wu},
title = {Improved Design and In Vivo Animal Tests of Bone-Guided Cochlear Implant
Microsystem with Monopolar Biphasic Multiple Stimulation and Neural
Action Potential Acquisition},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2020, Virtual
Event, Japan, November 9-11, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/A-SSCC48613.2020.9336120},
doi = {10.1109/A-SSCC48613.2020.9336120},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/WangHCLYHLKW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/ChiangCCCLLCC20,
author = {Yi{-}Shyuan Chiang and
Ruei{-}Che Chang and
Yi{-}Lin Chuang and
Shih{-}Ya Chou and
Hao{-}Ping Lee and
I{-}Ju Lin and
Jian{-}Hua Jiang Chen and
Yung{-}Ju Chang},
editor = {Regina Bernhaupt and
Florian 'Floyd' Mueller and
David Verweij and
Josh Andres and
Joanna McGrenere and
Andy Cockburn and
Ignacio Avellino and
Alix Goguey and
Pernille Bj{\o}n and
Shengdong Zhao and
Briane Paul Samson and
Rafal Kocielnik},
title = {Exploring the Design Space of User-System Communication for Smart-home
Routine Assistants},
booktitle = {{CHI} '20: {CHI} Conference on Human Factors in Computing Systems,
Honolulu, HI, USA, April 25-30, 2020},
pages = {1--14},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3313831.3376501},
doi = {10.1145/3313831.3376501},
timestamp = {Wed, 12 Jun 2024 07:39:18 +0200},
biburl = {https://dblp.org/rec/conf/chi/ChiangCCCLLCC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cinc/LinLTBW20,
author = {Yu{-}Cheng Lin and
Yun{-}Chieh Lee and
Wen{-}Chiao Tsai and
Win{-}Ken Beh and
An{-}Yeu Andy Wu},
title = {Explainable Deep Neural Network for Identifying Cardiac Abnormalities
Using Class Activation Map},
booktitle = {Computing in Cardiology, CinC 2020, Rimini, Italy, September 13-16,
2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.22489/CinC.2020.072},
doi = {10.22489/CINC.2020.072},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cinc/LinLTBW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/NahSTLTXCTBSXCS20,
author = {Seungjun Nah and
Sanghyun Son and
Radu Timofte and
Kyoung Mu Lee and
Yu Tseng and
Yu{-}Syuan Xu and
Cheng{-}Ming Chiang and
Yi{-}Min Tsai and
Stephan Brehm and
Sebastian A. Scherer and
Dejia Xu and
Yihao Chu and
Qingyan Sun and
Jiaqin Jiang and
Lunhao Duan and
Jian Yao and
Kuldeep Purohit and
Maitreya Suin and
A. N. Rajagopalan and
Yuichi Ito and
Hrishikesh P. S and
Densen Puthussery and
Akhil K. A and
C. V. Jiji and
Guisik Kim and
Deepa P. L and
Zhiwei Xiong and
Jie Huang and
Dong Liu and
Sangmin Kim and
Hyungjoon Nam and
Jisu Kim and
Jechang Jeong and
Shihua Huang and
Yuchen Fan and
Jiahui Yu and
Haichao Yu and
Thomas S. Huang and
Ya Zhou and
Xin Li and
Sen Liu and
Zhibo Chen and
Saikat Dutta and
Sourya Dipta Das and
Shivam Garg and
Daniel Sprague and
Bhrij Patel and
Thomas Huck},
title = {{NTIRE} 2020 Challenge on Image and Video Deblurring},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} Workshops 2020, Seattle, WA, USA, June 14-19, 2020},
pages = {1662--1675},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPRW\_2020/html/w31/Nah\_NTIRE\_2020\_Challenge\_on\_Image\_and\_Video\_Deblurring\_CVPRW\_2020\_paper.html},
doi = {10.1109/CVPRW50498.2020.00216},
timestamp = {Tue, 20 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/NahSTLTXCTBSXCS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ChenL20a,
author = {Ruey{-}Cheng Chen and
Chia{-}Jung Lee},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {Incorporating Behavioral Hypotheses for Query Generation},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {3105--3110},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.251},
doi = {10.18653/V1/2020.EMNLP-MAIN.251},
timestamp = {Tue, 20 Aug 2024 07:54:43 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ChenL20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ChiangHL20,
author = {David Cheng{-}Han Chiang and
Sung{-}Feng Huang and
Hung{-}yi Lee},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {Pretrained Language Model Embryology: The Birth of {ALBERT}},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {6813--6828},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.553},
doi = {10.18653/V1/2020.EMNLP-MAIN.553},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ChiangHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/JiangXL020,
author = {Jyun{-}Yu Jiang and
Chenyan Xiong and
Chia{-}Jung Lee and
Wei Wang},
editor = {Trevor Cohn and
Yulan He and
Yang Liu},
title = {Long Document Ranking with Query-Directed Sparse Transformer},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2020, Online Event, 16-20 November 2020},
series = {Findings of {ACL}},
volume = {{EMNLP} 2020},
pages = {4594--4605},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.findings-emnlp.412},
doi = {10.18653/V1/2020.FINDINGS-EMNLP.412},
timestamp = {Tue, 20 Aug 2024 07:54:42 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/JiangXL020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ChingYLHKHL20,
author = {Cheng{-}Wei Ching and
Chung{-}Kai Yang and
Yu{-}Chun Liu and
Chia{-}Wei Hsu and
Jian{-}Jhih Kuo and
Hung{-}Sheng Huang and
Jen{-}Feng Lee},
title = {Energy-Efficient Link Selection for Decentralized Learning via Smart
Devices with Edge Computing},
booktitle = {{IEEE} Global Communications Conference, {GLOBECOM} 2020, Virtual
Event, Taiwan, December 7-11, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/GLOBECOM42002.2020.9322306},
doi = {10.1109/GLOBECOM42002.2020.9322306},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/globecom/ChingYLHKHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/LinWCL20,
author = {Chia{-}Hung Lin and
Chao{-}Chin Wu and
Kuan{-}Fu Chen and
Ta{-}Sung Lee},
title = {A Variational Autoencoder-Based Secure Transceiver Design Using Deep
Learning},
booktitle = {{IEEE} Global Communications Conference, {GLOBECOM} 2020, Virtual
Event, Taiwan, December 7-11, 2020},
pages = {1--7},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/GLOBECOM42002.2020.9348041},
doi = {10.1109/GLOBECOM42002.2020.9348041},
timestamp = {Mon, 15 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/globecom/LinWCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/YenLCWY20,
author = {Chiu{-}Chen Yen and
Chia{-}Ying Lee and
Gwo{-}Dong Chen and
Jen{-}Hang Wang and
Su{-}Hang Yang},
title = {A Digital Reality Learning Environment with Instant Assessment on
Learning with Body and Visual Interaction},
booktitle = {20th {IEEE} International Conference on Advanced Learning Technologies,
{ICALT} 2020, Tartu, Estonia, July 6-9, 2020},
pages = {77--78},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICALT49669.2020.00030},
doi = {10.1109/ICALT49669.2020.00030},
timestamp = {Wed, 12 Aug 2020 12:28:51 +0200},
biburl = {https://dblp.org/rec/conf/icalt/YenLCWY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/SantiniBCBP20,
author = {Paolo Santini and
Massimo Battaglioni and
Franco Chiaraluce and
Marco Baldi and
Edoardo Persichetti},
title = {Low-Lee-Density Parity-Check Codes},
booktitle = {2020 {IEEE} International Conference on Communications, {ICC} 2020,
Dublin, Ireland, June 7-11, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICC40277.2020.9148812},
doi = {10.1109/ICC40277.2020.9148812},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icc/SantiniBCBP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/ChengHLP20,
author = {Chung{-}Kuan Cheng and
Chia{-}Tung Ho and
Daeyeal Lee and
Dongwon Park},
title = {A Routability-Driven Complimentary-FET {(CFET)} Standard Cell Synthesis
Framework using {SMT}},
booktitle = {{IEEE/ACM} International Conference On Computer Aided Design, {ICCAD}
2020, San Diego, CA, USA, November 2-5, 2020},
pages = {158:1--158:8},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1145/3400302.3415611},
doi = {10.1145/3400302.3415611},
timestamp = {Mon, 18 Jan 2021 09:56:56 +0100},
biburl = {https://dblp.org/rec/conf/iccad/ChengHLP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/ChangHL20,
author = {Hsuan{-}Yu Chang and
Chia{-}Cheng Hsu and
Yu{-}Hsuan Lee},
title = {Smooth Dark Channel Prior Technique for Image Dehazing Applications},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2020, Taoyuan, Taiwan, September 28-30, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICCE-Taiwan49838.2020.9258222},
doi = {10.1109/ICCE-TAIWAN49838.2020.9258222},
timestamp = {Wed, 24 Nov 2021 09:22:55 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/ChangHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/LeeTCJC20,
author = {Chia{-}Ying Lee and
Jing{-}Yau Tang and
Pen{-}Jan Chen and
Ling{-}Sheng Jang and
Hsiao{-}Ling Chuang},
title = {The Effect of Extremely Low Frequency Electromagnetic Field on Weight
Gain of Preterm Babies},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2020, Taoyuan, Taiwan, September 28-30, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICCE-Taiwan49838.2020.9258046},
doi = {10.1109/ICCE-TAIWAN49838.2020.9258046},
timestamp = {Wed, 24 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/LeeTCJC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icea/LeeCLCL20,
author = {Yueh{-}Shiu Lee and
I{-}Yun Chen and
Tsung{-}Yao Lin and
Yen{-}Chiao Chuang and
Hsu{-}Jung Liu},
title = {Developing a Model to Explore Consumer Buying Behaviors through Long
Short-Term Memory},
booktitle = {{ACM} {ICEA} '20: 2020 {ACM} International Conference on Intelligent
Computing and its Emerging Applications, GangWon Republic of Korea,
December 12 - 15, 2020},
pages = {11:1--11:3},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3440943.3444748},
doi = {10.1145/3440943.3444748},
timestamp = {Wed, 29 Sep 2021 09:35:11 +0200},
biburl = {https://dblp.org/rec/conf/icea/LeeCLCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/WongLLWCT20,
author = {Wai Mun Wong and
Christopher Lim and
Chia{-}Da Lee and
Lilian Wang and
Shih{-}Che Chen and
Pei{-}Kuei Tsung},
title = {{KRF-SLAM:} {A} Robust {AI} Slam Based On Keypoint Resampling And
Fusion},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2020,
Abu Dhabi, United Arab Emirates, October 25-28, 2020},
pages = {296--299},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICIP40778.2020.9191192},
doi = {10.1109/ICIP40778.2020.9191192},
timestamp = {Tue, 03 Nov 2020 11:48:53 +0100},
biburl = {https://dblp.org/rec/conf/icip/WongLLWCT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/KaoLCCLH20,
author = {Peng Yua Kao and
Yan{-}Jing Lei and
Chia{-}Hao Chang and
Chu{-}Song Chen and
Ming{-}Sui Lee and
Yi{-}Ping Hung},
title = {Activity Recognition Using First-Person-View Cameras Based on Sparse
Optical Flows},
booktitle = {25th International Conference on Pattern Recognition, {ICPR} 2020,
Virtual Event / Milan, Italy, January 10-15, 2021},
pages = {81--86},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICPR48806.2021.9412330},
doi = {10.1109/ICPR48806.2021.9412330},
timestamp = {Fri, 07 May 2021 08:42:33 +0200},
biburl = {https://dblp.org/rec/conf/icpr/KaoLCCLH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/YangCLW20,
author = {Fu{-}En Yang and
Jing{-}Cheng Chang and
Yuan{-}Hao Lee and
Yu{-}Chiang Frank Wang},
title = {Dual-MTGAN: Stochastic and Deterministic Motion Transfer for Image-to-Video
Synthesis},
booktitle = {25th International Conference on Pattern Recognition, {ICPR} 2020,
Virtual Event / Milan, Italy, January 10-15, 2021},
pages = {6764--6771},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICPR48806.2021.9412781},
doi = {10.1109/ICPR48806.2021.9412781},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/YangCLW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/ChenLLCCSTYHCLC20,
author = {Kuan{-}Ting Chen and
C. Lo and
Y.{-}Y. Lin and
C.{-}Y. Chueh and
C. Chang and
G.{-}Y. Siang and
Y.{-}J. Tseng and
Y.{-}J. Yang and
F.{-}C. Hsieh and
S.{-}H. Chang and
H. Liang and
S.{-}H. Chiang and
J.{-}H. Liu and
Y.{-}D. Lin and
P.{-}C. Yeh and
C.{-}Y. Wang and
H.{-}Y. Yang and
P.{-}J. Tzeng and
M.{-}H. Liao and
Shu{-}Tong Chang and
Y.{-}Y. Tseng and
Min{-}Hung Lee},
title = {Double Layers Omega FETs with Ferroelectric HfZrO2 for One-Transistor
Memory},
booktitle = {2020 {IEEE} International Reliability Physics Symposium, {IRPS} 2020,
Dallas, TX, USA, April 28 - May 30, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IRPS45951.2020.9129088},
doi = {10.1109/IRPS45951.2020.9129088},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/ChenLLCCSTYHCLC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChenHL20,
author = {Oscal Tzyh{-}Chiang Chen and
Manh{-}Hung Ha and
Yi Lun Lee},
title = {Computation-Affordable Recognition System for Activity Identification
using a Smart Phone at Home},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2020,
Sevilla, Spain, October 10-21, 2020},
pages = {1--5},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISCAS45731.2020.9180826},
doi = {10.1109/ISCAS45731.2020.9180826},
timestamp = {Mon, 18 Jan 2021 08:38:59 +0100},
biburl = {https://dblp.org/rec/conf/iscas/ChenHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChiangCL20,
author = {Wei Chiang and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {An Area-Efficient High-Throughput {SM4} Accelerator with SCA-Countermeasure
for {TV} Applications},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2020,
Sevilla, Spain, October 10-21, 2020},
pages = {1--5},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISCAS45731.2020.9180577},
doi = {10.1109/ISCAS45731.2020.9180577},
timestamp = {Mon, 18 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscas/ChiangCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/ChenLLCLW20,
author = {Chun{-}Jui Chen and
Yi{-}Ting Lin and
Chia{-}Chun Lin and
Yung{-}Chih Chen and
Yun{-}Ju Lee and
Chun{-}Yao Wang},
title = {Rehabilitation System for Limbs using IMUs},
booktitle = {21st International Symposium on Quality Electronic Design, {ISQED}
2020, Santa Clara, CA, USA, March 25-26, 2020},
pages = {285--291},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISQED48828.2020.9137026},
doi = {10.1109/ISQED48828.2020.9137026},
timestamp = {Wed, 22 Jul 2020 15:06:46 +0200},
biburl = {https://dblp.org/rec/conf/isqed/ChenLLCLW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/WangCCLLCW20,
author = {Teng{-}Chia Wang and
Yan{-}Ping Chang and
Chun{-}Jui Chen and
Yun{-}Ju Lee and
Chia{-}Chun Lin and
Yung{-}Chih Chen and
Chun{-}Yao Wang},
title = {IMU-based Smart Knee Pad for Walking Distance and Stride Count Measurement},
booktitle = {21st International Symposium on Quality Electronic Design, {ISQED}
2020, Santa Clara, CA, USA, March 25-26, 2020},
pages = {173--178},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISQED48828.2020.9136969},
doi = {10.1109/ISQED48828.2020.9136969},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isqed/WangCCLLCW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChihSLCLLCLSSCC20,
author = {Yu{-}Der Chih and
Yi{-}Chun Shih and
Chia{-}Fu Lee and
Yen{-}An Chang and
Po{-}Hao Lee and
Hon{-}Jarn Lin and
Yu{-}Lin Chen and
Chieh{-}Pu Lo and
Meng{-}Chun Shih and
Kuei{-}Hung Shen and
Harry Chuang and
Tsung{-}Yung Jonathan Chang},
title = {13.3 {A} 22nm 32Mb Embedded {STT-MRAM} with 10ns Read Speed, 1M Cycle
Write Endurance, 10 Years Retention at 150{\textdegree}C and High
Immunity to Magnetic Field Interference},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {222--224},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9062955},
doi = {10.1109/ISSCC19947.2020.9062955},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChihSLCLLCLSSCC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LinCTHKWTHLLWKC20,
author = {Chien{-}Hung Lin and
Chih{-}Chung Cheng and
Yi{-}Min Tsai and
Sheng{-}Je Hung and
Yu{-}Ting Kuo and
Perry H. Wang and
Pei{-}Kuei Tsung and
Jeng{-}Yun Hsu and
Wei{-}Chih Lai and
Chia{-}Hung Liu and
Shao{-}Yu Wang and
Chin{-}Hua Kuo and
Chih{-}Yu Chang and
Ming{-}Hsien Lee and
Tsung{-}Yao Lin and
Chih{-}Cheng Chen},
title = {7.1 {A} 3.4-to-13.3TOPS/W 3.6TOPS Dual-Core Deep-Learning Accelerator
for Versatile {AI} Applications in 7nm 5G Smartphone SoC},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {134--136},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9063111},
doi = {10.1109/ISSCC19947.2020.9063111},
timestamp = {Sat, 18 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/LinCTHKWTHLLWKC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WuCYLYCCCLCCHY20,
author = {Yi{-}Chung Wu and
Yen{-}Lung Chen and
Chung{-}Hsuan Yang and
Chao{-}Hsi Lee and
Chao{-}Yang Yu and
Nian{-}Shyang Chang and
Ling{-}Chien Chen and
Jia{-}Rong Chang and
Chun{-}Pin Lin and
Hung{-}Lieh Chen and
Chi{-}Shi Chen and
Jui{-}Hung Hung and
Chia{-}Hsiang Yang},
title = {21.1 {A} Fully Integrated Genetic Variant Discovery SoC for Next-Generation
Sequencing},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {322--324},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9063002},
doi = {10.1109/ISSCC19947.2020.9063002},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/WuCYLYCCCLCCHY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc-asia/ChuangHWLTCW20,
author = {Chien{-}Hui Chuang and
Kuan{-}Wei Hou and
Cheng{-}Wen Wu and
Mincent Lee and
Chia{-}Heng Tsai and
Hao Chen and
Min{-}Jer Wang},
title = {A Deep Learning-Based Screening Method for Improving the Quality and
Reliability of Integrated Passive Devices},
booktitle = {{IEEE} International Test Conference in Asia, ITC-Asia 2020, Taipei,
Taiwan, September 23-25, 2020},
pages = {13--18},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ITC-Asia51099.2020.00014},
doi = {10.1109/ITC-ASIA51099.2020.00014},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itc-asia/ChuangHWLTCW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc-asia/LeeLTCW20,
author = {Mincent Lee and
Cheng{-}Tse Lu and
Chia{-}Heng Tsai and
Hao Chen and
Min{-}Jer Wang},
title = {Site-aware Anomaly Detection with Machine Learning for Circuit Probing
to Prevent Overkill},
booktitle = {{IEEE} International Test Conference in Asia, ITC-Asia 2020, Taipei,
Taiwan, September 23-25, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ITC-Asia51099.2020.00012},
doi = {10.1109/ITC-ASIA51099.2020.00012},
timestamp = {Wed, 26 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itc-asia/LeeLTCW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/ChuangHWLTCW20,
author = {Chien{-}Hui Chuang and
Kuan{-}Wei Hou and
Cheng{-}Wen Wu and
Mincent Lee and
Chia{-}Heng Tsai and
Hao Chen and
Min{-}Jer Wang},
title = {A Deep Learning-Based Screening Method for Improving the Quality and
Reliability of Integrated Passive Devices},
booktitle = {{IEEE} International Test Conference, {ITC} 2020, Washington, DC,
USA, November 1-6, 2020},
pages = {1--9},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ITC44778.2020.9325221},
doi = {10.1109/ITC44778.2020.9325221},
timestamp = {Wed, 26 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itc/ChuangHWLTCW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ivs/LeeLFHCLC20,
author = {Sheng{-}Wei Lee and
Peng{-}Wei Lin and
Yuan{-}Ting Fu and
Chih{-}Ming Hsu and
Chen{-}Yu Chan and
Jhih{-}Hong Lin and
Yen{-}Hung Chiang},
title = {Improving vehicle localization using pole-like landmarks extracted
from 3-D lidar scans},
booktitle = {{IEEE} Intelligent Vehicles Symposium, {IV} 2020, Las Vegas, NV, USA,
October 19 - November 13, 2020},
pages = {2052--2057},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IV47402.2020.9304747},
doi = {10.1109/IV47402.2020.9304747},
timestamp = {Fri, 15 Jan 2021 15:43:41 +0100},
biburl = {https://dblp.org/rec/conf/ivs/LeeLFHCLC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/ChenOLLCGMGCA20,
author = {Antong Chen and
Charlene Zhi Lin Ong and
Weiwei Luo and
Chen Fei Lee and
Ser Mien Chia and
Joana Galvao and
Daniel Metzger and
Eric Gifford and
Chih{-}Liang Chin and
Asad Abu Bakar Ali},
editor = {Ivana Isgum and
Bennett A. Landman},
title = {Comparison of training strategies for the segmentation of retina layers
in optical coherence tomography images of rodent eyes using convolutional
neural networks},
booktitle = {Medical Imaging 2020: Image Processing, Houston, TX, USA, February
15-20, 2020},
series = {{SPIE} Proceedings},
volume = {11313},
pages = {1131339},
publisher = {{SPIE}},
year = {2020},
url = {https://doi.org/10.1117/12.2549442},
doi = {10.1117/12.2549442},
timestamp = {Tue, 21 Jul 2020 15:32:21 +0200},
biburl = {https://dblp.org/rec/conf/miip/ChenOLLCGMGCA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/LuCHGTTSHL20,
author = {Tsung{-}Han Lu and
Nai{-}Jung Chiang and
Chien{-}Jui Huang and
Priya Gopinathan and
Hsiu{-}Chi Tu and
Yi{-}Cheng Tsai and
Yen{-}Shen Shan and
Shang{-}Cheng Hung and
Gwo{-}Bin Lee},
title = {An integrated microfluidic platform for cholangiocarcinoma diagnosis
from clinical bile juice samples by utilizing multiple affinity reagents},
booktitle = {15th {IEEE} International Conference on Nano/Micro Engineered and
Molecular System, {NEMS} 2020, San Diego, CA, USA, September 27-30,
2020},
pages = {261--264},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/NEMS50311.2020.9265566},
doi = {10.1109/NEMS50311.2020.9265566},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nems/LuCHGTTSHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ococosda/ChenWLTKW20,
author = {Pin{-}Yuan Chen and
Chia{-}Hua Wu and
Hung{-}Shin Lee and
Shao{-}Kang Tsao and
Ming{-}Tat Ko and
Hsin{-}Min Wang},
title = {Using Taigi Dramas with Mandarin Chinese Subtitles to Improve Taigi
Speech Recognition},
booktitle = {23rd Conference of the Oriental {COCOSDA} International Committee
for the Co-ordination and Standardisation of Speech Databases and
Assessment Techniques, {O-COCOSDA} 2020, Yangon, Myanmar, November
5-7, 2020},
pages = {71--76},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/O-COCOSDA50338.2020.9295005},
doi = {10.1109/O-COCOSDA50338.2020.9295005},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ococosda/ChenWLTKW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rocling/WangCLLL20,
author = {Wen{-}Jet Wang and
Chia{-}Jung Chen and
Chien{-}Yu Lai and
Chia{-}Ming Lee and
Hsin{-}Hung Lin},
editor = {Jenq{-}Haur Wang and
Ying{-}Hui Lai},
title = {A Chinese Math Word Problem Solving System Based on Linguistic Theory
and Non-statistical Approach},
booktitle = {Proceedings of the 32nd Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2020, Taipei, Taiwan, September 24-26,
2020},
pages = {208--222},
publisher = {The Association for Computational Linguistics and Chinese Language
Processing {(ACLCLP)}},
year = {2020},
url = {https://aclanthology.org/2020.rocling-1.21},
timestamp = {Thu, 27 Oct 2022 16:33:44 +0200},
biburl = {https://dblp.org/rec/conf/rocling/WangCLLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggrapha/LeeHCHCH20,
author = {Dan{-}Feng Lee and
Xiang{-}Wen Huang and
Yu{-}Chia Chen and
Yu{-}Xiu Hsu and
Shu{-}Yu Chang and
Ping{-}Hsuan Han},
title = {FoodBender: Activating Utensil for Playing in the Immersive Game with
Attachable Haptic},
booktitle = {{SIGGRAPH} Asia 2019 Extended Reality Program, {SA} 2020, Virtual
Event, Republic of Korea, December 4-13, 2020},
pages = {7:1--7:2},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3415256.3421490},
doi = {10.1145/3415256.3421490},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggrapha/LeeHCHCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sii/ChenCMZL20,
author = {Oscal Tzyh{-}Chiang Chen and
Syu{-}Yang Chang and
Yu{-}Zhi Ma and
Yu{-}Cheng Zhang and
Yi Lun Lee},
title = {Time Capsule Gift with Affective Awareness of Event Memories via Near
Field Communication},
booktitle = {2020 {IEEE/SICE} International Symposium on System Integration, {SII}
2020, Honolulu, HI, USA, January 12-15, 2020},
pages = {585--589},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/SII46433.2020.9026183},
doi = {10.1109/SII46433.2020.9026183},
timestamp = {Thu, 12 Mar 2020 13:51:22 +0100},
biburl = {https://dblp.org/rec/conf/sii/ChenCMZL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/ChangCCLTWCT20,
author = {Chia{-}Yuan Chang and
Ning Chen and
Wei{-}Ting Chiang and
Chih{-}Hen Lee and
Yu{-}Hsuan Tseng and
Chuan{-}Ju Wang and
Hsien{-}Hao Chen and
Ming{-}Feng Tsai},
editor = {Ellen M. Voorhees and
Angela Ellis},
title = {Query Expansion with Semantic-Based Ellipsis Reduction for Conversational
{IR}},
booktitle = {Proceedings of the Twenty-Ninth Text REtrieval Conference, {TREC}
2020, Virtual Event [Gaithersburg, Maryland, USA], November 16-20,
2020},
series = {{NIST} Special Publication},
volume = {1266},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2020},
url = {https://trec.nist.gov/pubs/trec29/papers/ASCFDA.C.pdf},
timestamp = {Wed, 07 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/trec/ChangCCLTWCT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uss/LeeJFTP20,
author = {Dayeol Lee and
Dongha Jung and
Ian T. Fang and
Chia{-}Che Tsai and
Raluca Ada Popa},
editor = {Srdjan Capkun and
Franziska Roesner},
title = {An Off-Chip Attack on Hardware Enclaves via the Memory Bus},
booktitle = {29th {USENIX} Security Symposium, {USENIX} Security 2020, August 12-14,
2020},
pages = {487--504},
publisher = {{USENIX} Association},
year = {2020},
url = {https://www.usenix.org/conference/usenixsecurity20/presentation/lee-dayeol},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uss/LeeJFTP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/ChenLCLLCYL20,
author = {Yi{-}Ru Chen and
Hui{-}Hsin Liao and
Chia{-}Hsuan Chang and
Che{-}Chia Lin and
Chao{-}Lin Lee and
Yuan{-}Ming Chang and
Chun{-}Chieh Yang and
Jenq{-}Kuen Lee},
title = {Experiments and optimizations for {TVM} on {RISC-V} Architectures
with {P} Extension},
booktitle = {2020 International Symposium on {VLSI} Design, Automation and Test,
{VLSI-DAT} 2020, Hsinchu, Taiwan, August 10-13, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VLSI-DAT49148.2020.9196477},
doi = {10.1109/VLSI-DAT49148.2020.9196477},
timestamp = {Tue, 29 Sep 2020 11:35:15 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/ChenLCLLCYL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/OhLKZSAVFGCWMBB20,
author = {Jinwook Oh and
Sae Kyu Lee and
Mingu Kang and
Matthew M. Ziegler and
Joel Silberman and
Ankur Agrawal and
Swagath Venkataramani and
Bruce M. Fleischer and
Michael Guillorn and
Jungwook Choi and
Wei Wang and
Silvia M. Mueller and
Shimon Ben{-}Yehuda and
James Bonanno and
Nianzheng Cao and
Robert Casatuta and
Chia{-}Yu Chen and
Matt Cohen and
Ophir Erez and
Thomas W. Fox and
George Gristede and
Howard Haynie and
Vicktoria Ivanov and
Siyu Koswatta and
Shih{-}Hsien Lo and
Martin Lutz and
Gary W. Maier and
Alex Mesh and
Yevgeny Nustov and
Scot Rider and
Marcel Schaal and
Michael Scheuermann and
Xiao Sun and
Naigang Wang and
Fanchieh Yee and
Ching Zhou and
Vinay Shah and
Brian W. Curran and
Vijayalakshmi Srinivasan and
Pong{-}Fei Lu and
Sunil Shukla and
Kailash Gopalakrishnan and
Leland Chang},
title = {A 3.0 {TFLOPS} 0.62V Scalable Processor Core for High Compute Utilization
{AI} Training and Inference},
booktitle = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu,
HI, USA, June 16-19, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VLSICircuits18222.2020.9162917},
doi = {10.1109/VLSICIRCUITS18222.2020.9162917},
timestamp = {Sat, 19 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/OhLKZSAVFGCWMBB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/WenLWKY20,
author = {Chi{-}Chih Wen and
Yu{-}Chi Lee and
Yi{-}Chung Wu and
Chen{-}Chien Kao and
Chia{-}Hsiang Yang},
title = {A 1.96 Gb/s Massive {MU-MIMO} Detector for Next-Generation Cellular
Systems},
booktitle = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu,
HI, USA, June 16-19, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VLSICircuits18222.2020.9163045},
doi = {10.1109/VLSICIRCUITS18222.2020.9163045},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsic/WenLWKY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/ChenYLH20,
author = {Chiao{-}En Chen and
Hsin{-}Ching Yang and
Kelvin Kuang{-}Chi Lee and
Yuan{-}Hao Huang},
title = {Precoder Design for Transmitter Preprocessing Aided Spatial Modulated
{QPSK} Systems using One-bit DACs and Quantized Phase Shifters},
booktitle = {91st {IEEE} Vehicular Technology Conference, {VTC} Spring 2020, Antwerp,
Belgium, May 25-28, 2020},
pages = {1--5},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VTC2020-Spring48590.2020.9129416},
doi = {10.1109/VTC2020-SPRING48590.2020.9129416},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vtc/ChenYLH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/ChenYWYWCCKLKC20,
author = {Chun{-}Teng Chen and
Chia{-}Heng Yen and
Cheng{-}Yen Wen and
Cheng{-}Hao Yang and
Kai{-}Chiang Wu and
Mason Chern and
Ying{-}Yen Chen and
Chun{-}Yi Kuo and
Jih{-}Nung Lee and
Shu{-}Yi Kao and
Mango Chia{-}Tso Chao},
title = {CNN-based Stochastic Regression for {IDDQ} Outlier Identification},
booktitle = {38th {IEEE} {VLSI} Test Symposium, {VTS} 2020, San Diego, CA, USA,
April 5-8, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VTS48691.2020.9107570},
doi = {10.1109/VTS48691.2020.9107570},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vts/ChenYWYWCCKLKC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ChenLCWS20,
author = {Hsueh{-}Yi Chen and
Pei{-}Feng Lee and
Te{-}Wei Chiang and
Sheng{-}Shih Wang and
Shiann{-}Tsong Sheu},
title = {Hmc: {A} Hopping-Based Multi-Channel Coordination Scheme For Urllc
In Unlicensed Spectrum},
booktitle = {2020 {IEEE} Wireless Communications and Networking Conference, {WCNC}
2020, Seoul, Korea (South), May 25-28, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/WCNC45663.2020.9120845},
doi = {10.1109/WCNC45663.2020.9120845},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/ChenLCWS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-02580,
author = {Darsen D. Lu and
Mohan V. Dunga and
Ali M. Niknejad and
Chenming Hu and
Fu{-}Xiang Liang and
Wei{-}Chen Hung and
Jia{-}Wei Lee and
Chun{-}Hsiang Hsu and
Meng{-}Hsueh Chiang},
title = {Compact Device Models for FinFET and Beyond},
journal = {CoRR},
volume = {abs/2005.02580},
year = {2020},
url = {https://arxiv.org/abs/2005.02580},
eprinttype = {arXiv},
eprint = {2005.02580},
timestamp = {Sat, 09 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-02580.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-09218,
author = {Jia{-}Fong Yeh and
Hsin{-}Ying Lee and
Bing{-}Chen Tsai and
Yi{-}Rong Chen and
Ping{-}Chia Huang and
Winston H. Hsu},
title = {Large Margin Mechanism and Pseudo Query Set on Cross-Domain Few-Shot
Learning},
journal = {CoRR},
volume = {abs/2005.09218},
year = {2020},
url = {https://arxiv.org/abs/2005.09218},
eprinttype = {arXiv},
eprint = {2005.09218},
timestamp = {Wed, 28 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-09218.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02480,
author = {David Cheng{-}Han Chiang and
Sung{-}Feng Huang and
Hung{-}yi Lee},
title = {Pretrained Language Model Embryology: The Birth of {ALBERT}},
journal = {CoRR},
volume = {abs/2010.02480},
year = {2020},
url = {https://arxiv.org/abs/2010.02480},
eprinttype = {arXiv},
eprint = {2010.02480},
timestamp = {Thu, 22 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02480.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02667,
author = {Ruey{-}Cheng Chen and
Chia{-}Jung Lee},
title = {Incorporating Behavioral Hypotheses for Query Generation},
journal = {CoRR},
volume = {abs/2010.02667},
year = {2020},
url = {https://arxiv.org/abs/2010.02667},
eprinttype = {arXiv},
eprint = {2010.02667},
timestamp = {Mon, 12 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02667.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-12683,
author = {Jyun{-}Yu Jiang and
Chenyan Xiong and
Chia{-}Jung Lee and
Wei Wang},
title = {Long Document Ranking with Query-Directed Sparse Transformer},
journal = {CoRR},
volume = {abs/2010.12683},
year = {2020},
url = {https://arxiv.org/abs/2010.12683},
eprinttype = {arXiv},
eprint = {2010.12683},
timestamp = {Mon, 02 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-12683.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-04322,
author = {Hsu{-}Chun Hsiao and
Chun{-}Ying Huang and
Bing{-}Kai Hong and
Shin{-}Ming Cheng and
Hsin{-}Yuan Hu and
Chia{-}Chien Wu and
Jian{-}Sin Lee and
Shih{-}Hong Wang and
Wei Jeng},
title = {An Empirical Evaluation of Bluetooth-based Decentralized Contact Tracing
in Crowds},
journal = {CoRR},
volume = {abs/2011.04322},
year = {2020},
url = {https://arxiv.org/abs/2011.04322},
eprinttype = {arXiv},
eprint = {2011.04322},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-04322.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-11995,
author = {David Cheng{-}Han Chiang and
Hung{-}yi Lee},
title = {Pre-Training a Language Model Without Human Language},
journal = {CoRR},
volume = {abs/2012.11995},
year = {2020},
url = {https://arxiv.org/abs/2012.11995},
eprinttype = {arXiv},
eprint = {2012.11995},
timestamp = {Tue, 05 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2012-11995.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChenLCLLKL19,
author = {Fu{-}Hsing Chen and
Chia{-}Lun Lee and
Jui{-}Hung Chang and
Wei{-}Sheng Liao and
Chieh{-}An Lin and
Chia{-}Wei Kuo and
Chih{-}Lung Lin},
title = {Long-Term Behavior of Hydrogenated Amorphous Silicon Thin-Film Transistors
Covered With Color Filters for Use in Optical Sensors},
journal = {{IEEE} Access},
volume = {7},
pages = {116172--116178},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2936405},
doi = {10.1109/ACCESS.2019.2936405},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChenLCLLKL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LeeLCC19,
author = {Chia{-}Han Lee and
Jia{-}Wei Lin and
Po{-}Hao Chen and
Yu{-}Chieh Chang},
title = {Deep Learning-Constructed Joint Transmission-Recognition for Internet
of Things},
journal = {{IEEE} Access},
volume = {7},
pages = {76547--76561},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2920929},
doi = {10.1109/ACCESS.2019.2920929},
timestamp = {Mon, 08 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LeeLCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/WangCCHLHSCL19,
author = {Kuo{-}Wei Wang and
Chia{-}Yuen Chen and
Hsiao{-}Huang Chang and
Chuan{-}Chih Hsu and
Gong{-}Yau Lan and
Hao{-}Teng Hsu and
Kuo{-}Kai Shyu and
Wing P. Chan and
Po{-}Lei Lee},
title = {A Multivariate Empirical Mode Decomposition-Based Data-Driven Approach
for Extracting Task-Dependent Hemodynamic Responses in Olfactory-Induced
fMRI},
journal = {{IEEE} Access},
volume = {7},
pages = {15375--15388},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2893923},
doi = {10.1109/ACCESS.2019.2893923},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/WangCCHLHSCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/caee/TarngLLLL19,
author = {Wernhuar Tarng and
Chia{-}Lin Liu and
Chi{-}Young Lee and
Chih{-}Ming Lin and
Yun{-}Chen Lu},
title = {A virtual laboratory for learning fullerene production and nanostructure
analysis},
journal = {Comput. Appl. Eng. Educ.},
volume = {27},
number = {2},
pages = {472--484},
year = {2019},
url = {https://doi.org/10.1002/cae.22089},
doi = {10.1002/CAE.22089},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/caee/TarngLLLL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/ChenLHLCTCL19,
author = {Chia{-}Hung Chen and
Yan{-}Wei Lee and
Yao{-}Sian Huang and
Wei{-}Ren Lan and
Ruey{-}Feng Chang and
Chih{-}Yen Tu and
Chih{-}Yu Chen and
Wei{-}Chih Liao},
title = {Computer-aided diagnosis of endobronchial ultrasound images using
convolutional neural network},
journal = {Comput. Methods Programs Biomed.},
volume = {177},
pages = {175--182},
year = {2019},
url = {https://doi.org/10.1016/j.cmpb.2019.05.020},
doi = {10.1016/J.CMPB.2019.05.020},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/ChenLHLCTCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icl/LoLCY19,
author = {Yun{-}Feng Lo and
Chia{-}Han Lee and
Po{-}Chun Chou and
Ping{-}Cheng Yeh},
title = {Modeling Molecular Communications in Tubes With Poiseuille Flow and
Robin Boundary Condition},
journal = {{IEEE} Commun. Lett.},
volume = {23},
number = {8},
pages = {1314--1318},
year = {2019},
url = {https://doi.org/10.1109/LCOMM.2019.2920830},
doi = {10.1109/LCOMM.2019.2920830},
timestamp = {Thu, 20 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/icl/LoLCY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/YangLC19,
author = {Richard Hsin{-}Hsyong Yang and
Chia{-}Kun Lee and
Shiunn{-}Jang Chern},
title = {Performance Improvement of the Catastrophic {CPM} Scheme with New
Split-Merged {MNSED}},
journal = {{IEICE} Trans. Commun.},
volume = {102-B},
number = {11},
pages = {2091--2103},
year = {2019},
url = {https://doi.org/10.1587/transcom.2018EBP3143},
doi = {10.1587/TRANSCOM.2018EBP3143},
timestamp = {Mon, 18 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieicet/YangLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/SuCLC19,
author = {I{-}Fang Su and
Ding{-}Li Chen and
Chiang Lee and
Yu{-}Chi Chung},
title = {Finding Visible \emph{k}NN Objects in the Presence of Obstacles within
the User's View Field {\textdagger}},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {8},
number = {3},
pages = {151},
year = {2019},
url = {https://doi.org/10.3390/ijgi8030151},
doi = {10.3390/IJGI8030151},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/SuCLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/OuYLHTLCL19,
author = {I{-}Che Ou and
Jia{-}Ping Yang and
Chia{-}Hung Liu and
Kai{-}Jie Huang and
Kun{-}Ju Tsai and
Yu Lee and
Yuan{-}Hua Chu and
Yu{-}Te Liao},
title = {A Sustainable Soil Energy Harvesting System With Wide-Range Power-Tracking
Architecture},
journal = {{IEEE} Internet Things J.},
volume = {6},
number = {5},
pages = {8384--8392},
year = {2019},
url = {https://doi.org/10.1109/JIOT.2019.2917593},
doi = {10.1109/JIOT.2019.2917593},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/OuYLHTLCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NgYRDZLPYVLGLHB19,
author = {Kian Ann Ng and
Chao Yuan and
Astrid Rusly and
Anh{-}Tuan Do and
Bin Zhao and
Shih{-}Chiang Liu and
Wendy Yen Xian Peh and
Thow Xin Yuan and
Kai Voges and
Sanghoon Lee and
Gil Gerald Lasam Gammad and
Khay{-}Wai Leong and
John S. Ho and
Silvia Bossi and
Gemma Taverni and
Annarita Cutrone and
Shih{-}Cheng Yen and
Yong Ping Xu},
title = {A Wireless Multi-Channel Peripheral Nerve Signal Acquisition System-on-Chip},
journal = {{IEEE} J. Solid State Circuits},
volume = {54},
number = {8},
pages = {2266--2280},
year = {2019},
url = {https://doi.org/10.1109/JSSC.2019.2909158},
doi = {10.1109/JSSC.2019.2909158},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NgYRDZLPYVLGLHB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ShihLCLLCLYYCCC19,
author = {Yi{-}Chun Shih and
Chia{-}Fu Lee and
Yen{-}An Chang and
Po{-}Hao Lee and
Hon{-}Jarn Lin and
Yu{-}Lin Chen and
Ku{-}Feng Lin and
Ta{-}Ching Yeh and
Hung{-}Chang Yu and
Harry Chuang and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang},
title = {Logic Process Compatible 40-nm 16-Mb, Embedded Perpendicular-MRAM
With Hybrid-Resistance Reference, Sub- {\textdollar}{\textbackslash}mu{\textdollar}
{A} Sensing Resolution, and 17.5-nS Read Access Time},
journal = {{IEEE} J. Solid State Circuits},
volume = {54},
number = {4},
pages = {1029--1038},
year = {2019},
url = {https://doi.org/10.1109/JSSC.2018.2889106},
doi = {10.1109/JSSC.2018.2889106},
timestamp = {Wed, 07 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ShihLCLLCLYYCCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvcir/YehLCYLT19,
author = {Chih{-}Hsuan Yeh and
Jie{-}Ru Lin and
Mei{-}Juan Chen and
Chia{-}Hung Yeh and
Cheng{-}An Lee and
Kuang{-}Han Tai},
title = {Fast prediction for quality scalability of High Efficiency Video Coding
Scalable Extension},
journal = {J. Vis. Commun. Image Represent.},
volume = {58},
pages = {462--476},
year = {2019},
url = {https://doi.org/10.1016/j.jvcir.2018.12.021},
doi = {10.1016/J.JVCIR.2018.12.021},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jvcir/YehLCYLT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/PengCJHCCYFLC19,
author = {Szu{-}Min Peng and
Han{-}Mo Chiu and
Hsiao{-}Hsuan Jen and
Chen{-}Yang Hsu and
Sam Li{-}Sheng Chen and
Sherry Yueh{-}Hsia Chiu and
Amy Ming{-}Fang Yen and
Jean Ching{-}Yuan Fann and
Yi{-}Chia Lee and
Hsiu{-}Hsi Chen},
title = {Quantile-based fecal hemoglobin concentration for assessing colorectal
neoplasms with 1, 263, 717 Taiwanese screenees},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {19},
number = {1},
pages = {94:1--94:10},
year = {2019},
url = {https://doi.org/10.1186/s12911-019-0812-1},
doi = {10.1186/S12911-019-0812-1},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/PengCJHCCYFLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LaiCCLYLLCC19,
author = {Yu{-}Chi Lai and
Chia{-}Hsing Chiu and
Zhong{-}Qi Cai and
Jin{-}Yang Lin and
Chih{-}Yuan Yao and
Dong{-}Yuan Lyu and
Shyh{-}Yuan Lee and
Kuo{-}Wei Chen and
I{-}Yu Chen},
title = {OCT-Based Periodontal Inspection Framework},
journal = {Sensors},
volume = {19},
number = {24},
pages = {5496},
year = {2019},
url = {https://doi.org/10.3390/s19245496},
doi = {10.3390/S19245496},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LaiCCLYLLCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeHCHJW19,
author = {Chi{-}Yuan Lee and
Chin{-}Lung Hsieh and
Chia{-}Hung Chen and
Yen{-}Pu Huang and
Chong{-}An Jiang and
Pei{-}Chi Wu},
title = {A Flexible 5-In-1 Microsensor for Internal Microscopic Diagnosis of
Vanadium Redox Flow Battery Charging Process},
journal = {Sensors},
volume = {19},
number = {5},
pages = {1030},
year = {2019},
url = {https://doi.org/10.3390/s19051030},
doi = {10.3390/S19051030},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LeeHCHJW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ChenHLWS19,
author = {Yi{-}Chen Chen and
Sung{-}Feng Huang and
Hung{-}yi Lee and
Yu{-}Hsuan Wang and
Chia{-}Hao Shen},
title = {Audio Word2vec: Sequence-to-Sequence Autoencoding for Unsupervised
Learning of Audio Segmentation and Representation},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {27},
number = {9},
pages = {1481--1493},
year = {2019},
url = {https://doi.org/10.1109/TASLP.2019.2922832},
doi = {10.1109/TASLP.2019.2922832},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/ChenHLWS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/QianWYCCCYLLLCL19,
author = {Xin{-}Hong Qian and
Yi{-}Chung Wu and
Tzu{-}Yi Yang and
Cheng{-}Hsiang Cheng and
Hsing{-}Chien Chu and
Wan{-}Hsueh Cheng and
Ting{-}Yang Yen and
Tzu{-}Han Lin and
Yung{-}Jen Lin and
Yu{-}Chi Lee and
Jia{-}Heng Chang and
Shih{-}Ting Lin and
Shang{-}Hsuan Li and
Tsung{-}Chen Wu and
Chien{-}Chang Huang and
Sung{-}Hao Wang and
Chia{-}Fone Lee and
Chia{-}Hsiang Yang and
Chung{-}Chih Hung and
Tai{-}Shih Chi and
Chien{-}Hao Liu and
Ming{-}Dou Ker and
Chung{-}Yu Wu},
title = {Design and In Vivo Verification of a {CMOS} Bone-Guided Cochlear Implant
Microsystem},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {66},
number = {11},
pages = {3156--3167},
year = {2019},
url = {https://doi.org/10.1109/TBME.2019.2901374},
doi = {10.1109/TBME.2019.2901374},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/QianWYCCCYLLLCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LeeCCH19,
author = {Ling Lee and
Chun{-}An Chen and
Chiao{-}En Chen and
Yuan{-}Hao Huang},
title = {Square-Root Generalized Eigenvalue Decomposition Processor for Leakage-Based
Multi-User {MIMO} Precoding With Multi-Antenna Users},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {66-I},
number = {6},
pages = {2382--2393},
year = {2019},
url = {https://doi.org/10.1109/TCSI.2019.2893274},
doi = {10.1109/TCSI.2019.2893274},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LeeCCH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/HwangLP19,
author = {Wen{-}Liang Hwang and
Chia{-}Chen Lee and
Guan{-}Ju Peng},
title = {Multi-Objective Optimization and Characterization of Pareto Points
for Scalable Coding},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {29},
number = {7},
pages = {2096--2111},
year = {2019},
url = {https://doi.org/10.1109/TCSVT.2018.2851999},
doi = {10.1109/TCSVT.2018.2851999},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcsv/HwangLP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/LinWLCLWY19,
author = {Chih{-}Lung Lin and
Chia{-}En Wu and
Chia{-}Lun Lee and
Fu{-}Hsing Chen and
Yu{-}Sheng Lin and
Wan{-}Lin Wu and
Jian{-}Shen Yu},
title = {Alternately Controlled Optical Pixel Sensor System Using Amorphous
Silicon Thin-Film Transistors},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {66},
number = {9},
pages = {7366--7375},
year = {2019},
url = {https://doi.org/10.1109/TIE.2018.2880718},
doi = {10.1109/TIE.2018.2880718},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/LinWLCLWY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnse/ChangCCLL19,
author = {Cheng{-}Hsun Chang and
Cheng{-}Shang Chang and
Chia{-}Tai Chang and
Duan{-}Shin Lee and
Ping{-}En Lu},
title = {Exponentially Twisted Sampling for Centrality Analysis and Community
Detection in Attributed Networks},
journal = {{IEEE} Trans. Netw. Sci. Eng.},
volume = {6},
number = {4},
pages = {684--697},
year = {2019},
url = {https://doi.org/10.1109/TNSE.2018.2870671},
doi = {10.1109/TNSE.2018.2870671},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnse/ChangCCLL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/3dic/LeeCLIKCO19,
author = {Chia{-}Hsuan Lee and
Hsin{-}Chi Chang and
Jui{-}Han Liu and
Hiroyuki Ito and
Young{-}Suk Kim and
Kuan{-}Neng Chen and
Takayuki Ohba},
title = {Temperature Cycling Reliability of {WOW} Bumpless Through Silicon
Vias},
booktitle = {2019 International 3D Systems Integration Conference (3DIC), Sendai,
Japan, October 8-10, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/3DIC48104.2019.9058776},
doi = {10.1109/3DIC48104.2019.9058776},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/3dic/LeeCLIKCO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/3dic/TsaiLC19,
author = {Yi{-}Chieh Tsai and
Chia{-}Hsuan Lee and
Kuan{-}Neng Chen},
title = {Investigation of Low Temperature Cu Pillar Eutectic Bonding for 3D
Chip Stacking Technology},
booktitle = {2019 International 3D Systems Integration Conference (3DIC), Sendai,
Japan, October 8-10, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/3DIC48104.2019.9058877},
doi = {10.1109/3DIC48104.2019.9058877},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/3dic/TsaiLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACMdis/ChenHLHL19,
author = {Liang{-}Yu Chen and
Ji{-}Hong Huang and
Yu{-}Hao Lee and
Chia{-}Hsu Huang and
Rung{-}Huei Liang},
editor = {Steve Harrison and
Shaowen Bardzell and
Carman Neustaedter and
Deborah G. Tatar},
title = {A World Following Farmer Almanac: Speculation on Lifestyle Interweaving
Folk Religion and Smart Home},
booktitle = {Companion Publication of the 2019 on Designing Interactive Systems
Conference, {DIS} 2019, San Diego, CA, USA, June 23-28, 2019},
pages = {147--151},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3301019.3323914},
doi = {10.1145/3301019.3323914},
timestamp = {Fri, 17 Nov 2023 08:06:23 +0100},
biburl = {https://dblp.org/rec/conf/ACMdis/ChenHLHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/LuXCLS19,
author = {Chien{-}Yu Lu and
Min{-}Xin Xue and
Chia{-}Che Chang and
Che{-}Rung Lee and
Li Su},
title = {Play as You Like: Timbre-Enhanced Multi-Modal Music Style Transfer},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {1061--1068},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33011061},
doi = {10.1609/AAAI.V33I01.33011061},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/LuXCLS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LinCLLZXRHZMALN19,
author = {Yu{-}Hsiang Lin and
Chian{-}Yu Chen and
Jean Lee and
Zirui Li and
Yuyan Zhang and
Mengzhou Xia and
Shruti Rijhwani and
Junxian He and
Zhisong Zhang and
Xuezhe Ma and
Antonios Anastasopoulos and
Patrick Littell and
Graham Neubig},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {Choosing Transfer Languages for Cross-Lingual Learning},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {3125--3135},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1301},
doi = {10.18653/V1/P19-1301},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LinCLLZXRHZMALN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apnoms/LeeWWKHWLCT19,
author = {Tsu{-}Kuang Lee and
Tong{-}Wen Wang and
Wen{-}Xuan Wu and
Yu{-}Chiao Kuo and
Shih{-}Hsuan Huang and
Guan{-}Sheng Wang and
Chih{-}Yu Lin and
Jen{-}Jee Chen and
Yu{-}Chee Tseng},
title = {Building a {V2X} Simulation Framework for Future Autonomous Driving},
booktitle = {20th Asia-Pacific Network Operations and Management Symposium, {APNOMS}
2019, Matsue, Japan, September 18-20, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/APNOMS.2019.8892860},
doi = {10.23919/APNOMS.2019.8892860},
timestamp = {Thu, 14 Nov 2019 12:20:00 +0100},
biburl = {https://dblp.org/rec/conf/apnoms/LeeWWKHWLCT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/TuWYLCCL19,
author = {Ching{-}Sheng Tu and
Chen{-}Yu Wu and
Ying{-}Jie You and
Shie{-}Jue Lee and
Sharon Chia{-}Ju Chen and
Mei{-}Chuan Chou and
Ching{-}Kuan Liu},
title = {A LVQ-Based Identification System for Pathological Brain Aging Diseases},
booktitle = {12th International Congress on Image and Signal Processing, BioMedical
Engineering and Informatics, {CISP-BMEI} 2019, Suzhou, China, October
19-21, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CISP-BMEI48845.2019.8965956},
doi = {10.1109/CISP-BMEI48845.2019.8965956},
timestamp = {Thu, 03 Dec 2020 11:15:26 +0100},
biburl = {https://dblp.org/rec/conf/bmei/TuWYLCCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/LeeCLCCCS19,
author = {Hao{-}Ping Lee and
Kuan{-}yin Chen and
Chih{-}Heng Lin and
Chia{-}Yu Chen and
Yu{-}Lin Chung and
Yung{-}Ju Chang and
Chien{-}Ru Sun},
editor = {Stephen A. Brewster and
Geraldine Fitzpatrick and
Anna L. Cox and
Vassilis Kostakos},
title = {Does \emph{Who} Matter?: Studying the Impact of Relationship Characteristics
on Receptivity to Mobile {IM} Messages},
booktitle = {Proceedings of the 2019 {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2019, Glasgow, Scotland, UK, May 04-09, 2019},
pages = {526},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3290605.3300756},
doi = {10.1145/3290605.3300756},
timestamp = {Sun, 22 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/LeeCLCCCS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dasc/ChenZLKL19,
author = {Oscal Tzyh{-}Chiang Chen and
Yu{-}Cheng Zhang and
Zheng Kuan Lin and
Pei{-}I Kuo and
Yi Lun Lee},
title = {Camera-in-Hand Robotic Arm Using a Deep Neural Network to Realize
Unmanned Store Service},
booktitle = {2019 {IEEE} Intl Conf on Dependable, Autonomic and Secure Computing,
Intl Conf on Pervasive Intelligence and Computing, Intl Conf on Cloud
and Big Data Computing, Intl Conf on Cyber Science and Technology
Congress, DASC/PiCom/CBDCom/CyberSciTech 2019, Fukuoka, Japan, August
5-8, 2019},
pages = {833--839},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/DASC/PiCom/CBDCom/CyberSciTech.2019.00152},
doi = {10.1109/DASC/PICOM/CBDCOM/CYBERSCITECH.2019.00152},
timestamp = {Sun, 10 Nov 2019 16:47:28 +0100},
biburl = {https://dblp.org/rec/conf/dasc/ChenZLKL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dmip/LeeWHLLCWLWGW19,
author = {Wei{-}Kai Lee and
Chih{-}Chun Wu and
Tzu{-}Hsuan Huang and
Chun{-}Yi Lin and
Cheng{-}Chia Lee and
Wen{-}Yuh Chung and
Po{-}Shan Wang and
Chia{-}Feng Lu and
Hsiu{-}Mei Wu and
Wan{-}Yuo Guo and
Yu{-}Te Wu},
title = {Segmentation of Vestibular Schwannoma from Multi-parametric Magnetic
Resonance Images using Convolutional Neural Network},
booktitle = {{DMIP} 2019: 2nd International Conference on Digital Medicine and
Image Processing, Shanghai, China, November, 2019},
pages = {8--11},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3379299.3379300},
doi = {10.1145/3379299.3379300},
timestamp = {Wed, 22 Mar 2023 15:07:50 +0100},
biburl = {https://dblp.org/rec/conf/dmip/LeeWHLLCWLWGW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ehealth/LeeWY19,
author = {Hsien Ju Lee and
Shu{-}yi Wei and
Chia{-}Chi Yen},
editor = {Patty Kostkova and
Caroline Wood and
Arnold Bosman and
Floriana Grasso and
Michael Edelstein},
title = {Outcomes of {HERO} Clinic Services for Chemsex Practitioners},
booktitle = {Proceedings of the 9th International Conference on Digital Public
Health, {PDH} 2019, Marseille, France, November 20-23, 2019},
pages = {119--120},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3357729.3357751},
doi = {10.1145/3357729.3357751},
timestamp = {Tue, 26 Nov 2019 10:09:19 +0100},
biburl = {https://dblp.org/rec/conf/ehealth/LeeWY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LeeCL19,
author = {Chia{-}Hsuan Lee and
Yun{-}Nung Chen and
Hung{-}yi Lee},
title = {Mitigating the Impact of Speech Recognition Errors on Spoken Question
Answering by Adversarial Domain Adaptation},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2019, Brighton, United Kingdom, May 12-17, 2019},
pages = {7300--7304},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICASSP.2019.8683377},
doi = {10.1109/ICASSP.2019.8683377},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/LeeCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TsaiCWHL19,
author = {Richard Tzong{-}Han Tsai and
Chia{-}Hao Chen and
Chun{-}Kai Wu and
Yu{-}Cheng Hsiao and
Hung{-}yi Lee},
title = {Using Deep-Q Network to Select Candidates from N-best Speech Recognition
Hypotheses for Enhancing Dialogue State Tracking},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2019, Brighton, United Kingdom, May 12-17, 2019},
pages = {7375--7379},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICASSP.2019.8683749},
doi = {10.1109/ICASSP.2019.8683749},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/TsaiCWHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/LeeCYWH19,
author = {Ko{-}Feng Lee and
Yen{-}Lin Chen and
Chao{-}Wei Yu and
Cheng Han Wu and
Chia{-}Yu Hsiao},
title = {Low-cost Wearable Eye Gaze Detection and Tracking System},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2019, Yilan, Taiwan, May 20-22, 2019},
pages = {1--2},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCE-TW46550.2019.8991784},
doi = {10.1109/ICCE-TW46550.2019.8991784},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/LeeCYWH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/YuCLCH19,
author = {Chao{-}Wei Yu and
Yen{-}Lin Chen and
Ko{-}Feng Lee and
Chen{-}Hsiang Chen and
Chia{-}Yu Hsiao},
title = {Efficient Intelligent Automatic Image Annotation Method based on Machine
Learning Techniques},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2019, Yilan, Taiwan, May 20-22, 2019},
pages = {1--2},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCE-TW46550.2019.8991727},
doi = {10.1109/ICCE-TW46550.2019.8991727},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/YuCLCH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LeeLYC19,
author = {Chien{-}I Lee and
Meng{-}Yao Lin and
Chia{-}Lin Yang and
Yen{-}Kuang Chen},
title = {Iotbench: {A} Benchmark Suite for Intelligent Internet of Things Edge
Devices},
booktitle = {2019 {IEEE} International Conference on Image Processing, {ICIP} 2019,
Taipei, Taiwan, September 22-25, 2019},
pages = {170--174},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICIP.2019.8802949},
doi = {10.1109/ICIP.2019.8802949},
timestamp = {Wed, 11 Dec 2019 16:30:23 +0100},
biburl = {https://dblp.org/rec/conf/icip/LeeLYC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/LeeSCTSCC19,
author = {Chien{-}Nan Lee and
Meng{-}Hsuan Shih and
Chia{-}Wei Chen and
Ding{-}Jiun Tzeng and
Chuan{-}Che Shih and
Yiu{-}Tong Chu and
Ling Cheng},
title = {A Wearable Device of Salivation Detection and Improvement for Elderly
at High Risk for Dysphagia},
booktitle = {2019 International Conference on Machine Learning and Cybernetics,
{ICMLC} 2019, Kobe, Japan, July 7-10, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICMLC48188.2019.8949257},
doi = {10.1109/ICMLC48188.2019.8949257},
timestamp = {Tue, 14 Jan 2020 10:49:23 +0100},
biburl = {https://dblp.org/rec/conf/icmlc/LeeSCTSCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/ZhangLLCLHDWKSY19,
author = {You{-}Chen Zhang and
Chung{-}Hong Lee and
Tyng{-}Yeu Liang and
Wei{-}Che Chung and
Kuei{-}Han Li and
Cheng{-}Chieh Huang and
Hong{-}Jie Dai and
Chi{-}Shin Wu and
Chian{-}Jue Kuo and
Chu{-}Hsien Su and
Horng{-}Chang Yang},
title = {Depressive Symptoms and Functional Impairments Extraction From Electronic
Health Records},
booktitle = {2019 International Conference on Machine Learning and Cybernetics,
{ICMLC} 2019, Kobe, Japan, July 7-10, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICMLC48188.2019.8949199},
doi = {10.1109/ICMLC48188.2019.8949199},
timestamp = {Tue, 14 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmlc/ZhangLLCLHDWKSY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeehpcs/LyuLLTH19,
author = {Yi{-}Hong Lyu and
Cheng{-}Yueh Liu and
Chen{-}Pang Lee and
Chia{-}Heng Tu and
Shih{-}Hao Hung},
title = {Modeling Interprocessor Communication and Performance Scalability
for Distributed Deep Learning Systems},
booktitle = {17th International Conference on High Performance Computing {\&}
Simulation, {HPCS} 2019, Dublin, Ireland, July 15-19, 2019},
pages = {169--176},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/HPCS48598.2019.9188168},
doi = {10.1109/HPCS48598.2019.9188168},
timestamp = {Wed, 16 Sep 2020 15:39:05 +0200},
biburl = {https://dblp.org/rec/conf/ieeehpcs/LyuLLTH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieem/CheongC19,
author = {Michelle L. F. Cheong and
Yong Qing Chia},
title = {Simulation Model to Evaluate Effectiveness of Queue Management Tool
in Supermarket Retail Chain},
booktitle = {2019 {IEEE} International Conference on Industrial Engineering and
Engineering Management, {IEEM} 2019, Macao, Macao, December 15-18,
2019},
pages = {606--610},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IEEM44572.2019.8978794},
doi = {10.1109/IEEM44572.2019.8978794},
timestamp = {Tue, 04 Feb 2020 13:23:52 +0100},
biburl = {https://dblp.org/rec/conf/ieem/CheongC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/OuyangCYCLLOCWW19,
author = {Yen{-}Chieh Ouyang and
Chein{-}I Chang and
Yung{-}Jhe Yan and
Bo{-}Han Chen and
Meng{-}Chueh Lee and
Tsang{-}Sen Liu and
Mang Ou{-}Yang and
Hsian{-}Min Chen and
Chao{-}Cheng Wu and
Chia{-}Hsien Wen and
Min{-}Shao Shih},
title = {Quality Inspection of Phalaenopsis Hybrids Using Hyperspectral Band
Selection Techniques},
booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
pages = {2201--2204},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IGARSS.2019.8898775},
doi = {10.1109/IGARSS.2019.8898775},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/OuyangCYCLLOCWW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LeeTHCLLLLH19,
author = {Shuenn{-}Yuh Lee and
Chieh Tsou and
Peng{-}Wei Huang and
Po{-}Hao Cheng and
Chi{-}Chung Liao and
Zhan{-}Xien Liao and
Hao{-}Yun Lee and
Chou{-}Ching K. Lin and
Chia{-}Hsiang Hsieh},
title = {A Programmable Wireless {EEG} Monitoring SoC with Open/Closed-Loop
Optogenetic and Electrical Stimulation for Epilepsy Control},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019,
San Francisco, CA, USA, February 17-21, 2019},
pages = {372--374},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISSCC.2019.8662385},
doi = {10.1109/ISSCC.2019.8662385},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/LeeTHCLLLLH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/NienWLCCCLKC19,
author = {Yu{-}Teng Nien and
Kai{-}Chiang Wu and
Dong{-}Zhen Lee and
Ying{-}Yen Chen and
Po{-}Lin Chen and
Mason Chern and
Jih{-}Nung Lee and
Shu{-}Yi Kao and
Mango Chia{-}Tso Chao},
title = {Methodology of Generating Timing-Slack-Based Cell-Aware Tests},
booktitle = {{IEEE} International Test Conference, {ITC} 2019, Washington, DC,
USA, November 9-15, 2019},
pages = {1--10},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ITC44170.2019.9000119},
doi = {10.1109/ITC44170.2019.9000119},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itc/NienWLCCCLKC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mhci/LeeDLCCCC19,
author = {Hao{-}Ping Lee and
Tilman Dingler and
Chih{-}Heng Lin and
Kuan{-}yin Chen and
Yu{-}Lin Chung and
Chia{-}Yu Chen and
Yung{-}Ju Chang},
title = {Predicting Smartphone Users' General Responsiveness to {IM} Contacts
Based on {IM} Behavior},
booktitle = {Proceedings of the 21st International Conference on Human-Computer
Interaction with Mobile Devices and Services, MobileHCI 2019, Taipei,
Taiwan, October 1-4, 2019},
pages = {40:1--40:6},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3338286.3344387},
doi = {10.1145/3338286.3344387},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mhci/LeeDLCCCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/WangCCCYLCLLCCC19,
author = {Hao{-}Jen Wang and
Leng{-}Rong Chen and
Li{-}Wei Chen and
Yi{-}Chang Chen and
Shun{-}Mao Yang and
Mong{-}Wei Lin and
Joseph Chang and
Chia{-}Chen Li and
Chia{-}Yen Lee and
Jin{-}Shing Chen and
Yeun{-}Chung Chang and
Chung{-}Ming Chen},
editor = {Elsa D. Angelini and
Bennett A. Landman},
title = {Discrimination of benign and malignant pulmonary tumors in computed
tomography: effective priori information of fast learning network
architecture},
booktitle = {Medical Imaging 2019: Image Processing, San Diego, California, United
States, 16-21 February 2019},
series = {{SPIE} Proceedings},
volume = {10949},
pages = {109493B},
publisher = {{SPIE}},
year = {2019},
url = {https://doi.org/10.1117/12.2512846},
doi = {10.1117/12.2512846},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miip/WangCCCYLCLLCCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socc/ChangWLLCW19,
author = {Yan{-}Ping Chang and
Teng{-}Chia Wang and
Yun{-}Ju Lee and
Chia{-}Chun Lin and
Yung{-}Chih Chen and
Chun{-}Yao Wang},
title = {A Smart Single-Sensor Device for Instantaneously Monitoring Lower
Limb Exercises},
booktitle = {32nd {IEEE} International System-on-Chip Conference, {SOCC} 2019,
Singapore, September 3-6, 2019},
pages = {197--202},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/SOCC46988.2019.1570548017},
doi = {10.1109/SOCC46988.2019.1570548017},
timestamp = {Tue, 19 May 2020 13:56:11 +0200},
biburl = {https://dblp.org/rec/conf/socc/ChangWLLCW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/LuPVLVC19,
author = {Yun{-}Wen Lu and
Antoon Purnal and
Simon Vandenhende and
Chen{-}Yi Lee and
Ingrid Verbauwhede and
Hsie{-}Chia Chang},
title = {A Lightweight 1.16 pJ/bit Processor for the Authenticated Encryption
Scheme KetjeSR},
booktitle = {International Symposium on {VLSI} Design, Automation and Test, {VLSI-DAT}
2019, Hsinchu, Taiwan, April 22-25, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/VLSI-DAT.2019.8741601},
doi = {10.1109/VLSI-DAT.2019.8741601},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/LuPVLVC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/GallagherCCHSWB19,
author = {William J. Gallagher and
Eric Chien and
Tien{-}Wei Chiang and
Jian{-}Cheng Huang and
Meng{-}Chun Shih and
C. Y. Wang and
Christine Bair and
George Lee and
Yi{-}Chun Shih and
Chia{-}Fu Lee and
Roger Wang and
Kuei{-}Hung Shen and
J. J. Wu and
Wayne Wang and
Harry Chuang},
title = {Recent Progress and Next Directions for Embedded {MRAM} Technology},
booktitle = {2019 Symposium on {VLSI} Circuits, Kyoto, Japan, June 9-14, 2019},
pages = {190},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/VLSIC.2019.8777932},
doi = {10.23919/VLSIC.2019.8777932},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/GallagherCCHSWB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/LinHTTHCHHCGFRL19,
author = {Mu{-}Shan Lin and
Tze{-}Chiang Huang and
Chien{-}Chun Tsai and
King{-}Ho Tam and
Kenny Cheng{-}Hsiang Hsieh and
Tom Chen and
Wen{-}Hung Huang and
Jack Hu and
Yu{-}Chi Chen and
Sandeep Kumar Goel and
Chin{-}Ming Fu and
Stefan Rusu and
Chao{-}Chieh Li and
Sheng{-}Yao Yang and
Mei Wong and
Shu{-}Chun Yang and
Frank Lee},
title = {A 7nm 4GHz Arm\({}^{\mbox{{\textregistered}}}\)-core-based CoWoS\({}^{\mbox{{\textregistered}}}\)
Chiplet Design for High Performance Computing},
booktitle = {2019 Symposium on {VLSI} Circuits, Kyoto, Japan, June 9-14, 2019},
pages = {28},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/VLSIC.2019.8778161},
doi = {10.23919/VLSIC.2019.8778161},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/LinHTTHCHHCGFRL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/LinKZL19,
author = {Chia{-}Hung Lin and
Wei{-}Cheng Kao and
Shi{-}Qing Zhan and
Ta{-}Sung Lee},
title = {BsNet: {A} Deep Learning-Based Beam Selection Method for mmWave Communications},
booktitle = {90th {IEEE} Vehicular Technology Conference, {VTC} Fall 2019, Honolulu,
HI, USA, September 22-25, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/VTCFall.2019.8891363},
doi = {10.1109/VTCFALL.2019.8891363},
timestamp = {Mon, 20 Dec 2021 11:29:04 +0100},
biburl = {https://dblp.org/rec/conf/vtc/LinKZL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/WuLHCWKCCCL19,
author = {Tse{-}Wei Wu and
Dong{-}Zhen Lee and
Yu{-}Hao Huang and
Mango C.{-}T. Chao and
Kai{-}Chiang Wu and
Shu{-}Yi Kao and
Ying{-}Yen Chen and
Po{-}Lin Chen and
Mason Chern and
Jih{-}Nung Lee},
title = {Layout-Based Dual-Cell-Aware Tests},
booktitle = {37th {IEEE} {VLSI} Test Symposium, {VTS} 2019, Monterey, CA, USA,
April 23-25, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/VTS.2019.8758646},
doi = {10.1109/VTS.2019.8758646},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/vts/WuLHCWKCCCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/LeeKHWLT19,
author = {Tzu{-}Kuang Lee and
Yu{-}Chiao Kuo and
Shih{-}Hsuan Huang and
Guan{-}Sheng Wang and
Chih{-}Yu Lin and
Yu{-}Chee Tseng},
title = {Augmenting Car Surrounding Information by Inter-Vehicle Data Fusion},
booktitle = {2019 {IEEE} Wireless Communications and Networking Conference, {WCNC}
2019, Marrakesh, Morocco, April 15-18, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/WCNC.2019.8885487},
doi = {10.1109/WCNC.2019.8885487},
timestamp = {Wed, 06 Nov 2019 12:28:18 +0100},
biburl = {https://dblp.org/rec/conf/wcnc/LeeKHWLT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-07904,
author = {Chia{-}Hsuan Lee and
Yun{-}Nung Chen and
Hung{-}yi Lee},
title = {Mitigating the Impact of Speech Recognition Errors on Spoken Question
Answering by Adversarial Domain Adaptation},
journal = {CoRR},
volume = {abs/1904.07904},
year = {2019},
url = {http://arxiv.org/abs/1904.07904},
eprinttype = {arXiv},
eprint = {1904.07904},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-07904.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-11027,
author = {Cheng{-}Shang Chang and
Ching{-}Chu Huang and
Chia{-}Tai Chang and
Duan{-}Shin Lee and
Ping{-}En Lu},
title = {Generalized Modularity Embedding: a General Framework for Network
Embedding},
journal = {CoRR},
volume = {abs/1904.11027},
year = {2019},
url = {http://arxiv.org/abs/1904.11027},
eprinttype = {arXiv},
eprint = {1904.11027},
timestamp = {Sat, 23 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-11027.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-12688,
author = {Yu{-}Hsiang Lin and
Chian{-}Yu Chen and
Jean Lee and
Zirui Li and
Yuyan Zhang and
Mengzhou Xia and
Shruti Rijhwani and
Junxian He and
Zhisong Zhang and
Xuezhe Ma and
Antonios Anastasopoulos and
Patrick Littell and
Graham Neubig},
title = {Choosing Transfer Languages for Cross-Lingual Learning},
journal = {CoRR},
volume = {abs/1905.12688},
year = {2019},
url = {http://arxiv.org/abs/1905.12688},
eprinttype = {arXiv},
eprint = {1905.12688},
timestamp = {Mon, 03 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-12688.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-09756,
author = {Sameer Kumar and
Victor Bitorff and
Dehao Chen and
Chiachen Chou and
Blake A. Hechtman and
HyoukJoong Lee and
Naveen Kumar and
Peter Mattson and
Shibo Wang and
Tao Wang and
Yuanzhong Xu and
Zongwei Zhou},
title = {Scale MLPerf-0.6 models on Google TPU-v3 Pods},
journal = {CoRR},
volume = {abs/1909.09756},
year = {2019},
url = {http://arxiv.org/abs/1909.09756},
eprinttype = {arXiv},
eprint = {1909.09756},
timestamp = {Fri, 27 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-09756.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-14275,
author = {Yi{-}Wei Huang and
Chen{-}Lung Lu and
Kuan{-}Lin Chen and
Po{-}Sheng Ser and
Jui{-}Te Huang and
Yu{-}Chia Shen and
Pin{-}Wei Chen and
Po{-}Kai Chang and
Sheng{-}Cheng Lee and
Hsueh{-}Cheng Wang},
title = {Duckiefloat: a Collision-Tolerant Resource-Constrained Blimp for Long-Term
Autonomy in Subterranean Environments},
journal = {CoRR},
volume = {abs/1910.14275},
year = {2019},
url = {http://arxiv.org/abs/1910.14275},
eprinttype = {arXiv},
eprint = {1910.14275},
timestamp = {Mon, 04 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-14275.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-01701,
author = {Dayeol Lee and
Dongha Jung and
Ian T. Fang and
Chia{-}Che Tsai and
Raluca Ada Popa},
title = {An Off-Chip Attack on Hardware Enclaves via the Memory Bus},
journal = {CoRR},
volume = {abs/1912.01701},
year = {2019},
url = {http://arxiv.org/abs/1912.01701},
eprinttype = {arXiv},
eprint = {1912.01701},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-01701.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HsiehLYWYCY18,
author = {Sun{-}Yuan Hsieh and
Chia{-}Wei Lee and
Zong{-}Ying Yang and
Heng{-}Wei Wang and
Jun{-}Han Yu and
Bo{-}Cheng Chan and
Tai{-}Ling Ye},
title = {Classifying Protein Specific Residue Structures Based on Graph Mining},
journal = {{IEEE} Access},
volume = {6},
pages = {55828--55837},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2872496},
doi = {10.1109/ACCESS.2018.2872496},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/HsiehLYWYCY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LeeFXY18,
author = {Chiou{-}Yng Lee and
Chia{-}Chen Fan and
Jiafeng Xie and
Shyan{-}Ming Yuan},
title = {Efficient Implementation of Karatsuba Algorithm Based Three-Operand
Multiplication Over Binary Extension Field},
journal = {{IEEE} Access},
volume = {6},
pages = {38234--38242},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2851662},
doi = {10.1109/ACCESS.2018.2851662},
timestamp = {Wed, 15 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LeeFXY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/PerngKCLSHLK18,
author = {Jau{-}Woei Perng and
I{-}Hsi Kao and
Yen{-}Wei Chen and
Yi{-}Horng Lai and
Chih{-}Min Su and
Shih{-}Chiang Hung and
Mel S. Lee and
Chia{-}Te Kung},
title = {Analysis of the 72-h Mortality of Emergency Room Septic Patients Based
on a Deep Belief Network},
journal = {{IEEE} Access},
volume = {6},
pages = {76820--76830},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2884509},
doi = {10.1109/ACCESS.2018.2884509},
timestamp = {Thu, 22 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/PerngKCLSHLK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/LeeC18,
author = {Chia{-}Yen Lee and
Bo{-}Syun Chen},
title = {Mutually-exclusive-and-collectively-exhaustive feature selection scheme},
journal = {Appl. Soft Comput.},
volume = {68},
pages = {961--971},
year = {2018},
url = {https://doi.org/10.1016/j.asoc.2017.04.055},
doi = {10.1016/J.ASOC.2017.04.055},
timestamp = {Wed, 20 Jun 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asc/LeeC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/TsengCPCLZKLHLC18,
author = {Kuan{-}Chieh Tseng and
Yi{-}Fan Chiang{-}Hsieh and
Hsuan Pai and
Chi{-}Nga Chow and
Shu{-}Chuan Lee and
Han{-}Qin Zheng and
Po{-}Li Kuo and
Guan{-}Zhen Li and
Yu{-}Cheng Hung and
Na{-}Sheng Lin and
Wen{-}Chi Chang},
title = {microRPM: a microRNA prediction model based only on plant small {RNA}
sequencing data},
journal = {Bioinform.},
volume = {34},
number = {7},
pages = {1108--1115},
year = {2018},
url = {https://doi.org/10.1093/bioinformatics/btx725},
doi = {10.1093/BIOINFORMATICS/BTX725},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/TsengCPCLZKLHLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcgenomics/ChouHHHHLCLHLCH18,
author = {Chih{-}Hung Chou and
Hsi{-}Yuan Huang and
Wei{-}Chih Huang and
Sheng{-}Da Hsu and
Chung{-}Der Hsiao and
Chia{-}Yu Liu and
Yu{-}Hung Chen and
Yu{-}Chen Liu and
Wei{-}Yun Huang and
Meng{-}Lin Lee and
Yi{-}Chang Chen and
Hsien{-}Da Huang},
title = {The aquatic animals' transcriptome resource for comparative functional
analysis},
journal = {{BMC} Genom.},
volume = {19},
number = {{S2}},
year = {2018},
url = {https://doi.org/10.1186/s12864-018-4463-x},
doi = {10.1186/S12864-018-4463-X},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcgenomics/ChouHHHHLCLHLCH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcgenomics/HuangLCHYYCT18,
author = {Po{-}Jung Huang and
Chi{-}Ching Lee and
Ling{-}Ya Chiu and
Kuo{-}Yang Huang and
Yuan{-}Ming Yeh and
Chia{-}Yu Yang and
Cheng{-}Hsun Chiu and
Petrus Tang},
title = {VAReporter: variant reporter for cancer research of massive parallel
sequencing},
journal = {{BMC} Genom.},
volume = {19},
number = {{S2}},
year = {2018},
url = {https://doi.org/10.1186/s12864-018-4468-5},
doi = {10.1186/S12864-018-4468-5},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcgenomics/HuangLCHYYCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cee/HsuHLLCH18,
author = {Fu{-}Hau Hsu and
Yanling Hwang and
Chia{-}Hao Lee and
Chieh{-}Ju Lin and
Kai{-}Wei Chang and
Chen{-}Chia Huang},
title = {A Cloud-based Protection approach against JavaScript-based attacks
to browsers},
journal = {Comput. Electr. Eng.},
volume = {68},
pages = {241--251},
year = {2018},
url = {https://doi.org/10.1016/j.compeleceng.2018.03.050},
doi = {10.1016/J.COMPELECENG.2018.03.050},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cee/HsuHLLCH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmam/ChenLL18,
author = {Tsu{-}Fen Chen and
Hyesuk Lee and
Chia{-}Chen Liu},
title = {A Study on the Galerkin Least-Squares Method for the Oldroyd-B Model},
journal = {Comput. Methods Appl. Math.},
volume = {18},
number = {2},
pages = {181--198},
year = {2018},
url = {https://doi.org/10.1515/cmam-2017-0022},
doi = {10.1515/CMAM-2017-0022},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmam/ChenLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejivp/LinLCYL18,
author = {Kao{-}Min Lin and
Jie{-}Ru Lin and
Mei{-}Juan Chen and
Chia{-}Hung Yeh and
Cheng{-}An Lee},
title = {Fast inter-prediction algorithm based on motion vector information
for high efficiency video coding},
journal = {{EURASIP} J. Image Video Process.},
volume = {2018},
pages = {99},
year = {2018},
url = {https://doi.org/10.1186/s13640-018-0340-4},
doi = {10.1186/S13640-018-0340-4},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejivp/LinLCYL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/LuCHCLWCFCMFLT18,
author = {Tsung{-}Chien Lu and
Yi Chen and
Te{-}Wei Ho and
Yao{-}Ting Chang and
Yi{-}Ting Lee and
Yu{-}Siang Wang and
Yen{-}Pin Chen and
Chia{-}Ming Fu and
Wen{-}Chu Chiang and
Matthew Huei{-}Ming Ma and
Cheng{-}Chung Fang and
Feipei Lai and
Anne M. Turner},
title = {A novel depth estimation algorithm of chest compression for feedback
of high-quality cardiopulmonary resuscitation based on a smartwatch},
journal = {J. Biomed. Informatics},
volume = {87},
pages = {60--65},
year = {2018},
url = {https://doi.org/10.1016/j.jbi.2018.09.014},
doi = {10.1016/J.JBI.2018.09.014},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/LuCHCLWCFCMFLT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/WangCLCCHCLL18,
author = {Hsin{-}Yao Wang and
Shih{-}Cheng Chang and
Wan{-}Ying Lin and
Chun{-}Hsien Chen and
Szu{-}Hsien Chiang and
Kai{-}Yao Huang and
Bo{-}Yu Chu and
Jang{-}Jih Lu and
Tzong{-}Yi Lee},
title = {Machine Learning-Based Method for Obesity Risk Evaluation Using Single-Nucleotide
Polymorphisms Derived from Next-Generation Sequencing},
journal = {J. Comput. Biol.},
volume = {25},
number = {12},
pages = {1347--1360},
year = {2018},
url = {https://doi.org/10.1089/cmb.2018.0002},
doi = {10.1089/CMB.2018.0002},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/WangCLCCHCLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcss/ChenCHHKLW18,
author = {Li{-}Hsuan Chen and
Dun{-}Wei Cheng and
Sun{-}Yuan Hsieh and
Ling{-}Ju Hung and
Ralf Klasing and
Chia{-}Wei Lee and
Bang Ye Wu},
title = {Approximability and inapproximability of the star p-hub center problem
with parameterized triangle inequality},
journal = {J. Comput. Syst. Sci.},
volume = {92},
pages = {92--112},
year = {2018},
url = {https://doi.org/10.1016/j.jcss.2017.09.012},
doi = {10.1016/J.JCSS.2017.09.012},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcss/ChenCHHKLW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/ChenL18,
author = {Yi{-}Chung Chen and
Chiang Lee},
title = {An Efficient Mechanism for Compensating Vague Pattern Identification
in Support of a Multi-Criteria Recommendation System},
journal = {J. Inf. Sci. Eng.},
volume = {34},
number = {6},
pages = {1633--1653},
year = {2018},
url = {https://jise.iis.sinica.edu.tw/JISESearch/pages/View/PaperView.jsf?keyId=165\_2203},
timestamp = {Fri, 17 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/ChenL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/LaiWCLLCW18,
author = {Bo{-}Cheng Lai and
Tung{-}Yu Wu and
Tsou{-}Han Chiu and
Kun{-}Chun Li and
Chia{-}Ying Lee and
Wei{-}Chen Chien and
Wing Hung Wong},
title = {Towards high performance data analytic on heterogeneous many-core
systems: {A} study on Bayesian Sequential Partitioning},
journal = {J. Parallel Distributed Comput.},
volume = {122},
pages = {36--50},
year = {2018},
url = {https://doi.org/10.1016/j.jpdc.2018.07.011},
doi = {10.1016/J.JPDC.2018.07.011},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/LaiWCLLCW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvcir/YehTKLMC18,
author = {Chia{-}Hung Yeh and
Wen{-}Yu Tseng and
Li{-}Wei Kang and
Cheng{-}Wei Lee and
Kahlil Muchtar and
Mei{-}Juan Chen},
title = {Coding unit complexity-based predictions of coding unit depth and
prediction unit mode for efficient HEVC-to-SHVC transcoding with quality
scalability},
journal = {J. Vis. Commun. Image Represent.},
volume = {55},
pages = {342--351},
year = {2018},
url = {https://doi.org/10.1016/j.jvcir.2018.06.008},
doi = {10.1016/J.JVCIR.2018.06.008},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jvcir/YehTKLMC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lht/ChenLH18,
author = {Chia{-}Chen Chen and
Chun{-}Hsiung Lee and
Kuo{-}Lun Hsiao},
title = {Comparing the determinants of non-MOOC and {MOOC} continuance intention
in Taiwan: Effects of interactivity and openness},
journal = {Libr. Hi Tech},
volume = {36},
number = {4},
pages = {705--719},
year = {2018},
url = {https://doi.org/10.1108/LHT-11-2016-0129},
doi = {10.1108/LHT-11-2016-0129},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lht/ChenLH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/ChenHLWC18,
author = {Kuan{-}Ting Chen and
Ren{-}Yu He and
Chia{-}Feng Lee and
Ming{-}Ting Wu and
Shu{-}Tong Chang},
title = {Compact conduction band model for transition-metal dichalcogenide
alloys},
journal = {Microelectron. Reliab.},
volume = {83},
pages = {223--229},
year = {2018},
url = {https://doi.org/10.1016/j.microrel.2017.04.022},
doi = {10.1016/J.MICROREL.2017.04.022},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/ChenHLWC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ChouSYCLLHSTLCT18,
author = {Chih{-}Hung Chou and
Sirjana Shrestha and
Chi{-}Dung Yang and
Nai{-}Wen Chang and
Yu{-}Ling Lin and
Kuang{-}Wen Liao and
Wei{-}Chih Huang and
Ting{-}Hsuan Sun and
Siang{-}Jyun Tu and
Wei{-}Hsiang Lee and
Men{-}Yee Chiew and
Chun{-}San Tai and
Ting{-}Yen Wei and
Tzi{-}Ren Tsai and
Hsin{-}Tzu Huang and
Chung{-}Yu Wang and
Hsin{-}Yi Wu and
Shu{-}Yi Ho and
Pin{-}Rong Chen and
Cheng{-}Hsun Chuang and
Pei{-}Jung Hsieh and
Yi{-}Shin Wu and
Wen{-}Liang Chen and
Meng{-}Ju Li and
Yu{-}chun Wu and
Xin{-}Yi Huang and
Fung Ling Ng and
Waradee Buddhakosai and
Pei{-}Chun Huang and
Kuan{-}Chun Lan and
Chia{-}Yen Huang and
Shun{-}Long Weng and
Yeong{-}Nan Cheng and
Chao Liang and
Wen{-}Lian Hsu and
Hsien{-}Da Huang},
title = {miRTarBase update 2018: a resource for experimentally validated microRNA-target
interactions},
journal = {Nucleic Acids Res.},
volume = {46},
number = {Database-Issue},
pages = {D296--D302},
year = {2018},
url = {https://doi.org/10.1093/nar/gkx1067},
doi = {10.1093/NAR/GKX1067},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/ChouSYCLLHSTLCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChiehWLCLLCCHY18,
author = {Jen{-}Jie Chieh and
Wen{-}Chun Wei and
Shu{-}Hsien Liao and
Hsin{-}Hsein Chen and
Yen{-}Fu Lee and
Feng{-}Chun Lin and
Ming{-}Hsien Chiang and
Ming{-}Jang Chiu and
Herng{-}Er Horng and
Shieh{-}Yueh Yang},
title = {Eight-Channel {AC} Magnetosusceptometer of Magnetic Nanoparticles
for High-Throughput and Ultra-High-Sensitivity Immunoassay},
journal = {Sensors},
volume = {18},
number = {4},
pages = {1043},
year = {2018},
url = {https://doi.org/10.3390/s18041043},
doi = {10.3390/S18041043},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ChiehWLCLLCCHY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeCCYY18,
author = {Chi{-}Yuan Lee and
Chia{-}Hung Chen and
Chao{-}Yuan Chiu and
Kuan{-}Lin Yu and
Lung{-}Jieh Yang},
title = {Application of Flexible Four-In-One Microsensor to Internal Real-Time
Monitoring of Proton Exchange Membrane Fuel Cell},
journal = {Sensors},
volume = {18},
number = {7},
pages = {2269},
year = {2018},
url = {https://doi.org/10.3390/s18072269},
doi = {10.3390/S18072269},
timestamp = {Mon, 29 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LeeCCYY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeCTW18,
author = {Chi{-}Yuan Lee and
Chia{-}Hung Chen and
Chao{-}Hsuan Tsai and
Yu{-}Syuan Wang},
title = {Development of an Internal Real-Time Wireless Diagnostic Tool for
a Proton Exchange Membrane Fuel Cell},
journal = {Sensors},
volume = {18},
number = {1},
pages = {213},
year = {2018},
url = {https://doi.org/10.3390/s18010213},
doi = {10.3390/S18010213},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/LeeCTW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LeeLCHW18,
author = {Chi{-}Yuan Lee and
Shih{-}Chun Li and
Chia{-}Hung Chen and
Yen{-}Ting Huang and
Yu{-}Syuan Wang},
title = {Real-Time Microscopic Monitoring of Flow, Voltage and Current in the
Proton Exchange Membrane Water Electrolyzer},
journal = {Sensors},
volume = {18},
number = {3},
pages = {867},
year = {2018},
url = {https://doi.org/10.3390/s18030867},
doi = {10.3390/S18030867},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/LeeLCHW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LinLYLLC18,
author = {Bor{-}Shing Lin and
I{-}Jung Lee and
Shu{-}Yu Yang and
Yi{-}Chiang Lo and
Junghsi Lee and
Jean{-}Lon Chen},
title = {Design of an Inertial-Sensor-Based Data Glove for Hand Function Evaluation},
journal = {Sensors},
volume = {18},
number = {5},
pages = {1545},
year = {2018},
url = {https://doi.org/10.3390/s18051545},
doi = {10.3390/S18051545},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LinLYLLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/LinTLYLHCKLC18,
author = {Chien{-}Hsueh Lin and
Chih{-}Ying Tsai and
Kao{-}Chi Lee and
Sung{-}Chu Yu and
Wen{-}Rong Liau and
Alex Chun{-}Liang Hou and
Ying{-}Yen Chen and
Chun{-}Yi Kuo and
Jih{-}Nung Lee and
Mango C.{-}T. Chao},
title = {A Model-Based-Random-Forest Framework for Predicting V\({}_{\mbox{t}}\)
Mean and Variance Based on Parallel I\({}_{\mbox{d}}\) Measurement},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {37},
number = {10},
pages = {2139--2151},
year = {2018},
url = {https://doi.org/10.1109/TCAD.2017.2783304},
doi = {10.1109/TCAD.2017.2783304},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/LinTLYLHCKLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/LinLLCL18,
author = {Chih{-}Lung Lin and
Po{-}Chun Lai and
Po{-}Cheng Lai and
Ting{-}Ching Chu and
Chia{-}Lun Lee},
title = {Bidirectional Gate Driver Circuit Using Recharging and Time-Division
Driving Scheme for In-Cell Touch LCDs},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {4},
pages = {3585--3591},
year = {2018},
url = {https://doi.org/10.1109/TIE.2017.2756583},
doi = {10.1109/TIE.2017.2756583},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/LinLLCL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/ChangLS18,
author = {Cheng{-}Shang Chang and
Duan{-}Shin Lee and
Chia{-}Kai Su},
title = {Greenput: {A} Power-Saving Algorithm That Achieves Maximum Throughput
in Wireless Networks},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {26},
number = {2},
pages = {906--919},
year = {2018},
url = {http://doi.ieeecomputersociety.org/10.1109/TNET.2018.2808920},
doi = {10.1109/TNET.2018.2808920},
timestamp = {Sun, 06 May 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ton/ChangLS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tr/LinHCXL18,
author = {Limei Lin and
Sun{-}Yuan Hsieh and
Riqing Chen and
Li Xu and
Chia{-}Wei Lee},
title = {The Relationship Between g-Restricted Connectivity and g-Good-Neighbor
Fault Diagnosability of General Regular Networks},
journal = {{IEEE} Trans. Reliab.},
volume = {67},
number = {1},
pages = {285--296},
year = {2018},
url = {https://doi.org/10.1109/TR.2017.2760905},
doi = {10.1109/TR.2017.2760905},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tr/LinHCXL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsg/JiangWZCLSH18,
author = {Joe{-}Air Jiang and
Jie{-}Jyun Wan and
Xiang{-}Yao Zheng and
Chia{-}Pang Chen and
Chien{-}Hsing Lee and
Lin{-}Kuei Su and
Wen{-}Chi Huang},
title = {A Novel Weather Information-Based Optimization Algorithm for Thermal
Sensor Placement in Smart Grid},
journal = {{IEEE} Trans. Smart Grid},
volume = {9},
number = {2},
pages = {911--922},
year = {2018},
url = {https://doi.org/10.1109/TSG.2016.2571220},
doi = {10.1109/TSG.2016.2571220},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsg/JiangWZCLSH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/www/ChenTL18,
author = {Yi{-}Chung Chen and
Ming{-}Yeh Tsai and
Chiang Lee},
title = {Recommending topics in dialogue},
journal = {World Wide Web},
volume = {21},
number = {5},
pages = {1165--1185},
year = {2018},
url = {https://doi.org/10.1007/s11280-017-0499-0},
doi = {10.1007/S11280-017-0499-0},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/www/ChenTL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/accv/ChenCL18,
author = {Wei{-}Chun Chen and
Chia{-}Che Chang and
Che{-}Rung Lee},
editor = {C. V. Jawahar and
Hongdong Li and
Greg Mori and
Konrad Schindler},
title = {Knowledge Distillation with Feature Maps for Image Classification},
booktitle = {Computer Vision - {ACCV} 2018 - 14th Asian Conference on Computer
Vision, Perth, Australia, December 2-6, 2018, Revised Selected Papers,
Part {III}},
series = {Lecture Notes in Computer Science},
volume = {11363},
pages = {200--215},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-20893-6\_13},
doi = {10.1007/978-3-030-20893-6\_13},
timestamp = {Wed, 29 May 2019 12:05:18 +0200},
biburl = {https://dblp.org/rec/conf/accv/ChenCL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/OuYLHTLCL18,
author = {I{-}Che Ou and
Jia{-}Ping Yang and
Chia{-}Hung Liu and
Kai{-}Jie Huang and
Kun{-}Ju Tsai and
Yu Lee and
Yuan{-}Hua Chu and
Yu{-}Te Liao},
title = {A Wide-Range Capacitive {DC-DC} Converter with 2D-MPPT for Soil/Solar
Energy Extraction},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2018, Tainan,
Taiwan, November 5-7, 2018},
pages = {37--38},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ASSCC.2018.8579339},
doi = {10.1109/ASSCC.2018.8579339},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/OuYLHTLCL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/LeeCLCCWC18,
author = {Chien{-}Chih Lee and
Wen{-}Hsin Chang and
Ting{-}Yuan Liu and
Yu{-}Chia Chen and
Guan{-}Yu Chen and
Yang{-}Chang Wu and
Jan{-}Gowth Chang},
title = {The Amiloride Derivatives Regulate the Alternative Splicing of Apoptotic
Gene Transcripts},
booktitle = {18th {IEEE} International Conference on Bioinformatics and Bioengineering,
{BIBE} 2018, Taichung, Taiwan, October 29-31, 2018},
pages = {319--322},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BIBE.2018.00069},
doi = {10.1109/BIBE.2018.00069},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/bibe/LeeCLCCWC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LeeZLCH18,
author = {Cheng{-}Han Lee and
Kaipeng Zhang and
Hu{-}Cheng Lee and
Chia{-}Wen Cheng and
Winston H. Hsu},
title = {Attribute Augmented Convolutional Neural Network for Face Hallucination},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2018, Salt Lake City, UT, USA, June 18-22,
2018},
pages = {721--729},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018\_workshops/w13/html/Lee\_Attribute\_Augmented\_Convolutional\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPRW.2018.00115},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/LeeZLCH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/LeeWLCW18,
author = {Tung{-}Yuan Lee and
Chia{-}Cheng Wu and
Chia{-}Chun Lin and
Yung{-}Chih Chen and
Chun{-}Yao Wang},
editor = {Jan Madsen and
Ayse K. Coskun},
title = {Logic optimization with considering boolean relations},
booktitle = {2018 Design, Automation {\&} Test in Europe Conference {\&}
Exhibition, {DATE} 2018, Dresden, Germany, March 19-23, 2018},
pages = {761--766},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.23919/DATE.2018.8342109},
doi = {10.23919/DATE.2018.8342109},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/date/LeeWLCW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/ChangLLJWC18,
author = {Chia{-}Che Chang and
Chieh Hubert Lin and
Che{-}Rung Lee and
Da{-}Cheng Juan and
Wei Wei and
Hwann{-}Tzong Chen},
editor = {Vittorio Ferrari and
Martial Hebert and
Cristian Sminchisescu and
Yair Weiss},
title = {Escaping from Collapsing Modes in a Constrained Space},
booktitle = {Computer Vision - {ECCV} 2018 - 15th European Conference, Munich,
Germany, September 8-14, 2018, Proceedings, Part {VII}},
series = {Lecture Notes in Computer Science},
volume = {11211},
pages = {212--227},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-01234-2\_13},
doi = {10.1007/978-3-030-01234-2\_13},
timestamp = {Tue, 30 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eccv/ChangLLJWC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcce/SuCHWKCHL18,
author = {Jian{-}Ping Su and
Liang{-}Bi Chen and
Chia{-}Hao Hsu and
Wei{-}Chien Wang and
Cheng{-}Chin Kuo and
Wan{-}Jung Chang and
Wei{-}Wen Hu and
Da{-}Huei Lee},
title = {An Intelligent Scalp Inspection and Diagnosis System for Caring Hairy
Scalp Health},
booktitle = {{IEEE} 7th Global Conference on Consumer Electronics, {GCCE} 2018,
Nara, Japan, October 9-12, 2018},
pages = {507--508},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/GCCE.2018.8574619},
doi = {10.1109/GCCE.2018.8574619},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/gcce/SuCHWKCHL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/glvlsi/WuLLWJCWLWC18,
author = {Chia{-}Cheng Wu and
Tung{-}Yuan Lee and
Yung{-}An Lai and
Hsin{-}Pei Wang and
De{-}Xuan Ji and
Yan{-}Ping Chang and
Teng{-}Chia Wang and
Chin{-}Heng Liu and
Chun{-}Yao Wang and
Yung{-}Chih Chen},
editor = {Deming Chen and
Houman Homayoun and
Baris Taskin},
title = {A Hybrid Approach to Equivalent Fault Identification for Verification
Environment Qualification},
booktitle = {Proceedings of the 2018 on Great Lakes Symposium on VLSI, {GLSVLSI}
2018, Chicago, IL, USA, May 23-25, 2018},
pages = {447--450},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3194554.3194635},
doi = {10.1145/3194554.3194635},
timestamp = {Wed, 10 Mar 2021 14:55:38 +0100},
biburl = {https://dblp.org/rec/conf/glvlsi/WuLLWJCWLWC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/ChenYHLHS18,
author = {Oscal Tzyh{-}Chiang Chen and
Sung{-}Nien Yu and
Ching{-}Chun Huang and
Huang{-}Chen Lee and
Yu{-}Ling Hsueh and
Jerry Chih{-}Yuan Sun},
title = {Mobile Learning System with Context-Aware Interactions and Point-of-Interest
Understanding},
booktitle = {2018 {IEEE} International Conference on Multimedia {\&} Expo Workshops,
{ICME} Workshops 2018, San Diego, CA, USA, July 23-27, 2018},
pages = {1--4},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICMEW.2018.8551571},
doi = {10.1109/ICMEW.2018.8551571},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmcs/ChenYHLHS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/LinTTLF18,
author = {Bing{-}Jhang Lin and
Ting{-}Chen Tsan and
Tzu{-}Chia Tung and
You{-}Hsien Lee and
Chiou{-}Shann Fuh},
editor = {Long Cheng and
Andrew Chi{-}Sing Leung and
Seiichi Ozawa},
title = {Use 3D Convolutional Neural Network to Inspect Solder Ball Defects},
booktitle = {Neural Information Processing - 25th International Conference, {ICONIP}
2018, Siem Reap, Cambodia, December 13-16, 2018, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {11301},
pages = {263--274},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-04167-0\_24},
doi = {10.1007/978-3-030-04167-0\_24},
timestamp = {Tue, 14 May 2019 10:00:42 +0200},
biburl = {https://dblp.org/rec/conf/iconip/LinTTLF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/ChangCHHHLLSSTT18,
author = {Andy R. K. Chang and
Yu{-}Ling Chen and
Yen{-}Zhou Huang and
Hung{-}Chang Hsiao and
Michael Hsu and
Chia{-}Chee Lee and
Hsin{-}Yin Lee and
Wei{-}An Shih and
Huan{-}Ping Su and
Chia{-}Ping Tsai and
Kuan{-}Po Tseng},
title = {The Case of a Novel Operational Distributed Storage Service for Big
Data in a Semiconductor Wafer Fabrication Foundry},
booktitle = {24th {IEEE} International Conference on Parallel and Distributed Systems,
{ICPADS} 2018, Singapore, December 11-13, 2018},
pages = {1028--1033},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/PADSW.2018.8644546},
doi = {10.1109/PADSW.2018.8644546},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/icpads/ChangCHHHLLSSTT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsm2/ChiuHLCCF18,
author = {Lee{-}Wen Chiu and
Jun{-}Wei Hsieh and
Chin{-}Rong Lai and
Hui{-}Fen Chiang and
Shyi{-}Chyi Cheng and
Kuo{-}Chin Fan},
editor = {Anup Basu and
Stefano Berretti},
title = {Person Authentication by Air-Writing Using 3D Sensor and Time Order
Stroke Context},
booktitle = {Smart Multimedia - First International Conference, {ICSM} 2018, Toulon,
France, August 24-26, 2018, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {11010},
pages = {260--273},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-04375-9\_22},
doi = {10.1007/978-3-030-04375-9\_22},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/icsm2/ChiuHLCCF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictc/ChangCCHHHHLLSS18,
author = {Andy R. K. Chang and
Yu{-}Ling Chen and
Po{-}Yu Chou and
Yen{-}Zhou Huang and
Hung{-}Chang Hsiao and
Tsung{-}Ting Hsieh and
Michael Hsu and
Chia{-}Chee Lee and
Hsin{-}Yin Lee and
Yun{-}Chi Shih and
Wei{-}An Shih and
Chien{-}Hsiang Tang and
Chia{-}Ping Tsai and
Kuan{-}Po Tseng},
title = {The Case of Big Data Platform Services for Semiconductor Wafer Fabrication
Foundries},
booktitle = {International Conference on Information and Communication Technology
Convergence, {ICTC} 2018, Jeju Island, Korea (South), October 17-19,
2018},
pages = {41--45},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICTC.2018.8539541},
doi = {10.1109/ICTC.2018.8539541},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ictc/ChangCCHHHHLLSS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictc/ChouTXCLYTS18,
author = {Li{-}Der Chou and
Chia{-}Wei Tseng and
Shun{-}Yu Xie and
Pin{-}Hao Chen and
Yu{-}zhe Lee and
Chia{-}Kuan Yen and
Wei{-}Hsiang Tsai and
Sen Su},
title = {Design of {SFC} Management System based on {SDN} and {NFV}},
booktitle = {International Conference on Information and Communication Technology
Convergence, {ICTC} 2018, Jeju Island, Korea (South), October 17-19,
2018},
pages = {391--395},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICTC.2018.8539693},
doi = {10.1109/ICTC.2018.8539693},
timestamp = {Thu, 22 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ictc/ChouTXCLYTS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/islped/SrinivasanFSZSO18,
author = {Vijayalakshmi Srinivasan and
Bruce M. Fleischer and
Sunil Shukla and
Matthew M. Ziegler and
Joel Silberman and
Jinwook Oh and
Jungwook Choi and
Silvia M. Mueller and
Ankur Agrawal and
Tina Babinsky and
Nianzheng Cao and
Chia{-}Yu Chen and
Pierce Chuang and
Thomas W. Fox and
George Gristede and
Michael Guillorn and
Howard Haynie and
Michael J. Klaiber and
Dongsoo Lee and
Shih{-}Hsien Lo and
Gary W. Maier and
Michael Scheuermann and
Swagath Venkataramani and
Christos Vezyrtzis and
Naigang Wang and
Fanchieh Yee and
Ching Zhou and
Pong{-}Fei Lu and
Brian W. Curran and
Leland Chang and
Kailash Gopalakrishnan},
title = {Across the Stack Opportunities for Deep Learning Acceleration},
booktitle = {Proceedings of the International Symposium on Low Power Electronics
and Design, {ISLPED} 2018, Seattle, WA, USA, July 23-25, 2018},
pages = {35:1--35:2},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3218603.3241339},
doi = {10.1145/3218603.3241339},
timestamp = {Tue, 22 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/islped/SrinivasanFSZSO18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/TsaiLC18,
author = {Phil Chia{-}Yang Tsai and
Kelvin Kuang{-}Chi Lee and
Chiao{-}En Chen},
title = {An Eigen-based Matrix Inverse Approximation Scheme with Stair Matrix
Splitting for Massive {MIMO} Systems},
booktitle = {2018 International Symposium on Intelligent Signal Processing and
Communication Systems (ISPACS), Ishigaki, Okinawa, Japan, November
27-30, 2018},
pages = {378--381},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISPACS.2018.8923264},
doi = {10.1109/ISPACS.2018.8923264},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispacs/TsaiLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispan/YangLLCLK18,
author = {Chao{-}Tung Yang and
Jung{-}Chun Liu and
Jheng{-}Yue Lee and
Chih{-}Hung Chang and
Chuan{-}Lin Lai and
Chia{-}Chen Kuo},
title = {The Implementation of a Virtual Desktop Infrastructure with {GPU}
Accelerated on OpenStack},
booktitle = {15th International Symposium on Pervasive Systems, Algorithms and
Networks, {I-SPAN} 2018, Yichang, China, October 16-18, 2018},
pages = {366--370},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/I-SPAN.2018.00069},
doi = {10.1109/I-SPAN.2018.00069},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispan/YangLLCLK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/ChenCCLC18,
author = {Jheng{-}Yi Chen and
Ming{-}Yu Chang and
Shi{-}Hao Chen and
Jia{-}Wei Lee and
Meng{-}Hsueh Chiang},
title = {Body-biasing assisted vmin optimization for 5nm-node multi-Vt {FD-SOI}
6T-SRAM},
booktitle = {19th International Symposium on Quality Electronic Design, {ISQED}
2018, Santa Clara, CA, USA, March 13-14, 2018},
pages = {151--155},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISQED.2018.8357280},
doi = {10.1109/ISQED.2018.8357280},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isqed/ChenCCLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithings/LeeLC18,
author = {Chia{-}Peng Lee and
Phone Lin and
Hsuan{-}Yeh Chen},
title = {A Protocol to Protocol Switching Mechanism for Energy Saving of Power-Constrained
in {LTE} and NB-IoT Interworking Networks},
booktitle = {{IEEE} International Conference on Internet of Things (iThings) and
{IEEE} Green Computing and Communications (GreenCom) and {IEEE} Cyber,
Physical and Social Computing (CPSCom) and {IEEE} Smart Data (SmartData),
iThings/GreenCom/CPSCom/SmartData 2018, Halifax, NS, Canada, July
30 - August 3, 2018},
pages = {483--489},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/Cybermatics\_2018.2018.00105},
doi = {10.1109/CYBERMATICS\_2018.2018.00105},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/ithings/LeeLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lwmoocs/HuangCTFL18,
author = {Nen{-}Fu Huang and
Chia{-}Chi Chen and
Jian{-}Wei Tzeng and
Tung{-}Te Fang and
Chia{-}An Lee},
title = {Concept Assessment System Integrated with a Knowledge Map Using Deep
Learning},
booktitle = {Learning With MOOCS, {LWMOOCS} 2018, Madrid, Spain, September 26-28,
2018},
pages = {113--116},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/LWMOOCS.2018.8534674},
doi = {10.1109/LWMOOCS.2018.8534674},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/lwmoocs/HuangCTFL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lwmoocs/HuangHLCTF18,
author = {Nen{-}Fu Huang and
I{-}Hsien Hsu and
Chia{-}An Lee and
Hsiang{-}Chun Chen and
Jian{-}Wei Tzeng and
Tung{-}Te Fang},
title = {The Clustering Analysis System Based on Students' Motivation and Learning
Behavior},
booktitle = {Learning With MOOCS, {LWMOOCS} 2018, Madrid, Spain, September 26-28,
2018},
pages = {117--119},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/LWMOOCS.2018.8534611},
doi = {10.1109/LWMOOCS.2018.8534611},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lwmoocs/HuangHLCTF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/LeeTJHLH18,
author = {Chia{-}Tung Lee and
Hsueh{-}Yang Tseng and
Yi{-}Ting Jiang and
Cheng{-}Yeh Huang and
Meng{-}Shiue Lee and
Wensyang Hsu},
title = {Detection of Multiple Embryo Growth Factors by Bead-Based Digital
Microfluidic Chip in Embryo Culture Medium},
booktitle = {13th {IEEE} Annual International Conference on Nano/Micro Engineered
and Molecular Systems, {NEMS} 2018, Singapore, Singapore, April 22-26,
2018},
pages = {119--122},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/NEMS.2018.8556863},
doi = {10.1109/NEMS.2018.8556863},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/nems/LeeTJHLH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/racs/WangLTLH18,
author = {Pei{-}Jen Wang and
Cheng{-}Yueh Liu and
Chia{-}Heng Tu and
Chen{-}Pang Lee and
Shih{-}Hao Hung},
editor = {Chih{-}Cheng Hung and
Lamjed Ben Said},
title = {Acceleration of Monte-Carlo simulation on high performance computing
platforms},
booktitle = {Proceedings of the 2018 Conference on Research in Adaptive and Convergent
Systems, {RACS} 2018, Honolulu, HI, USA, October 09-12, 2018},
pages = {225--230},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3264746.3264765},
doi = {10.1145/3264746.3264765},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/racs/WangLTLH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rocling/ChenOLL18,
author = {Li{-}Mei Chen and
D. Kimbrough Oller and
Chia{-}Cheng Lee and
Chin{-}Ting Jimbo Liu},
editor = {Chi{-}Chun Jeremy Lee and
Cheng{-}Zen Yang and
Jen{-}Tzung Chien},
title = {{LENA} computerized automatic analysis of speech development from
birth to three},
booktitle = {Proceedings of the 30th Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2018, Hsinchu, Taiwan, October 4-5, 2018},
pages = {158--168},
publisher = {The Association for Computational Linguistics and Chinese Language
Processing {(ACLCLP)}},
year = {2018},
url = {https://aclanthology.org/O18-1017/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rocling/ChenOLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggrapha/ChangCCCYLC18,
author = {Shih{-}Hsiu Chang and
Ching{-}Ya Chiu and
Chia{-}Sheng Chang and
Kuo{-}Wei Chen and
Chih{-}Yuan Yao and
Ruen{-}Rone Lee and
Hung{-}Kuo Chu},
editor = {Nafees Bin Zafar and
Kun Zhou},
title = {Generating 360 outdoor panorama dataset with reliable sun position
estimation},
booktitle = {{SIGGRAPH} Asia 2018 Posters, Tokyo, Japan, December 04-07, 2018},
pages = {22:1--22:2},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3283289.3283348},
doi = {10.1145/3283289.3283348},
timestamp = {Sun, 02 Dec 2018 12:01:29 +0100},
biburl = {https://dblp.org/rec/conf/siggrapha/ChangCCCYLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggrapha/MoraceWYCYL18,
author = {Charles C. Morace and
Feng{-}Wei Wu and
Chih{-}Kuo Yeh and
Chia{-}Hsiang Chen and
I{-}Cheng Yeh and
Tong{-}Yee Lee},
editor = {Nafees Bin Zafar and
Kun Zhou},
title = {Hair modeling from a single anime-style image},
booktitle = {{SIGGRAPH} Asia 2018 Posters, Tokyo, Japan, December 04-07, 2018},
pages = {31:1--31:2},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3283289.3283347},
doi = {10.1145/3283289.3283347},
timestamp = {Fri, 17 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggrapha/MoraceWYCYL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slt/ChenHSLL18,
author = {Yi{-}Chen Chen and
Sung{-}Feng Huang and
Chia{-}Hao Shen and
Hung{-}yi Lee and
Lin{-}Shan Lee},
title = {Phonetic-and-Semantic Embedding of Spoken words with Applications
in Spoken Content Retrieval},
booktitle = {2018 {IEEE} Spoken Language Technology Workshop, {SLT} 2018, Athens,
Greece, December 18-21, 2018},
pages = {941--948},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/SLT.2018.8639553},
doi = {10.1109/SLT.2018.8639553},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/slt/ChenHSLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slt/LeeWCL18,
author = {Chia{-}Hsuan Lee and
Shang{-}Ming Wang and
Huan{-}Cheng Chang and
Hung{-}yi Lee},
title = {{ODSQA:} Open-Domain Spoken Question Answering Dataset},
booktitle = {2018 {IEEE} Spoken Language Technology Workshop, {SLT} 2018, Athens,
Greece, December 18-21, 2018},
pages = {949--956},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/SLT.2018.8639505},
doi = {10.1109/SLT.2018.8639505},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/slt/LeeWCL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/LeeYWLC18,
author = {Kuan{-}Ru Lee and
Yi{-}Xian Yeh and
Chao{-}Cheng Wu and
Jiannher Lin and
Yung{-}Hsiao Chiang},
title = {Unsupervised Classification of Cerebrospinal Fluid by Statistical
Indicators},
booktitle = {{IEEE} International Conference on Systems, Man, and Cybernetics,
{SMC} 2018, Miyazaki, Japan, October 7-10, 2018},
pages = {3827--3832},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/SMC.2018.00648},
doi = {10.1109/SMC.2018.00648},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/smc/LeeYWLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tencon/TsanLLTF18,
author = {Ting{-}Chen Tsan and
Bing{-}Jhang Lin and
You{-}Hsien Lee and
Tzu{-}Chia Tung and
Chiou{-}Shann Fuh},
title = {Solder Ball 3D Reconstruction with X-Ray Images Using Filtered Back
Projection},
booktitle = {{TENCON} 2018 - 2018 {IEEE} Region 10 Conference, Jeju, South Korea,
October 28-31, 2018},
pages = {2510--2515},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/TENCON.2018.8650405},
doi = {10.1109/TENCON.2018.8650405},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/tencon/TsanLLTF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/KuWLCWL18,
author = {Fang{-}Ju Ku and
Tung{-}Yu Wu and
Yen{-}Chin Liao and
Hsie{-}Chia Chang and
Wing Hung Wong and
Chen{-}Yi Lee},
title = {A 1.86mJ/Gb/query bit-plane payload machine learning processor in
90nm {CMOS}},
booktitle = {2018 International Symposium on {VLSI} Design, Automation and Test
(VLSI-DAT), Hsinchu, Taiwan, April 16-19, 2018},
pages = {1--4},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/VLSI-DAT.2018.8373265},
doi = {10.1109/VLSI-DAT.2018.8373265},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/KuWLCWL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/FleischerSZSOSC18,
author = {Bruce M. Fleischer and
Sunil Shukla and
Matthew M. Ziegler and
Joel Silberman and
Jinwook Oh and
Vijayalakshmi Srinivasan and
Jungwook Choi and
Silvia M. Mueller and
Ankur Agrawal and
Tina Babinsky and
Nianzheng Cao and
Chia{-}Yu Chen and
Pierce Chuang and
Thomas W. Fox and
George Gristede and
Michael Guillorn and
Howard Haynie and
Michael J. Klaiber and
Dongsoo Lee and
Shih{-}Hsien Lo and
Gary W. Maier and
Michael Scheuermann and
Swagath Venkataramani and
Christos Vezyrtzis and
Naigang Wang and
Fanchieh Yee and
Ching Zhou and
Pong{-}Fei Lu and
Brian W. Curran and
Leland Chang and
Kailash Gopalakrishnan},
title = {A Scalable Multi- TeraOPS Deep Learning Processor Core for {AI} Trainina
and Inference},
booktitle = {2018 {IEEE} Symposium on {VLSI} Circuits, Honolulu, HI, USA, June
18-22, 2018},
pages = {35--36},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/VLSIC.2018.8502276},
doi = {10.1109/VLSIC.2018.8502276},
timestamp = {Tue, 22 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsic/FleischerSZSOSC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/ShihLCLLCLYYCCC18,
author = {Yi{-}Chun Shih and
Chia{-}Fu Lee and
Yen{-}An Chang and
Po{-}Hao Lee and
Hon{-}Jarn Lin and
Yu{-}Lin Chen and
Ku{-}Feng Lin and
Ta{-}Ching Yeh and
Hung{-}Chang Yu and
Harry Chuang and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang},
title = {Logic Process Compatible 40NM 16MB, Embedded Perpendicular-MRAM with
Hybrid-Resistance Reference, Sub-{\(\mu\)}A Sensing Resolution, and
17.5NS Read Access Time},
booktitle = {2018 {IEEE} Symposium on {VLSI} Circuits, Honolulu, HI, USA, June
18-22, 2018},
pages = {79--80},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/VLSIC.2018.8502260},
doi = {10.1109/VLSIC.2018.8502260},
timestamp = {Wed, 07 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/ShihLCLLCLYYCCC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vrst/ChengCCLHHKL18,
author = {Chih{-}Hao Cheng and
Chia{-}Chi Chang and
Ying{-}Hsuan Chen and
Ying{-}Li Lin and
Jing{-}Yuan Huang and
Ping{-}Hsuan Han and
Ju{-}Chun Ko and
Lai{-}Chung Lee},
editor = {Stephen N. Spencer and
Shigeo Morishima and
Yuichi Itoh and
Takaaki Shiratori and
Yonghao Yue and
Rob Lindeman},
title = {GravityCup: a liquid-based haptics for simulating dynamic weight in
virtual reality},
booktitle = {Proceedings of the 24th {ACM} Symposium on Virtual Reality Software
and Technology, {VRST} 2018, Tokyo, Japan, November 28 - December
01, 2018},
pages = {51:1--51:2},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3281505.3281569},
doi = {10.1145/3281505.3281569},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vrst/ChengCCLHHKL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vrst/HanCLWHHCH18,
author = {Ping{-}Hsuan Han and
Yang{-}Sheng Chen and
Kong{-}Chang Lee and
Hao{-}Cheng Wang and
Chiao{-}En Hsieh and
Jui{-}Chun Hsiao and
Chien{-}Hsing Chou and
Yi{-}Ping Hung},
editor = {Stephen N. Spencer and
Shigeo Morishima and
Yuichi Itoh and
Takaaki Shiratori and
Yonghao Yue and
Rob Lindeman},
title = {Haptic around: multiple tactile sensations for immersive environment
and interaction in virtual reality},
booktitle = {Proceedings of the 24th {ACM} Symposium on Virtual Reality Software
and Technology, {VRST} 2018, Tokyo, Japan, November 28 - December
01, 2018},
pages = {35:1--35:10},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3281505.3281507},
doi = {10.1145/3281505.3281507},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vrst/HanCLWHHCH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/LoCLCT18,
author = {Chi{-}Chung Lo and
Ting{-}Hui Chiang and
Tsu{-}Kuang Lee and
Ling{-}Jyh Chen and
Yu{-}Chee Tseng},
title = {Wireless location tracking by a sensor-assisted particle filter and
floor plans in a 2.5-D space},
booktitle = {2018 {IEEE} Wireless Communications and Networking Conference, {WCNC}
2018, Barcelona, Spain, April 15-18, 2018},
pages = {1--6},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/WCNC.2018.8377214},
doi = {10.1109/WCNC.2018.8377214},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/LoCLCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-10952,
author = {Yi{-}Chen Chen and
Chia{-}Hao Shen and
Sung{-}Feng Huang and
Hung{-}yi Lee},
title = {Towards Unsupervised Automatic Speech Recognition Trained by Unaligned
Speech and Text only},
journal = {CoRR},
volume = {abs/1803.10952},
year = {2018},
url = {http://arxiv.org/abs/1803.10952},
eprinttype = {arXiv},
eprint = {1803.10952},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-10952.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-10012,
author = {Yongfu Li and
Chin Hui Lee and
Wan Chia Ang and
Kok Peng Chua and
Yoong Seang Jonathan Ong and
Chiu Wing Colin Hui},
title = {Constraining the Synopsys Pin Access Checker Utility for Improved
Standard Cells Library Verification Flow},
journal = {CoRR},
volume = {abs/1805.10012},
year = {2018},
url = {http://arxiv.org/abs/1805.10012},
eprinttype = {arXiv},
eprint = {1805.10012},
timestamp = {Tue, 23 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-10012.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-11426,
author = {Yongfu Li and
Wan Chia Ang and
Chin Hui Lee and
Kok Peng Chua and
Yoong Seang Jonathan Ong and
Chiu Wing Colin Hui},
title = {Standard Cell Library Evaluation with Multiple lithography-compliant
verification and Improved Synopsys Pin Access Checking Utility},
journal = {CoRR},
volume = {abs/1805.11426},
year = {2018},
url = {http://arxiv.org/abs/1805.11426},
eprinttype = {arXiv},
eprint = {1805.11426},
timestamp = {Tue, 23 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-11426.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1807-08089,
author = {Yi{-}Chen Chen and
Sung{-}Feng Huang and
Chia{-}Hao Shen and
Hung{-}yi Lee and
Lin{-}Shan Lee},
title = {Phonetic-and-Semantic Embedding of Spoken Words with Applications
in Spoken Content Retrieval},
journal = {CoRR},
volume = {abs/1807.08089},
year = {2018},
url = {http://arxiv.org/abs/1807.08089},
eprinttype = {arXiv},
eprint = {1807.08089},
timestamp = {Sat, 15 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1807-08089.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1808-02280,
author = {Chia{-}Hsuan Lee and
Shang{-}Ming Wang and
Huan{-}Cheng Chang and
Hung{-}yi Lee},
title = {{ODSQA:} Open-domain Spoken Question Answering Dataset},
journal = {CoRR},
volume = {abs/1808.02280},
year = {2018},
url = {http://arxiv.org/abs/1808.02280},
eprinttype = {arXiv},
eprint = {1808.02280},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1808-02280.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1808-07258,
author = {Chia{-}Che Chang and
Chieh Hubert Lin and
Che{-}Rung Lee and
Da{-}Cheng Juan and
Wei Wei and
Hwann{-}Tzong Chen},
title = {Escaping from Collapsing Modes in a Constrained Space},
journal = {CoRR},
volume = {abs/1808.07258},
year = {2018},
url = {http://arxiv.org/abs/1808.07258},
eprinttype = {arXiv},
eprint = {1808.07258},
timestamp = {Tue, 30 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1808-07258.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-12566,
author = {Yi{-}Chen Chen and
Chia{-}Hao Shen and
Sung{-}Feng Huang and
Hung{-}yi Lee and
Lin{-}Shan Lee},
title = {Almost-unsupervised Speech Recognition with Close-to-zero Resource
Based on Phonetic Structures Learned from Very Small Unpaired Speech
and Text Data},
journal = {CoRR},
volume = {abs/1810.12566},
year = {2018},
url = {http://arxiv.org/abs/1810.12566},
eprinttype = {arXiv},
eprint = {1810.12566},
timestamp = {Thu, 08 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-12566.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-12214,
author = {Chien{-}Yu Lu and
Min{-}Xin Xue and
Chia{-}Che Chang and
Che{-}Rung Lee and
Li Su},
title = {Play as You Like: Timbre-enhanced Multi-modal Music Style Transfer},
journal = {CoRR},
volume = {abs/1811.12214},
year = {2018},
url = {http://arxiv.org/abs/1811.12214},
eprinttype = {arXiv},
eprint = {1811.12214},
timestamp = {Wed, 13 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-12214.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1812-00660,
author = {Wei{-}Chun Chen and
Chia{-}Che Chang and
Chien{-}Yu Lu and
Che{-}Rung Lee},
title = {Knowledge Distillation with Feature Maps for Image Classification},
journal = {CoRR},
volume = {abs/1812.00660},
year = {2018},
url = {http://arxiv.org/abs/1812.00660},
eprinttype = {arXiv},
eprint = {1812.00660},
timestamp = {Tue, 01 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1812-00660.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1812-05272,
author = {Graham Neubig and
Patrick Littell and
Chian{-}Yu Chen and
Jean Lee and
Zirui Li and
Yu{-}Hsiang Lin and
Yuyan Zhang},
title = {Towards a General-Purpose Linguistic Annotation Backend},
journal = {CoRR},
volume = {abs/1812.05272},
year = {2018},
url = {http://arxiv.org/abs/1812.05272},
eprinttype = {arXiv},
eprint = {1812.05272},
timestamp = {Tue, 01 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1812-05272.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/TangHLC17,
author = {Hsin{-}Chieh Tang and
Hung{-}Jin Huang and
Cheng{-}Chun Lee and
Calvin Yu{-}Chian Chen},
title = {Network pharmacology-based approach of novel traditional Chinese medicine
formula for treatment of acute skin inflammation in silico},
journal = {Comput. Biol. Chem.},
volume = {71},
pages = {70--81},
year = {2017},
url = {https://doi.org/10.1016/j.compbiolchem.2017.08.013},
doi = {10.1016/J.COMPBIOLCHEM.2017.08.013},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/candc/TangHLC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ile/CaiCSLL17,
author = {Su Cai and
Feng{-}Kuang Chiang and
Yuchen Sun and
Chenglong Lin and
Joey J. Lee},
title = {Applications of augmented reality-based natural interactive learning
in magnetic field instruction},
journal = {Interact. Learn. Environ.},
volume = {25},
number = {6},
pages = {778--791},
year = {2017},
url = {https://doi.org/10.1080/10494820.2016.1181094},
doi = {10.1080/10494820.2016.1181094},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ile/CaiCSLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/HsuBJSLPMQKI17,
author = {Pin{-}Chia Hsu and
Bart M. H. Bruininks and
Damien Jefferies and
Paulo Cesar Telles de Souza and
Jumin Lee and
Dhilon S. Patel and
Siewert J. Marrink and
Yifei Qi and
Syma Khalid and
Wonpil Im},
title = {{CHARMM-GUI} Martini Maker for modeling and simulation of complex
bacterial membranes with lipopolysaccharides},
journal = {J. Comput. Chem.},
volume = {38},
number = {27},
pages = {2354--2363},
year = {2017},
url = {https://doi.org/10.1002/jcc.24895},
doi = {10.1002/JCC.24895},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcc/HsuBJSLPMQKI17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChangLLCKYTCS17,
author = {Meng{-}Fan Chang and
Chien{-}Chen Lin and
Albert Lee and
Yen{-}Ning Chiang and
Chia{-}Chen Kuo and
Geng{-}Hau Yang and
Hsiang{-}Jen Tsai and
Tien{-}Fu Chen and
Shyh{-}Shyuan Sheu},
title = {A 3T1R Nonvolatile {TCAM} Using {MLC} ReRAM for Frequent-Off Instant-On
Filters in IoT and Big-Data Processing},
journal = {{IEEE} J. Solid State Circuits},
volume = {52},
number = {6},
pages = {1664--1679},
year = {2017},
url = {https://doi.org/10.1109/JSSC.2017.2681458},
doi = {10.1109/JSSC.2017.2681458},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChangLLCKYTCS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LinLC17,
author = {Bor{-}Shing Lin and
Cheng{-}Che Lee and
Pei{-}Ying Chiang},
title = {Simple Smartphone-Based Guiding System for Visually Impaired People},
journal = {Sensors},
volume = {17},
number = {6},
pages = {1371},
year = {2017},
url = {https://doi.org/10.3390/s17061371},
doi = {10.3390/S17061371},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/LinLC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/TanGCHCCLHH17,
author = {Tan{-}Hsu Tan and
Munkhjargal Gochoo and
Yung{-}Fu Chen and
Jin{-}Jia Hu and
John Y. Chiang and
Ching{-}Su Chang and
Ming{-}Huei Lee and
Yung{-}Nian Hsu and
Jiin{-}Chyr Hsu},
title = {Ubiquitous Emergency Medical Service System Based on Wireless Biosensors,
Traffic Information, and Wireless Communication Technologies: Development
and Evaluation},
journal = {Sensors},
volume = {17},
number = {1},
pages = {202},
year = {2017},
url = {https://doi.org/10.3390/s17010202},
doi = {10.3390/S17010202},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/TanGCHCCLHH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/LeeCYCL17,
author = {Chien{-}Ching Lee and
Chia{-}Chun Chuang and
Chia{-}Hong Yeng and
Yeou{-}Jiunn Chen and
Bor{-}Shyh Lin},
title = {Noise Suppression by Minima Controlled Recursive Averaging for SSVEP-Based
BCIs With Single Channel},
journal = {{IEEE} Signal Process. Lett.},
volume = {24},
number = {12},
pages = {1783--1787},
year = {2017},
url = {https://doi.org/10.1109/LSP.2017.2761193},
doi = {10.1109/LSP.2017.2761193},
timestamp = {Fri, 24 Nov 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spl/LeeCYCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ChungTLL17,
author = {Cheng{-}Tao Chung and
Cheng{-}Yu Tsai and
Chia{-}Hsiang Liu and
Lin{-}Shan Lee},
title = {Unsupervised Iterative Deep Learning of Speech Features and Acoustic
Tokens with Applications to Spoken Term Detection},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {25},
number = {10},
pages = {1914--1928},
year = {2017},
url = {https://doi.org/10.1109/TASLP.2017.2729024},
doi = {10.1109/TASLP.2017.2729024},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taslp/ChungTLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/LiuLWCLLPW17,
author = {Hsuan{-}Hung Liu and
Bing{-}Yang Lin and
Cheng{-}Wen Wu and
Wan{-}Ting Chiang and
Mincent Lee and
Hung{-}Chih Lin and
Ching{-}Nen Peng and
Min{-}Jer Wang},
title = {A Built-Off Self-Repair Scheme for Channel-Based 3D Memories},
journal = {{IEEE} Trans. Computers},
volume = {66},
number = {8},
pages = {1293--1301},
year = {2017},
url = {https://doi.org/10.1109/TC.2017.2667645},
doi = {10.1109/TC.2017.2667645},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/LiuLWCLLPW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/ChungYLCL17,
author = {Szu{-}Chi Chung and
Chun{-}Yuan Yu and
Sung{-}Shine Lee and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {An Improved {DPA} Countermeasure Based on Uniform Distribution Random
Power Generator for IoT Applications},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {64-I},
number = {9},
pages = {2522--2531},
year = {2017},
url = {https://doi.org/10.1109/TCSI.2017.2698063},
doi = {10.1109/TCSI.2017.2698063},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/ChungYLCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tci/LeeH17,
author = {Chia{-}Chen Lee and
Wen{-}Liang Hwang},
title = {Mixture of Gaussian Blur Kernel Representation for Blind Image Restoration},
journal = {{IEEE} Trans. Computational Imaging},
volume = {3},
number = {4},
pages = {783--797},
year = {2017},
url = {https://doi.org/10.1109/TCI.2017.2706062},
doi = {10.1109/TCI.2017.2706062},
timestamp = {Thu, 14 Dec 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tci/LeeH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsg/TsaiCCLLWL17,
author = {Chin{-}Chu Tsai and
Le{-}Ren Chang{-}Chien and
I{-}Jen Chen and
Chia{-}Jung Lin and
Wei{-}Jen Lee and
Chin{-}Chung Wu and
Hung{-}Wei Lan},
title = {Practical Considerations to Calibrate Generator Model Parameters Using
Phasor Measurements},
journal = {{IEEE} Trans. Smart Grid},
volume = {8},
number = {5},
pages = {2228--2238},
year = {2017},
url = {https://doi.org/10.1109/TSG.2016.2519528},
doi = {10.1109/TSG.2016.2519528},
timestamp = {Sat, 16 Sep 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsg/TsaiCCLLWL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/LeeMFY17,
author = {Chiou{-}Yng Lee and
Pramod Kumar Meher and
Chia{-}Chen Fan and
Shyan{-}Ming Yuan},
title = {Low-Complexity Digit-Serial Multiplier Over {\textdollar}GF(2\{m\}){\textdollar}
Based on Efficient Toeplitz Block Toeplitz Matrix-Vector Product Decomposition},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {25},
number = {2},
pages = {735--746},
year = {2017},
url = {https://doi.org/10.1109/TVLSI.2016.2605183},
doi = {10.1109/TVLSI.2016.2605183},
timestamp = {Wed, 11 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/LeeMFY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/LeeC17a,
author = {Kelvin Kuang{-}Chi Lee and
Chiao{-}En Chen},
title = {An Eigen-Based Approach for Enhancing Matrix Inversion Approximation
in Massive {MIMO} Systems},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {66},
number = {6},
pages = {5480--5484},
year = {2017},
url = {https://doi.org/10.1109/TVT.2016.2622010},
doi = {10.1109/TVT.2016.2622010},
timestamp = {Thu, 25 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/LeeC17a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/TuLLCCL17,
author = {Yuan{-}Kuang Tu and
Cheng{-}Hua Lee and
Chia{-}Horng Liu and
Chung{-}Yung Chia and
Yuan{-}Kai Chen and
Yi{-}Bing Lin},
title = {Deployment of the First Commercial {LWA} Service},
journal = {{IEEE} Wirel. Commun.},
volume = {24},
number = {6},
pages = {6--8},
year = {2017},
url = {https://doi.org/10.1109/MWC.2017.8246817},
doi = {10.1109/MWC.2017.8246817},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wc/TuLLCCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acii/ChouLCLML17,
author = {Huang{-}Cheng Chou and
Wei{-}Cheng Lin and
Lien{-}Chiang Chang and
Chyi{-}Chang Li and
Hsi{-}Pin Ma and
Chi{-}Chun Lee},
title = {{NNIME:} The {NTHU-NTUA} Chinese interactive multimodal emotion corpus},
booktitle = {Seventh International Conference on Affective Computing and Intelligent
Interaction, {ACII} 2017, San Antonio, TX, USA, October 23-26, 2017},
pages = {292--298},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ACII.2017.8273615},
doi = {10.1109/ACII.2017.8273615},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acii/ChouLCLML17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/HsuDL17,
author = {Chia{-}Chun Hsu and
Jian{-}Jiun Ding and
Yih{-}Cherng Lee},
title = {Efficient edge-oriented based image interpolation algorithm for non-integer
scaling factor},
booktitle = {2017 Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} {ASC} 2017, Kuala Lumpur, Malaysia,
December 12-15, 2017},
pages = {1156--1159},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/APSIPA.2017.8282202},
doi = {10.1109/APSIPA.2017.8282202},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/apsipa/HsuDL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asianhost/SiddiquiLCPS17,
author = {Ali Shuja Siddiqui and
Chia{-}Che Lee and
Wenjie Che and
Jim Plusquellic and
Fareena Saqib},
title = {Secure intra-vehicular communication over {CANFD}},
booktitle = {2017 Asian Hardware Oriented Security and Trust Symposium, AsianHOST
2017, Beijing, China, October 19-20, 2017},
pages = {97--102},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/AsianHOST.2017.8354002},
doi = {10.1109/ASIANHOST.2017.8354002},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asianhost/SiddiquiLCPS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aspdac/HuangHYCCKLC17,
author = {Tzu{-}Hsuan Huang and
Wei{-}Tse Hung and
Hao{-}Yu Yang and
Wen{-}Hsiang Chang and
Ying{-}Yen Chen and
Chun{-}Yi Kuo and
Jih{-}Nung Lee and
Mango C.{-}T. Chao},
title = {Predicting Vt variation and static {IR} drop of ring oscillators using
model-fitting techniques},
booktitle = {22nd Asia and South Pacific Design Automation Conference, {ASP-DAC}
2017, Chiba, Japan, January 16-19, 2017},
pages = {426--431},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ASPDAC.2017.7858360},
doi = {10.1109/ASPDAC.2017.7858360},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/aspdac/HuangHYCCKLC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/HuCCL17,
author = {Hsiao{-}Wei Hu and
Ching{-}Han Cheng and
Yun{-}Chu Chung and
Chia{-}Yu Lee},
editor = {Jian{-}Yun Nie and
Zoran Obradovic and
Toyotaro Suzumura and
Rumi Ghosh and
Raghunath Nambiar and
Chonggang Wang and
Hui Zang and
Ricardo Baeza{-}Yates and
Xiaohua Hu and
Jeremy Kepner and
Alfredo Cuzzocrea and
Jian Tang and
Masashi Toyoda},
title = {Ticket-purchase behavior under the effects of marketing campaigns
on facebook fan pages},
booktitle = {2017 {IEEE} International Conference on Big Data {(IEEE} BigData 2017),
Boston, MA, USA, December 11-14, 2017},
pages = {2746--2751},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/BigData.2017.8258239},
doi = {10.1109/BIGDATA.2017.8258239},
timestamp = {Fri, 19 Nov 2021 16:08:20 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/HuCCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/case/ChienLDCC17,
author = {Chen{-}Fu Chien and
Peng{-}Chieh Lee and
Runliang Dou and
Ying{-}Jen Chen and
Chia{-}Cheng Chen},
title = {Modeling collinear WATs for parametric yield enhancement in semiconductor
manufacturing},
booktitle = {13th {IEEE} Conference on Automation Science and Engineering, {CASE}
2017, Xi'an, China, August 20-23, 2017},
pages = {739--743},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/COASE.2017.8256192},
doi = {10.1109/COASE.2017.8256192},
timestamp = {Fri, 03 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/case/ChienLDCC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ciac/ChenHHKLW17,
author = {Li{-}Hsuan Chen and
Sun{-}Yuan Hsieh and
Ling{-}Ju Hung and
Ralf Klasing and
Chia{-}Wei Lee and
Bang Ye Wu},
editor = {Dimitris Fotakis and
Aris Pagourtzis and
Vangelis Th. Paschos},
title = {On the Complexity of the Star p-hub Center Problem with Parameterized
Triangle Inequality},
booktitle = {Algorithms and Complexity - 10th International Conference, {CIAC}
2017, Athens, Greece, May 24-26, 2017, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10236},
pages = {152--163},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-57586-5\_14},
doi = {10.1007/978-3-319-57586-5\_14},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ciac/ChenHHKLW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/desec/DengCLCL17,
author = {Juinn{-}Horng Deng and
Pin{-}Nien Chen and
Chia{-}Fang Lee and
Yuan{-}Feng Chan and
Yen{-}Chung Lin},
title = {{SDR} measurement platform design for {FMCW} {RADAR} performance verification},
booktitle = {{IEEE} Conference on Dependable and Secure Computing, {DSC} 2017,
Taipei, Taiwan, August 7-10, 2017},
pages = {477--478},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/DESEC.2017.8073869},
doi = {10.1109/DESEC.2017.8073869},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/desec/DengCLCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcce/SuPWCLWLCL17,
author = {Tzu{-}Hao Su and
Si{-}Ching Pan and
Xutao Wei and
Yu{-}Liang Chiang and
Ting{-}Lan Lin and
Yangming Wen and
Zhaoyi Liu and
Shih{-}Lun Chen and
Ho{-}Yin Lee},
title = {Sparsity analysis of endoscopy images},
booktitle = {{IEEE} 6th Global Conference on Consumer Electronics, {GCCE} 2017,
Nagoya, Japan, October 24-27, 2017},
pages = {1--2},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/GCCE.2017.8229209},
doi = {10.1109/GCCE.2017.8229209},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/gcce/SuPWCLWLCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/TsaiCCL17,
author = {Wen{-}Hsien Tsai and
Hui{-}Chiao Chen and
Jui{-}Chu Chang and
Hsiu{-}Li Lee},
editor = {Tung Bui},
title = {The Internal Audit Performance: The Effectiveness of {ERM} and {IT}
Environments},
booktitle = {50th Hawaii International Conference on System Sciences, {HICSS} 2017,
Hilton Waikoloa Village, Hawaii, USA, January 4-7, 2017},
pages = {1--9},
publisher = {ScholarSpace / {AIS} Electronic Library (AISeL)},
year = {2017},
url = {https://hdl.handle.net/10125/41757},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/TsaiCCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icatech/ChuKCLLSL17,
author = {Yuan{-}Chia Chu and
Wen{-}Tsung Kuo and
Yuan{-}Ren Cheng and
Fong{-}Ci Lin and
Chung{-}Yuan Lee and
Cheng{-}Ying Shiau and
Feipei Lai},
title = {{SMART} survival metadata analysis responsive tool},
booktitle = {{XXVI} International Conference on Information, Communication and
Automation Technologies, {ICAT} 2017, Sarajevo, Bosnia and Herzegovina,
October 26-28, 2017},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ICAT.2017.8171608},
doi = {10.1109/ICAT.2017.8171608},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icatech/ChuKCLLSL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/HsuCLY17,
author = {Bo{-}Kai Hsu and
Po{-}Chun Chou and
Chia{-}Han Lee and
Ping{-}Cheng Yeh},
title = {Training-based synchronization for quantity-based modulation in inverse
Gaussian channels},
booktitle = {{IEEE} International Conference on Communications, {ICC} 2017, Paris,
France, May 21-25, 2017},
pages = {1--6},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICC.2017.7996905},
doi = {10.1109/ICC.2017.7996905},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/icc/HsuCLY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/ChiouLHC17,
author = {Hong{-}Wen Chiou and
Yu{-}Min Lee and
Hsuan{-}Hsuan Hsiao and
Liang{-}Chia Cheng},
editor = {Sri Parameswaran},
title = {Thermal modeling and design on smartphones with heat pipe cooling
technique},
booktitle = {2017 {IEEE/ACM} International Conference on Computer-Aided Design,
{ICCAD} 2017, Irvine, CA, USA, November 13-16, 2017},
pages = {482--489},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICCAD.2017.8203816},
doi = {10.1109/ICCAD.2017.8203816},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iccad/ChiouLHC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icgec/LeeYC17,
author = {Chen{-}Yu Lee and
Jia{-}Fong Yeh and
Tsung{-}Che Chiang},
editor = {Jerry Chun{-}Wei Lin and
Jeng{-}Shyang Pan and
Shu{-}Chuan Chu and
Chien{-}Ming Chen},
title = {A Many-Objective Evolutionary Algorithm with Reference Point-Based
and Vector Angle-Based Selection},
booktitle = {Genetic and Evolutionary Computing - Proceedings of the Eleventh International
Conference on Genetic and Evolutionary Computing, {ICGEC} 2017, November
6-8, 2017, Kaohsiung, Taiwan},
series = {Advances in Intelligent Systems and Computing},
volume = {579},
pages = {3--11},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-981-10-6487-6\_1},
doi = {10.1007/978-981-10-6487-6\_1},
timestamp = {Thu, 22 Oct 2020 13:52:00 +0200},
biburl = {https://dblp.org/rec/conf/icgec/LeeYC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iiaiaai/LinCL17,
author = {Zhong{-}Yi Lin and
Tsung{-}Che Chiang and
Chen{-}Yu Lee},
title = {Adaptive Multiobjective Differential Evolution Algorithms for Environmental/Economic
Dispatch},
booktitle = {6th {IIAI} International Congress on Advanced Applied Informatics,
{IIAI-AAI} 2017, Hamamatsu, Japan, July 9-13, 2017},
pages = {909--914},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/IIAI-AAI.2017.26},
doi = {10.1109/IIAI-AAI.2017.26},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iiaiaai/LinCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iiaiaai/WangLLCSLY17,
author = {Shao{-}Yu Wang and
Owen H. T. Lu and
Wen{-}Long Lee and
Tosti Hsu{-}Cheng Chiang and
Wan{-}Sheng Su and
Ming{-}Chao Lin and
Stephen J. H. Yang},
title = {Examining the Trend of Taiwan Primary and High School Scientific Exhibition
by Using Text Mining Technique},
booktitle = {6th {IIAI} International Congress on Advanced Applied Informatics,
{IIAI-AAI} 2017, Hamamatsu, Japan, July 9-13, 2017},
pages = {477--481},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/IIAI-AAI.2017.181},
doi = {10.1109/IIAI-AAI.2017.181},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iiaiaai/WangLLCSLY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iih-msp/HuangLHOHCT17,
author = {Nen{-}Fu Huang and
Chia{-}An Lee and
Yi{-}Wei Huang and
Po{-}Wen Ou and
How{-}Hsuan Hsu and
So{-}Chen Chen and
Jian{-}Wei Tzeng},
editor = {Jeng{-}Shyang Pan and
Pei{-}Wei Tsai and
Junzo Watada and
Lakhmi C. Jain},
title = {On the Automatic Construction of Knowledge-Map from Handouts for {MOOC}
Courses},
booktitle = {Advances in Intelligent Information Hiding and Multimedia Signal Processing
- Proceedings of the Thirteenth International Conference on Intelligent
Information Hiding and Multimedia Signal Processing, {IIH-MSP} 2017,
August, 12-15, 2017, Matsue, Shimane, Japan, Part {I}},
series = {Smart Innovation, Systems and Technologies},
volume = {81},
pages = {107--114},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-63856-0\_13},
doi = {10.1007/978-3-319-63856-0\_13},
timestamp = {Sun, 25 Oct 2020 22:36:27 +0100},
biburl = {https://dblp.org/rec/conf/iih-msp/HuangLHOHCT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WuCL17,
author = {Tsung{-}Chen Wu and
Tai{-}Shih Chi and
Chia{-}Fone Lee},
editor = {Francisco Lacerda},
title = {Simulations of High-Frequency Vocoder on Mandarin Speech Recognition
for Acoustic Hearing Preserved Cochlear Implant},
booktitle = {18th Annual Conference of the International Speech Communication Association,
Interspeech 2017, Stockholm, Sweden, August 20-24, 2017},
pages = {196--200},
publisher = {{ISCA}},
year = {2017},
url = {https://doi.org/10.21437/Interspeech.2017-858},
doi = {10.21437/INTERSPEECH.2017-858},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/WuCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipsn/SuSWL17,
author = {Chia{-}Min Su and
Cheng{-}Yu Shi and
Yong{-}Lin Wu and
Huang{-}Chen Lee},
editor = {Pei Zhang and
Prabal Dutta and
Guoliang Xing},
title = {A LoRa wireless smart badge for enhancing museum visitors' experience:
demo abstract},
booktitle = {Proceedings of the 16th {ACM/IEEE} International Conference on Information
Processing in Sensor Networks, {IPSN} 2017, Pittsburgh, PA, USA, April
18-21, 2017},
pages = {261--262},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3055031.3055035},
doi = {10.1145/3055031.3055035},
timestamp = {Thu, 19 Aug 2021 10:42:37 +0200},
biburl = {https://dblp.org/rec/conf/ipsn/SuSWL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LeeKLCC17,
author = {Yueh{-}Ying Lee and
Pin{-}Hung Kuo and
Chia{-}Han Lee and
Yen{-}Kuang Chen and
Shao{-}Yi Chien},
title = {Distributed video codec with spatiotemporal side information},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2017,
Baltimore, MD, USA, May 28-31, 2017},
pages = {1--4},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISCAS.2017.8050299},
doi = {10.1109/ISCAS.2017.8050299},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LeeKLCC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispass/WangTWCWCLSYHKL17,
author = {Li Wang and
Ren{-}Wei Tsai and
Shao{-}Chung Wang and
Kun{-}Chih Chen and
Po{-}Han Wang and
Hsiang{-}Yun Cheng and
Yi{-}Chung Lee and
Sheng{-}Jie Shu and
Chun{-}Chieh Yang and
Min{-}Yih Hsu and
Li{-}Chen Kan and
Chao{-}Lin Lee and
Tzu{-}Chieh Yu and
Rih{-}Ding Peng and
Chia{-}Lin Yang and
Yuan{-}Shin Hwang and
Jenq Kuen Lee and
Shiao{-}Li Tsao and
Ming Ouhyoung},
title = {Analyzing OpenCL 2.0 workloads using a heterogeneous {CPU-GPU} simulator},
booktitle = {2017 {IEEE} International Symposium on Performance Analysis of Systems
and Software, {ISPASS} 2017, Santa Rosa, CA, USA, April 24-25, 2017},
pages = {127--128},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ISPASS.2017.7975279},
doi = {10.1109/ISPASS.2017.7975279},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispass/WangTWCWCLSYHKL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChangCCSCFLLHLL17,
author = {Jonathan Chang and
Yen{-}Huei Chen and
Wei{-}Min Chan and
Sahil Preet Singh and
Hank Cheng and
Hidehiro Fujiwara and
Jih{-}Yu Lin and
Kao{-}Cheng Lin and
John Hung and
Robin Lee and
Hung{-}Jen Liao and
Jhon{-}Jhy Liaw and
Quincy Li and
Chih{-}Yung Lin and
Mu{-}Chi Chiang and
Shien{-}Yang Wu},
title = {12.1 {A} 7nm 256Mb {SRAM} in high-k metal-gate FinFET technology with
write-assist circuitry for low-VMIN applications},
booktitle = {2017 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2017, San Francisco, CA, USA, February 5-9, 2017},
pages = {206--207},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISSCC.2017.7870333},
doi = {10.1109/ISSCC.2017.7870333},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChangCCSCFLLHLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isvlsi/FangLLHCCLKC17,
author = {Sheng{-}Hsin Fang and
Chang{-}Tzu Lin and
Wei{-}Hsun Liao and
Chien{-}Chia Huang and
Li{-}Chin Chen and
Hung{-}Ming Chen and
I{-}Hsuan Lee and
Ding{-}Ming Kwai and
Yung{-}Fa Chou},
title = {On Tolerating Faults of TSV/Microbumps for Power Delivery Networks
in 3D {IC}},
booktitle = {2017 {IEEE} Computer Society Annual Symposium on VLSI, {ISVLSI} 2017,
Bochum, Germany, July 3-5, 2017},
pages = {459--464},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ISVLSI.2017.86},
doi = {10.1109/ISVLSI.2017.86},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isvlsi/FangLLHCCLKC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdl/WuCCLG17,
author = {Jian Wu and
Sagnik Ray Choudhury and
Agnese Chiatti and
Chen Liang and
C. Lee Giles},
title = {{HESDK:} {A} Hybrid Approach to Extracting Scientific Domain Knowledge
Entities},
booktitle = {2017 {ACM/IEEE} Joint Conference on Digital Libraries, {JCDL} 2017,
Toronto, ON, Canada, June 19-23, 2017},
pages = {241--244},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/JCDL.2017.7991580},
doi = {10.1109/JCDL.2017.7991580},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/jcdl/WuCCLG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobisec2/LeeTCLK17,
author = {Tsung{-}Ju Lee and
Shian{-}Shyong Tseng and
Hsing{-}Chung Chen and
Sung{-}Chiang Lin and
Chiun{-}How Kao},
editor = {Ilsun You and
Hsing{-}Chung Chen and
Vishal Sharma and
Igor V. Kotenko},
title = {A Frame-Based Approach to Generating Insider Threat Test Suite on
Cloud File-Sharing},
booktitle = {Mobile Internet Security - Second International Symposium, MobiSec
2017, Jeju Island, Republic of Korea, October 19-22, 2017, Revised
Selected Papers},
series = {Communications in Computer and Information Science},
volume = {971},
pages = {151--156},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-981-13-3732-1\_12},
doi = {10.1007/978-981-13-3732-1\_12},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mobisec2/LeeTCLK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mwscas/SiddiquiLS17,
author = {Ali Shuja Siddiqui and
Chia{-}Che Lee and
Fareena Saqib},
title = {Hardware based protection against malwares by {PUF} based access control
mechanism},
booktitle = {{IEEE} 60th International Midwest Symposium on Circuits and Systems,
{MWSCAS} 2017, Boston, MA, USA, August 6-9, 2017},
pages = {1312--1315},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/MWSCAS.2017.8053172},
doi = {10.1109/MWSCAS.2017.8053172},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/mwscas/SiddiquiLS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/ChouWCCHCL17,
author = {Shan{-}Ying Chou and
Jia{-}Han Wu and
Shang{-}Ta Chou and
Chia{-}Hui Chen and
Wen{-}Yen Huang and
Chen{-}Yu Chen and
Gwo{-}Bin Lee},
title = {An integrated microfluidic system for automating multiplex allergy
microarrays},
booktitle = {12th {IEEE} International Conference on Nano/Micro Engineered and
Molecular Systems, {NEMS} 2017, Los Angeles, CA, USA, April 9-12,
2017},
pages = {434--437},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/NEMS.2017.8017059},
doi = {10.1109/NEMS.2017.8017059},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/nems/ChouWCCHCL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/ChangVLKEDMBC17,
author = {Chia{-}Ming Chang and
Guilhem de Valicourt and
Jeffrey Lee and
K. W. Kim and
Michael S. Eggleston and
Po Dong and
Anaelle Maho and
Romain Brenot and
Young{-}Kai Chen},
title = {Small form factor hybrid Ill-V/Si wavelength-tunable push-pull microring
based transmitter},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2017,
Los Angeles, CA, USA, March 19-23, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://ieeexplore.ieee.org/document/7937317},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/ChangVLKEDMBC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/ValicourtCEMZLS17,
author = {Guilhem de Valicourt and
Chia{-}Ming Chang and
Michael S. Eggleston and
Argishti Melikyan and
C. Zhu and
J. Lee and
Jesse E. Simsarian and
S. Chandrasekhar and
Jeffrey H. Sinsky and
Kwangwoong Kim and
Anaelle Maho and
R. Brenot and
Po Dong and
Young{-}Kai Chen},
title = {Hybrid III-V/Silicon integration: Enabling the next generation of
advanced photonic transmitters},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2017,
Los Angeles, CA, USA, March 19-23, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://ieeexplore.ieee.org/document/7937422},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/ValicourtCEMZLS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/ValicourtEZLCSK17,
author = {Guilhem de Valicourt and
Michael S. Eggleston and
C. Zhu and
J. Lee and
Chia{-}Ming Chang and
Jeffrey H. Sinsky and
K. W. Kim and
Young{-}Kai Chen and
Anaelle Maho and
R. Brenot and
Po Dong},
title = {80Gb/s {PDM-QPSK} PIC-to-PIC transmission based on integrated hybrid
silicon/III-V wavelength-tunable transmitter and monolithic silicon
coherent receiver},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2017,
Los Angeles, CA, USA, March 19-23, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://ieeexplore.ieee.org/document/7937205},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/ValicourtEZLCSK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/LiuCPRCCFL17,
author = {Lee{-}Kai Liu and
Li{-}Yu Chien and
Shang{-}Heh Pan and
Jia{-}Liang Ren and
Chi{-}Lun Chiao and
Wei{-}Hsuan Chen and
Li{-}Chen Fu and
Jin{-}Shin Lai},
title = {Interactive torque controller with electromyography intention prediction
implemented on exoskeleton robot {NTUH-II}},
booktitle = {2017 {IEEE} International Conference on Robotics and Biomimetics,
{ROBIO} 2017, Macau, China, December 5-8, 2017},
pages = {1485--1490},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ROBIO.2017.8324627},
doi = {10.1109/ROBIO.2017.8324627},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/robio/LiuCPRCCFL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/HanHCHLKCCH17,
author = {Ping{-}Hsuan Han and
Chiao{-}En Hsieh and
Yang{-}Sheng Chen and
Jui{-}Chun Hsiao and
Kong{-}Chang Lee and
Sheng{-}Fu Ko and
Kuan{-}Wen Chen and
Chien{-}Hsing Chou and
Yi{-}Ping Hung},
title = {AoEs: enhancing teleportation experience in immersive environment
with mid-air haptics},
booktitle = {Special Interest Group on Computer Graphics and Interactive Techniques
Conference, {SIGGRAPH} 2017, Los Angeles, CA, USA, July 30 - August
3, 2017, Emerging Technologies},
pages = {3:1--3:2},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3084822.3084823},
doi = {10.1145/3084822.3084823},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/HanHCHLKCCH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/spawc/LeeC17a,
author = {Kelvin Kuang{-}Chi Lee and
Chiao{-}En Chen},
title = {An improved matrix inversion approximation method for massive {MIMO}
systems with transmit antenna correlation},
booktitle = {18th {IEEE} International Workshop on Signal Processing Advances in
Wireless Communications, {SPAWC} 2017, Sapporo, Japan, July 3-6, 2017},
pages = {1--5},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/SPAWC.2017.8227755},
doi = {10.1109/SPAWC.2017.8227755},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/spawc/LeeC17a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uic/ChangCLL17,
author = {Cheng{-}Shang Chang and
Chia{-}Tai Chang and
Duan{-}Shin Lee and
Li{-}Heng Liou},
title = {K-sets\({}^{\mbox{+}}\): {A} linear-time clustering algorithm for
data points with a sparse similarity measure},
booktitle = {2017 {IEEE} SmartWorld, Ubiquitous Intelligence {\&} Computing,
Advanced {\&} Trusted Computed, Scalable Computing {\&} Communications,
Cloud {\&} Big Data Computing, Internet of People and Smart City
Innovation, SmartWorld/SCALCOM/UIC/ATC/CBDCom/IOP/SCI 2017, San Francisco,
CA, USA, August 4-8, 2017},
pages = {1--8},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/UIC-ATC.2017.8397636},
doi = {10.1109/UIC-ATC.2017.8397636},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/uic/ChangCLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/WuWLSWCKHLC17,
author = {Te{-}Yen Wu and
Bryan Wang and
Jiun{-}Yu Lee and
Hao{-}Ping Shen and
Yu{-}Chian Wu and
Yu{-}An Chen and
Pin{-}Sung Ku and
Ming{-}Wei Hsu and
Yu{-}Chih Lin and
Mike Y. Chen},
editor = {Krzysztof Gajos and
Jennifer Mankoff and
Chris Harrison},
title = {CircuitSense: Automatic Sensing of Physical Circuits and Generation
of Virtual Circuits to Support Software Tools},
booktitle = {Proceedings of the 30th Annual {ACM} Symposium on User Interface Software
and Technology, {UIST} 2017, Quebec City, QC, Canada, October 22 -
25, 2017},
pages = {311--319},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3126594.3126634},
doi = {10.1145/3126594.3126634},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uist/WuWLSWCKHLC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/WuCLLW17,
author = {Chia{-}Heng Wu and
Ting{-}Sheng Chen and
Ding{-}Yuan Lee and
Tsung{-}Te Liu and
An{-}Yeu Wu},
title = {Low-latency Voltage-Racing Winner-Take-All {(VR-WTA)} circuit for
acceleration of learning engine},
booktitle = {2017 International Symposium on {VLSI} Design, Automation and Test,
{VLSI-DAT} 2017, Hsinchu, Taiwan, April 24-27, 2017},
pages = {1--4},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/VLSI-DAT.2017.7939641},
doi = {10.1109/VLSI-DAT.2017.7939641},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/WuCLLW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/LinLL17,
author = {Yeh{-}Cheng Lin and
Chia{-}Peng Lee and
Phone Lin},
title = {A Study on Networking Functionalities and Challenges for Machine-to-Machine
Mobile Networks},
booktitle = {86th {IEEE} Vehicular Technology Conference, {VTC} Fall 2017, Toronto,
ON, Canada, September 24-27, 2017},
pages = {1--4},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/VTCFall.2017.8288379},
doi = {10.1109/VTCFALL.2017.8288379},
timestamp = {Mon, 20 Dec 2021 11:29:16 +0100},
biburl = {https://dblp.org/rec/conf/vtc/LinLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/HuangLWNCWLC17,
author = {Yu{-}Hao Huang and
Ching{-}Ho Lu and
Tse{-}Wei Wu and
Yu{-}Teng Nien and
Ying{-}Yen Chen and
Max Wu and
Jih{-}Nung Lee and
Mango C.{-}T. Chao},
title = {Methodology of generating dual-cell-aware tests},
booktitle = {35th {IEEE} {VLSI} Test Symposium, {VTS} 2017, Las Vegas, NV, USA,
April 9-12, 2017},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/VTS.2017.7928925},
doi = {10.1109/VTS.2017.7928925},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vts/HuangLWNCWLC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ChangCLL17,
author = {Cheng{-}Shang Chang and
Chia{-}Tai Chang and
Duan{-}Shin Lee and
Li{-}Heng Liou},
title = {K-sets+: a Linear-time Clustering Algorithm for Data Points with a
Sparse Similarity Measure},
journal = {CoRR},
volume = {abs/1705.04249},
year = {2017},
url = {http://arxiv.org/abs/1705.04249},
eprinttype = {arXiv},
eprint = {1705.04249},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ChangCLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ChungTLL17,
author = {Cheng{-}Tao Chung and
Cheng{-}Yu Tsai and
Chia{-}Hsiang Liu and
Lin{-}Shan Lee},
title = {Unsupervised Iterative Deep Learning of Speech Features and Acoustic
Tokens with Applications to Spoken Term Detection},
journal = {CoRR},
volume = {abs/1707.05315},
year = {2017},
url = {http://arxiv.org/abs/1707.05315},
eprinttype = {arXiv},
eprint = {1707.05315},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ChungTLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChenL16,
author = {Yi{-}Chung Chen and
Chiang Lee},
title = {Skyline Path Queries With Aggregate Attributes},
journal = {{IEEE} Access},
volume = {4},
pages = {4690--4706},
year = {2016},
url = {https://doi.org/10.1109/ACCESS.2016.2602702},
doi = {10.1109/ACCESS.2016.2602702},
timestamp = {Wed, 04 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChenL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChenLL16,
author = {Chi{-}Hua Chen and
Chi{-}Ao Lee and
Chi{-}Chun Lo},
title = {Vehicle Localization and Velocity Estimation Based on Mobile Phone
Sensing},
journal = {{IEEE} Access},
volume = {4},
pages = {803--817},
year = {2016},
url = {https://doi.org/10.1109/ACCESS.2016.2530806},
doi = {10.1109/ACCESS.2016.2530806},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/ChenLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LiLLLC16,
author = {Tzuu{-}Hseng S. Li and
Ming{-}Han Lee and
Chia{-}Wei Lin and
Guan{-}Hong Liou and
Wei{-}Chung Chen},
title = {Design of Autonomous and Manual Driving System for 4WIS4WID Vehicle},
journal = {{IEEE} Access},
volume = {4},
pages = {2256--2271},
year = {2016},
url = {https://doi.org/10.1109/ACCESS.2016.2548081},
doi = {10.1109/ACCESS.2016.2548081},
timestamp = {Wed, 04 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LiLLLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/JuangCLL16,
author = {Chia{-}Feng Juang and
Guo{-}Cyuan Chen and
Chung{-}Wei Liang and
Demei Lee},
title = {Stereo-camera-based object detection using fuzzy color histograms
and a fuzzy classifier with depth and shape estimations},
journal = {Appl. Soft Comput.},
volume = {46},
pages = {753--766},
year = {2016},
url = {https://doi.org/10.1016/j.asoc.2015.10.025},
doi = {10.1016/J.ASOC.2015.10.025},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/asc/JuangCLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/HungCCLCLLHL16,
author = {Sheng{-}Jou Hung and
Yi{-}Lin Chen and
Chia{-}Hung Chu and
Chuan{-}Chun Lee and
Wan{-}Li Chen and
Ya{-}Lan Lin and
Ming{-}Ching Lin and
Chung{-}Liang Ho and
Tsunglin Liu},
title = {TRIg: a robust alignment pipeline for non-regular T-cell receptor
and immunoglobulin sequences},
journal = {{BMC} Bioinform.},
volume = {17},
pages = {433},
year = {2016},
url = {https://doi.org/10.1186/s12859-016-1304-2},
doi = {10.1186/S12859-016-1304-2},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/HungCCLCLLHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cim/HuangCCHL16,
author = {Shih{-}Chia Huang and
Bo{-}Hao Chen and
Sheng{-}Kai Chou and
Jenq{-}Neng Hwang and
Kuan{-}Hui Lee},
title = {Smart Car [Application Notes]},
journal = {{IEEE} Comput. Intell. Mag.},
volume = {11},
number = {4},
pages = {46--58},
year = {2016},
url = {https://doi.org/10.1109/MCI.2016.2601758},
doi = {10.1109/MCI.2016.2601758},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cim/HuangCCHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cim/LeeWYWWCCWY16,
author = {Chang{-}Shing Lee and
Mei{-}Hui Wang and
Shi{-}Jim Yen and
Ting{-}Han Wei and
I{-}Chen Wu and
Ping{-}Chiang Chou and
Chun{-}Hsun Chou and
Ming{-}Wan Wang and
Tai{-}Hsiung Yang},
title = {Human vs. Computer Go: Review and Prospect [Discussion Forum]},
journal = {{IEEE} Comput. Intell. Mag.},
volume = {11},
number = {3},
pages = {67--72},
year = {2016},
url = {https://doi.org/10.1109/MCI.2016.2572559},
doi = {10.1109/MCI.2016.2572559},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cim/LeeWYWWCCWY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/ShihWLCCL16,
author = {Kao{-}Shang Shih and
Pei{-}Wei Weng and
Shang{-}Chih Lin and
Yi{-}Tzu Chen and
Cheng{-}Kung Cheng and
Chian{-}Her Lee},
title = {Biomechanical comparison between concentrated, follower, and muscular
loads of the lumbar column},
journal = {Comput. Methods Programs Biomed.},
volume = {135},
pages = {209--218},
year = {2016},
url = {https://doi.org/10.1016/j.cmpb.2016.07.021},
doi = {10.1016/J.CMPB.2016.07.021},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/ShihWLCCL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dt/LinCWLLPW16,
author = {Bing{-}Yang Lin and
Wan{-}Ting Chiang and
Cheng{-}Wen Wu and
Mincent Lee and
Hung{-}Chih Lin and
Ching{-}Nen Peng and
Min{-}Jer Wang},
title = {Configurable Cubical Redundancy Schemes for Channel-Based 3-D {DRAM}
Yield Improvement},
journal = {{IEEE} Des. Test},
volume = {33},
number = {2},
pages = {30--39},
year = {2016},
url = {https://doi.org/10.1109/MDAT.2015.2455347},
doi = {10.1109/MDAT.2015.2455347},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dt/LinCWLLPW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/ChangL16,
author = {Chia{-}Lun Chang and
Tai{-}Cheng Lee},
title = {A Compact Multi-Input Power Conversion System with High Time-Efficiency
Inductor-Sharing Technique for Thermoelectric Energy Harvesting Applications},
journal = {J. Circuits Syst. Comput.},
volume = {25},
number = {1},
pages = {1640007:1--1640007:18},
year = {2016},
url = {https://doi.org/10.1142/S0218126616400077},
doi = {10.1142/S0218126616400077},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcsc/ChangL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JuLLCCWWLHCLCLC16,
author = {Chi{-}Cheng Ju and
Tsu{-}Ming Liu and
Kun{-}Bin Lee and
Yung{-}Chang Chang and
Han{-}Liang Chou and
Chih{-}Ming Wang and
Tung{-}Hsing Wu and
Hue{-}Min Lin and
Yi{-}Hsin Huang and
Chia{-}Yun Cheng and
Ting{-}An Lin and
Chun{-}Chia Chen and
Yu{-}Kun Lin and
Min{-}Hao Chiu and
Wei{-}Cing Li and
Sheng{-}Jen Wang and
Yen{-}Chieh Lai and
Ping Chao and
Chih{-}Da Chien and
Meng{-}Jye Hu and
Peng{-}Hao Wang and
Yen{-}Chao Huang and
Shun{-}Hsiang Chuang and
Lien{-}Fei Chen and
Hsiu{-}Yi Lin and
Ming{-}Long Wu and
Che{-}Hong Chen},
title = {A 0.5 nJ/Pixel 4 {K} {H.265/HEVC} Codec {LSI} for Multi-Format Smartphone
Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {51},
number = {1},
pages = {56--67},
year = {2016},
url = {https://doi.org/10.1109/JSSC.2015.2465857},
doi = {10.1109/JSSC.2015.2465857},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JuLLCCWWLHCLCLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/monet/MaLCL16,
author = {Shang{-}Pin Ma and
Wen{-}Tin Lee and
Ping{-}Chang Chen and
Chi{-}Chia Li},
title = {Framework for Enhancing Mobile Availability of RESTful Services -
{A} Connectivity-Aware and Risk-Driven Approach},
journal = {Mob. Networks Appl.},
volume = {21},
number = {2},
pages = {337--351},
year = {2016},
url = {https://doi.org/10.1007/s11036-015-0655-7},
doi = {10.1007/S11036-015-0655-7},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/monet/MaLCL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ChouCSHLLYHWTTH16,
author = {Chih{-}Hung Chou and
Nai{-}Wen Chang and
Sirjana Shrestha and
Sheng{-}Da Hsu and
Yu{-}Ling Lin and
Wei{-}Hsiang Lee and
Chi{-}Dung Yang and
Hsiao{-}Chin Hong and
Ting{-}Yen Wei and
Siang{-}Jyun Tu and
Tzi{-}Ren Tsai and
Shu{-}Yi Ho and
Ting{-}Yan Jian and
Hsin{-}Yi Wu and
Pin{-}Rong Chen and
Nai{-}Chieh Lin and
Hsin{-}Tzu Huang and
Tzu{-}Ling Yang and
Chung{-}Yuan Pai and
Chun{-}San Tai and
Wen{-}Liang Chen and
Chia{-}Yen Huang and
Chun{-}Chi Liu and
Shun{-}Long Weng and
Kuang{-}Wen Liao and
Wen{-}Lian Hsu and
Hsien{-}Da Huang},
title = {miRTarBase 2016: updates to the experimentally validated miRNA-target
interactions database},
journal = {Nucleic Acids Res.},
volume = {44},
number = {Database-Issue},
pages = {239--247},
year = {2016},
url = {https://doi.org/10.1093/nar/gkv1258},
doi = {10.1093/NAR/GKV1258},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/ChouCSHLLYHWTTH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChungYLLTLWWTTC16,
author = {Tien{-}Kan Chung and
Po{-}Chen Yeh and
Hao Lee and
Cheng{-}Mao Lin and
Chia{-}Yung Tseng and
Wen{-}Tuan Lo and
Chieh{-}Min Wang and
Wen{-}Chin Wang and
Chi{-}Jen Tu and
Pei{-}Yuan Tasi and
Jui{-}Wen Chang},
title = {An Attachable Electromagnetic Energy Harvester Driven Wireless Sensing
System Demonstrating Milling-Processes and Cutter-Wear/Breakage-Condition
Monitoring},
journal = {Sensors},
volume = {16},
number = {3},
pages = {269},
year = {2016},
url = {https://doi.org/10.3390/s16030269},
doi = {10.3390/S16030269},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/ChungYLLTLWWTTC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/FangLC16,
author = {Wen{-}Hsien Fang and
Yi{-}Chiao Lee and
Yie{-}Tarng Chen},
title = {Importance Sampling-Based Maximum Likelihood Estimation for Multidimensional
Harmonic Retrieval},
journal = {{IEEE} Signal Process. Lett.},
volume = {23},
number = {1},
pages = {35--39},
year = {2016},
url = {https://doi.org/10.1109/LSP.2015.2498195},
doi = {10.1109/LSP.2015.2498195},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spl/FangLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/LaiLCKC16,
author = {Bo{-}Cheng Charles Lai and
Chia{-}Ying Lee and
Tsou{-}Han Chiu and
Hsien{-}Kai Kuo and
Chun{-}Kai Chang},
title = {Unified Designs for High Performance {LDPC} Decoding on {GPGPU}},
journal = {{IEEE} Trans. Computers},
volume = {65},
number = {12},
pages = {3754--3765},
year = {2016},
url = {https://doi.org/10.1109/TC.2016.2547379},
doi = {10.1109/TC.2016.2547379},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/LaiLCKC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LaiJLCCTL16,
author = {Shin{-}Chi Lai and
Wen{-}Ho Juang and
Yueh{-}Shu Lee and
Shin{-}Hao Chen and
Ke{-}Horng Chen and
Chia{-}Chun Tsai and
Chiung{-}Hon Lee},
title = {Hybrid Architecture Design for Calculating Variable-Length Fourier
Transform},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {63-II},
number = {3},
pages = {279--283},
year = {2016},
url = {https://doi.org/10.1109/TCSII.2015.2482238},
doi = {10.1109/TCSII.2015.2482238},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LaiJLCCTL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LeeHY16,
author = {Cheng{-}Yen Lee and
Ping{-}Hsuan Hsieh and
Chia{-}Hsiang Yang},
title = {A Standard-Cell-Design-Flow Compatible Energy-Recycling Logic With
70{\%} Energy Saving},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {63-I},
number = {1},
pages = {70--79},
year = {2016},
url = {https://doi.org/10.1109/TCSI.2015.2510620},
doi = {10.1109/TCSI.2015.2510620},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcas/LeeHY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LinTCCL16,
author = {Chia{-}Lung Lin and
Shu{-}Wen Tu and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {An Efficient Decoder Architecture for Nonbinary {LDPC} Codes With
Extended Min-Sum Algorithm},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {63-II},
number = {9},
pages = {863--867},
year = {2016},
url = {https://doi.org/10.1109/TCSII.2016.2534820},
doi = {10.1109/TCSII.2016.2534820},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LinTCCL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LinWHWL16,
author = {Chin{-}Yu Lin and
Chien{-}Heng Wong and
Chia{-}Hau Hsu and
Yen{-}Hsin Wei and
Tai{-}Cheng Lee},
title = {A 200-MS/s Phase-Detector-Based Comparator With 400-{\(\mu\)}V\({}_{\mbox{rms}}\)
Noise},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {63-II},
number = {9},
pages = {813--817},
year = {2016},
url = {https://doi.org/10.1109/TCSII.2016.2534678},
doi = {10.1109/TCSII.2016.2534678},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LinWHWL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/LaiLCB16,
author = {I{-}Wei Lai and
Chia{-}Han Lee and
Kwang{-}Cheng Chen and
Ezio Biglieri},
title = {Open-Loop End-to-End Transmission for Multihop Opportunistic Networks
With Energy-Harvesting Devices},
journal = {{IEEE} Trans. Commun.},
volume = {64},
number = {7},
pages = {2860--2872},
year = {2016},
url = {https://doi.org/10.1109/TCOMM.2016.2574858},
doi = {10.1109/TCOMM.2016.2574858},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcom/LaiLCB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/ZhengHTHL16,
author = {Liang Zheng and
Y.{-}W. Peter Hong and
Chee Wei Tan and
Cheng{-}Lin Hsieh and
Chia{-}Han Lee},
title = {Wireless Max-Min Utility Fairness With General Monotonic Constraints
by Perron-Frobenius Theory},
journal = {{IEEE} Trans. Inf. Theory},
volume = {62},
number = {12},
pages = {7283--7298},
year = {2016},
url = {https://doi.org/10.1109/TIT.2016.2615183},
doi = {10.1109/TIT.2016.2615183},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tit/ZhengHTHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vlsisp/LeeTYCH16,
author = {Gwo Giun Lee and
Tzu{-}Chiang Tai and
Wei{-}Chiao Yang and
Chun{-}Fu Chen and
Chun{-}Hsi Huang},
title = {Reconfigurable Interpolation Architecture for Multistandard Video
Decoding},
journal = {J. Signal Process. Syst.},
volume = {84},
number = {2},
pages = {251--264},
year = {2016},
url = {https://doi.org/10.1007/s11265-015-1053-x},
doi = {10.1007/S11265-015-1053-X},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/vlsisp/LeeTYCH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/3dic/LiangCLLYC16,
author = {Hao{-}Wen Liang and
Hsiu{-}Chi Chen and
Chien{-}Hung Lin and
Chia{-}Lin Lee and
Shan{-}Chun Yang and
Kuan{-}Neng Chen},
title = {The influence of device morphology on wafer-level bonding with polymer-coated
layer},
booktitle = {2016 {IEEE} International 3D Systems Integration Conference, 3DIC
2016, San Francisco, CA, USA, November 8-11, 2016},
pages = {1--4},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/3DIC.2016.7970009},
doi = {10.1109/3DIC.2016.7970009},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/3dic/LiangCLLYC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/LinLCCL16,
author = {Chia{-}Lung Lin and
Rong{-}Jie Liu and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 7.72 Gb/s {LDPC-CC} decoder with overlapped architecture for pre-5G
wireless communications},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2016, Toyama,
Japan, November 7-9, 2016},
pages = {337--340},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ASSCC.2016.7844204},
doi = {10.1109/ASSCC.2016.7844204},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/asscc/LinLCCL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/HoLTLL16,
author = {Yu{-}Lung Ho and
Wei{-}Yang Lin and
Chia{-}Ling Tsai and
Cheng{-}Chia Lee and
Chih{-}Yang Lin},
title = {Automatic Brain Extraction for T1-Weighted Magnetic Resonance Images
Using Region Growing},
booktitle = {16th {IEEE} International Conference on Bioinformatics and Bioengineering,
{BIBE} 2016, Taichung, Taiwan, October 31 - November 2, 2016},
pages = {250--253},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/BIBE.2016.42},
doi = {10.1109/BIBE.2016.42},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibe/HoLTLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biocas/LinLCHC16,
author = {Yu{-}Shan Lin and
Sheng{-}Cheng Lee and
Yu{-}Jui Chen and
Chia{-}Ming Huang and
Herming Chiueh},
title = {Live demonstration: {A} wireless multi-channel physiological signal
acquisition system-on-chip for wearable devices},
booktitle = {{IEEE} Biomedical Circuits and Systems Conference, BioCAS 2016, Shanghai,
China, October 17-19, 2016},
pages = {128},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BioCAS.2016.7833742},
doi = {10.1109/BIOCAS.2016.7833742},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/biocas/LinLCHC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/LeeCGCC16,
author = {Tzu{-}I Lee and
Yih{-}Harn Chiang and
Jiayi Guo and
Mu{-}Tsz Chen and
Yue Chen},
editor = {Jofish Kaye and
Allison Druin and
Cliff Lampe and
Dan Morris and
Juan Pablo Hourcade},
title = {Dot-it: Managing Nausea and Vomiting for {A} Peaceful Pregnancy with
Personal Pattern Exploration},
booktitle = {Proceedings of the 2016 {CHI} Conference on Human Factors in Computing
Systems, San Jose, CA, USA, May 7-12, 2016, Extended Abstracts},
pages = {20--25},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2851581.2890631},
doi = {10.1145/2851581.2890631},
timestamp = {Wed, 01 Jun 2022 08:38:38 +0200},
biburl = {https://dblp.org/rec/conf/chi/LeeCGCC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cocoon/ChenCHHLW16,
author = {Li{-}Hsuan Chen and
Dun{-}Wei Cheng and
Sun{-}Yuan Hsieh and
Ling{-}Ju Hung and
Chia{-}Wei Lee and
Bang Ye Wu},
editor = {Thang N. Dinh and
My T. Thai},
title = {Approximation Algorithms for the Star k-Hub Center Problem in Metric
Graphs},
booktitle = {Computing and Combinatorics - 22nd International Conference, {COCOON}
2016, Ho Chi Minh City, Vietnam, August 2-4, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9797},
pages = {222--234},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-42634-1\_18},
doi = {10.1007/978-3-319-42634-1\_18},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cocoon/ChenCHHLW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ddecs/HuangCXLHC16,
author = {Hong{-}Yi Huang and
Kun{-}Yuan Chen and
Jia{-}Hao Xie and
Ming{-}Ta Lee and
Hao{-}Chiao Hong and
Kuo{-}Hsing Cheng},
title = {Gm-C filter with automatic calibration scheme},
booktitle = {2016 {IEEE} 19th International Symposium on Design and Diagnostics
of Electronic Circuits {\&} Systems (DDECS), Kosice, Slovakia,
April 20-22, 2016},
pages = {206--209},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/DDECS.2016.7482471},
doi = {10.1109/DDECS.2016.7482471},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/ddecs/HuangCXLHC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/glvlsi/HungFCCLL16,
author = {Yu{-}Hsiang Hung and
Sheng{-}Hsin Fang and
Hung{-}Ming Chen and
Shen{-}Min Chen and
Chang{-}Tzu Lin and
Chia{-}Hsin Lee},
editor = {Ayse K. Coskun and
Martin Margala and
Laleh Behjat and
Jie Han},
title = {A New Methodology for Noise Sensor Placement Based on Association
Rule Mining},
booktitle = {Proceedings of the 26th edition on Great Lakes Symposium on VLSI,
{GLVLSI} 2016, Boston, MA, USA, May 18-20, 2016},
pages = {81--86},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2902961.2902973},
doi = {10.1145/2902961.2902973},
timestamp = {Wed, 10 Mar 2021 14:55:38 +0100},
biburl = {https://dblp.org/rec/conf/glvlsi/HungFCCLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/i2mtc/ChiuCLHC16,
author = {Po{-}Kai Chiu and
Donyau Chiang and
Chao{-}Te Lee and
Chien{-}Nan Hsiao and
Fong{-}Zhi Chen},
title = {Relative reflectivity uncertainty evaluation for a broadband spectrophotometer
system},
booktitle = {{IEEE} International Instrumentation and Measurement Technology Conference,
{I2MTC} 2016, Proceedings, Taipei, Taiwan, May 23-26, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/I2MTC.2016.7520515},
doi = {10.1109/I2MTC.2016.7520515},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/i2mtc/ChiuCLHC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iasam/LinTC16,
author = {Ray{-}Lee Lin and
Chia{-}Hao Tsai and
Nian{-}Ci Chen},
title = {Design and implementation of ferroresonant transformer for {LED} driver
systems},
booktitle = {2016 {IEEE} Industry Applications Society Annual Meeting, Portland,
OR, USA, October 2-6, 2016},
pages = {1--9},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IAS.2016.7731891},
doi = {10.1109/IAS.2016.7731891},
timestamp = {Tue, 06 Jul 2021 18:52:58 +0200},
biburl = {https://dblp.org/rec/conf/iasam/LinTC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/KaoLHLKS16,
author = {Wen{-}Chung Kao and
Chun{-}Yi Lin and
Chen{-}Chien J. Hsu and
Chia{-}Yi Lee and
Bai{-}Yueh Ke and
Ting{-}Yi Su},
title = {Optimal iris region matching and gaze point calibration for real-time
eye tracking systems},
booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2016,
Las Vegas, NV, USA, January 7-11, 2016},
pages = {443--444},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICCE.2016.7430684},
doi = {10.1109/ICCE.2016.7430684},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iccel/KaoLHLKS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icebe/MaLFLH16,
author = {Shang{-}Pin Ma and
Chi{-}Chia Li and
Chen{-}Yuan Fan and
Wen{-}Tin Lee and
Nien{-}Lin Hsueh},
editor = {Jingzhi Guo and
Hongming Cai and
Xiang Fei and
Kuo{-}Ming Chao and
Jen{-}Yao Chung},
title = {{MASA:} {A} Cross-Platform Component Architecture for Building Mobile
Applications with Service Caching},
booktitle = {13th {IEEE} International Conference on e-Business Engineering, {ICEBE}
2016, Macau, China, November 4-6, 2016},
pages = {264--269},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/ICEBE.2016.052},
doi = {10.1109/ICEBE.2016.052},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icebe/MaLFLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LeeH16,
author = {Chia{-}Chen Lee and
Wen{-}Liang Hwang},
title = {Sparse representation of a blur kernel for out-of-focus blind image
restoration},
booktitle = {2016 {IEEE} International Conference on Image Processing, {ICIP} 2016,
Phoenix, AZ, USA, September 25-28, 2016},
pages = {2698--2702},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICIP.2016.7532849},
doi = {10.1109/ICIP.2016.7532849},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/LeeH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/YangLYSCC16,
author = {Jen{-}An Yang and
Chia{-}Han Lee and
Shao{-}Wen Yang and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen and
Shao{-}Yi Chien},
title = {Wearable social camera: Egocentric video summarization for social
interaction},
booktitle = {2016 {IEEE} International Conference on Multimedia {\&} Expo Workshops,
{ICME} Workshops 2016, Seattle, WA, USA, July 11-15, 2016},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/ICMEW.2016.7574681},
doi = {10.1109/ICMEW.2016.7574681},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmcs/YangLYSCC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeesensors/ChiaPL16,
author = {Liping Sharon Chia and
Suresh Palale and
Pooi See Lee},
title = {Thickness-dependent sensitivity of Copper Phthalocyanine chemiresistive
Nitrogen Dioxide sensors},
booktitle = {2016 {IEEE} SENSORS, Orlando, FL, USA, October 30 - November 3, 2016},
pages = {1--3},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICSENS.2016.7808405},
doi = {10.1109/ICSENS.2016.7808405},
timestamp = {Wed, 28 Dec 2022 14:09:32 +0100},
biburl = {https://dblp.org/rec/conf/ieeesensors/ChiaPL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/LeeH16,
author = {Chia{-}Chen Lee and
Shu{-}Kai Hsieh},
editor = {Amy Isard and
Verena Rieser and
Dimitra Gkatzia},
title = {Evaluative Pattern Extraction for Automated Text Generation},
booktitle = {{INLG} 2016 - Proceedings of the Ninth International Natural Language
Generation Conference, September 5-8, 2016, Edinburgh, {UK}},
pages = {99--103},
publisher = {The Association for Computer Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/w16-6617},
doi = {10.18653/V1/W16-6617},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/LeeH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipsn/LinLSLL16,
author = {Tzu{-}Ting Lin and
Chun{-}Ju Lin and
Chia{-}Min Su and
Yi{-}Chun Lin and
Huang{-}Chen Lee},
title = {Poster Abstract: Exploiting Temporal Variation of Received Radio Signal
Strength for Indoor Human Tracking},
booktitle = {15th {ACM/IEEE} International Conference on Information Processing
in Sensor Networks, {IPSN} 2016, Vienna, Austria, April 11-14, 2016},
pages = {50:1--50:2},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IPSN.2016.7460703},
doi = {10.1109/IPSN.2016.7460703},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipsn/LinLSLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/LeeCYL16,
author = {Yen{-}Chi Lee and
Chiun{-}Chuan Chen and
Ping{-}Cheng Yeh and
Chia{-}Han Lee},
title = {Distribution of first arrival position in molecular communication},
booktitle = {{IEEE} International Symposium on Information Theory, {ISIT} 2016,
Barcelona, Spain, July 10-15, 2016},
pages = {1033--1037},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ISIT.2016.7541456},
doi = {10.1109/ISIT.2016.7541456},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/isit/LeeCYL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nana/LeeCCCL16,
author = {Ru{-}Hung Lee and
An{-}Yi Chen and
Chih{-}Chung Chiang and
Yu{-}Shan Athena Chen and
Chun{-}Hung Liu},
title = {A Preliminary Design and Implementation of Location-Based Mobile Advertising
Schemes with Plot Placement Animation over a Cyber-Physical System},
booktitle = {International Conference on Networking and Network Applications, NaNA
2016, Hakodate City, Hokkaido, Japan, July 23-25, 2016},
pages = {196--201},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/NaNA.2016.89},
doi = {10.1109/NANA.2016.89},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nana/LeeCCCL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/ChiuCLHWC16,
author = {Po{-}Kai Chiu and
Donyau Chiang and
Chao{-}Te Lee and
Chien{-}Nan Hsiao and
Zheng{-}Han Wu and
Chien{-}Yue Chen},
title = {Development of high-performance parallel exposure I-line {UV} light
source},
booktitle = {11th {IEEE} Annual International Conference on Nano/Micro Engineered
and Molecular Systems, {NEMS} 2016, Sendai, Japan, April 17-20, 2016},
pages = {396--400},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/NEMS.2016.7758276},
doi = {10.1109/NEMS.2016.7758276},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nems/ChiuCLHWC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/LeeLKH16,
author = {Chia{-}Yi Lee and
Kin Fong Lei and
Cheng{-}Lung Ku and
Chia{-}Hao Huang},
title = {Development of bionic invasion membrane for the study of multiple
sclerosis},
booktitle = {11th {IEEE} Annual International Conference on Nano/Micro Engineered
and Molecular Systems, {NEMS} 2016, Sendai, Japan, April 17-20, 2016},
pages = {370--374},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/NEMS.2016.7758270},
doi = {10.1109/NEMS.2016.7758270},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nems/LeeLKH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ntcir/DayTCLCSTCHCTLL16,
author = {Min{-}Yuh Day and
Cheng{-}Chia Tsai and
Wei{-}Chun Chuang and
Jin{-}Kun Lin and
Hsiu{-}Yuan Chang and
Tzu{-}Jui Sun and
Yuan{-}Jie Tsai and
Yi{-}Heng Chiang and
Cheng{-}Zhi Han and
Wei{-}Ming Chen and
Yun{-}Da Tsai and
Yi{-}Jing Lin and
Yue{-}Da Lin and
Yu{-}Ming Guo and
Ching{-}Yuan Chien and
Cheng{-}Hung Lee},
editor = {Noriko Kando and
Tetsuya Sakai and
Mark Sanderson},
title = {{IMTKU} Question Answering System for World History Exams at {NTCIR-12}
{QA} Lab2},
booktitle = {Proceedings of the 12th {NTCIR} Conference on Evaluation of Information
Access Technologies, National Center of Sciences, Tokyo, Japan, June
7-10, 2016},
publisher = {National Institute of Informatics {(NII)}},
year = {2016},
url = {http://research.nii.ac.jp/ntcir/workshop/OnlineProceedings12/pdf/ntcir/QALAB/05-NTCIR12-QALAB-DayM.pdf},
timestamp = {Wed, 01 Jun 2022 17:01:01 +0200},
biburl = {https://dblp.org/rec/conf/ntcir/DayTCLCSTCHCTLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rocling/HuangWLLLH16,
author = {Tzu{-}Yun Huang and
Hsiao{-}Han Wu and
Chia{-}Chen Lee and
Shao{-}Man Lee and
Guan{-}Wei Li and
Shu{-}Kai Hsieh},
editor = {Chung{-}Hsien Wu and
Yuen{-}Hsien Tseng and
Hung{-}Yu Kao and
Lun{-}Wei Ku and
Yu Tsao and
Shih{-}Hung Wu},
title = {Crowdsourcing Experiment Designs for Chinese Word Sense Annotation},
booktitle = {Proceedings of the 28th Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2016, National Cheng Kung University,
Tainan, Taiwan, October 6-7, 2015},
publisher = {Association for Computational Linguistics and Chinese Language Processing
(ACLCLP), Taiwan},
year = {2016},
url = {https://aclanthology.org/O16-1009/},
timestamp = {Tue, 30 Jul 2024 08:36:43 +0200},
biburl = {https://dblp.org/rec/conf/rocling/HuangWLLLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/YenYMCLCL16,
author = {Shao{-}Wei Yen and
Chih{-}Kuo Yeh and
Charles C. Morace and
Sheng{-}Yuan Chen and
Shih{-}Syun Lin and
Chia{-}Hsiang Chen and
Tong{-}Yee Lee},
editor = {Johannes Kopf and
Phillip Chi{-}Wing Fu},
title = {Content enhanced word art with depth perception},
booktitle = {{SIGGRAPH} {ASIA} 2016, Macao, December 5-8, 2016 - Posters},
pages = {51},
publisher = {{ACM}},
year = {2016},
url = {http://dl.acm.org/citation.cfm?id=3005280},
timestamp = {Mon, 03 Jul 2023 17:35:02 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/YenYMCLCL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/LeeWCL16,
author = {Kuan{-}Ru Lee and
Chao{-}Cheng Wu and
Yung{-}Hsiao Chiang and
Jiannher Lin},
title = {Evaluation of band generation process for classification of cerebrospinal
fluid in magnetic resonance images},
booktitle = {2016 {IEEE} International Conference on Systems, Man, and Cybernetics,
{SMC} 2016, Budapest, Hungary, October 9-12, 2016},
pages = {4305--4310},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/SMC.2016.7844908},
doi = {10.1109/SMC.2016.7844908},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/smc/LeeWCL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tale/WangCKTCCCLLC16,
author = {Yen{-}Yin Wang and
Yu{-}Chun Cheng and
Chieh{-}Ju Kuo and
I{-}Chang Tsai and
Min{-}Tsuei Chen and
Chin{-}Yu Chou and
Yung{-}Hsuan Chen and
Jinn{-}Bao Lee and
John Laio and
Chia{-}Heng Chen},
title = {Equal learning rights for the new generation - a study on the innovation
of interactive live webcasting by the Small School Alliance},
booktitle = {{IEEE} International Conference on Teaching, Assessment, and Learning
for Engineering, {TALE} 2016, Bangkok, Thailand, December 7-9, 2016},
pages = {70--76},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/TALE.2016.7851773},
doi = {10.1109/TALE.2016.7851773},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/tale/WangCKTCCCLLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/ChenHHLHLCH16,
author = {Yang{-}Sheng Chen and
Ping{-}Hsuan Han and
Jui{-}Chun Hsiao and
Kong{-}Chang Lee and
Chiao{-}En Hsieh and
Kuan{-}Yin Lu and
Chien{-}Hsing Chou and
Yi{-}Ping Hung},
editor = {Jun Rekimoto and
Takeo Igarashi and
Jacob O. Wobbrock and
Daniel Avrahami},
title = {SoEs: Attachable Augmented Haptic on Gaming Controller for Immersive
Interaction},
booktitle = {Proceedings of the 29th Annual Symposium on User Interface Software
and Technology, {UIST} 2016 Adjunct Volume, Tokyo, Japan, October
16 - 19, 2016},
pages = {71--72},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2984751.2985707},
doi = {10.1145/2984751.2985707},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uist/ChenHHLHLCH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/TsaiLLYLHCKLC16,
author = {Chih{-}Ying Tsai and
Kao{-}Chi Lee and
Chien{-}Hsueh Lin and
Sung{-}Chu Yu and
Wen{-}Rong Liau and
Alex Chun{-}Liang Hou and
Ying{-}Yen Chen and
Chun{-}Yi Kuo and
Jih{-}Nung Lee and
Mango C.{-}T. Chao},
title = {Predicting Vt mean and variance from parallel Id measurement with
model-fitting technique},
booktitle = {34th {IEEE} {VLSI} Test Symposium, {VTS} 2016, Las Vegas, NV, USA,
April 25-27, 2016},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/VTS.2016.7477268},
doi = {10.1109/VTS.2016.7477268},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vts/TsaiLLYLHCKLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/LiuMLQC16,
author = {Chen{-}Feng Liu and
Marco Maso and
Chia{-}Han Lee and
Tony Q. S. Quek and
Leonardo S. Cardoso},
title = {Enhancing full-duplex information transfer by {RF} energy harvesting},
booktitle = {{IEEE} Wireless Communications and Networking Conference Workshops,
{WCNC} Workshops 2016, Doha, Qatar, April 3-6, 2016},
pages = {333--339},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/WCNCW.2016.7552721},
doi = {10.1109/WCNCW.2016.7552721},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wcnc/LiuMLQC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/LiuMLQC16a,
author = {Chen{-}Feng Liu and
Marco Maso and
Chia{-}Han Lee and
Tony Q. S. Quek and
Leonardo S. Cardoso},
title = {Enhancing full-duplex information transfer by {RF} energy harvesting},
booktitle = {{IEEE} Wireless Communications and Networking Conference, {WCNC} 2016,
Doha, Qatar, April 3-6, 2016},
pages = {1--7},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/WCNC.2016.7564692},
doi = {10.1109/WCNC.2016.7564692},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wcnc/LiuMLQC16a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wisnet/ChangWJCFL16,
author = {Yen Chih Chang and
Chia{-}Chun Wang and
Wen{-}De Jian and
Chia{-}Chan Chang and
Guo{-}Hua Feng and
Huang{-}Chen Lee},
title = {Wireless sensors for intelligent ball screws monitoring},
booktitle = {{IEEE} Topical Conference on Wireless Sensors and Sensor Networks,
WiSNet 2016, Austin, TX, USA, January 24-27, 2016},
pages = {44--47},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/WISNET.2016.7444318},
doi = {10.1109/WISNET.2016.7444318},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/wisnet/ChangWJCFL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ChungTLLLL16,
author = {Cheng{-}Tao Chung and
Cheng{-}Yu Tsai and
Hsiang{-}Hung Lu and
Chia{-}Hsiang Liu and
Hung{-}yi Lee and
Lin{-}Shan Lee},
title = {An Iterative Deep Learning Framework for Unsupervised Discovery of
Speech Features and Linguistic Units with Applications on Spoken Term
Detection},
journal = {CoRR},
volume = {abs/1602.00426},
year = {2016},
url = {http://arxiv.org/abs/1602.00426},
eprinttype = {arXiv},
eprint = {1602.00426},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ChungTLLLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LeeWYWWCCWY16,
author = {Chang{-}Shing Lee and
Mei{-}Hui Wang and
Shi{-}Jim Yen and
Ting{-}Han Wei and
I{-}Chen Wu and
Ping{-}Chiang Chou and
Chun{-}Hsun Chou and
Ming{-}Wan Wang and
Tai{-}Hsiung Yang},
title = {Human vs. Computer Go: Review and Prospect},
journal = {CoRR},
volume = {abs/1606.02032},
year = {2016},
url = {http://arxiv.org/abs/1606.02032},
eprinttype = {arXiv},
eprint = {1606.02032},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/LeeWYWWCCWY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiuMLLQ16,
author = {Chen{-}Feng Liu and
Marco Maso and
Subhash Lakshminarayana and
Chia{-}Han Lee and
Tony Q. S. Quek},
title = {Simultaneous Wireless Information and Power Transfer Under Different
{CSI} Acquisition Schemes},
journal = {CoRR},
volume = {abs/1605.05639},
year = {2016},
url = {http://arxiv.org/abs/1605.05639},
eprinttype = {arXiv},
eprint = {1605.05639},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/LiuMLLQ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MasoLLQC16,
author = {Marco Maso and
Chen{-}Feng Liu and
Chia{-}Han Lee and
Tony Q. S. Quek and
Leonardo S. Cardoso},
title = {Energy-Recycling Full-Duplex Radios for Next-Generation Networks},
journal = {CoRR},
volume = {abs/1605.05633},
year = {2016},
url = {http://arxiv.org/abs/1605.05633},
eprinttype = {arXiv},
eprint = {1605.05633},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MasoLLQC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/WangLCYS15,
author = {Wei Wang and
Chia{-}Han Lee and
Lin Chen and
F. Richard Yu and
Hsuan{-}Jung Su},
title = {{IEEE} Access Special Section Editorial: Emerging Cloud-Based Wireless
Communications and Networks},
journal = {{IEEE} Access},
volume = {3},
pages = {3122--3124},
year = {2015},
url = {https://doi.org/10.1109/ACCESS.2016.2517298},
doi = {10.1109/ACCESS.2016.2517298},
timestamp = {Wed, 15 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/WangLCYS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/alr/KoL15,
author = {Chia{-}Nan Ko and
Cheng{-}Ming Lee},
title = {Image recognition using adaptive fuzzy neural network based on lifting
scheme of wavelet},
journal = {Artif. Life Robotics},
volume = {20},
number = {4},
pages = {353--358},
year = {2015},
url = {https://doi.org/10.1007/s10015-015-0242-9},
doi = {10.1007/S10015-015-0242-9},
timestamp = {Thu, 26 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/alr/KoL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/LiLCC15,
author = {I{-}Hsum Li and
Lian{-}Wang Lee and
Hsin{-}Han Chiang and
Pin{-}Cheng Chen},
title = {Intelligent switching adaptive control for uncertain nonlinear dynamical
systems},
journal = {Appl. Soft Comput.},
volume = {34},
pages = {638--654},
year = {2015},
url = {https://doi.org/10.1016/j.asoc.2015.04.057},
doi = {10.1016/J.ASOC.2015.04.057},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asc/LiLCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbsn/ChangCCMLCP15,
author = {Fong{-}Ching Chang and
Chiung{-}Hui Chiu and
Ping{-}Hung Chen and
Nae{-}Fang Miao and
Ching{-}Mei Lee and
Jengtung Chiang and
Ying{-}Chun Pan},
title = {Relationship Between Parental and Adolescent eHealth Literacy and
Online Health Information Seeking in Taiwan},
journal = {Cyberpsychology Behav. Soc. Netw.},
volume = {18},
number = {10},
pages = {618--624},
year = {2015},
url = {https://doi.org/10.1089/cyber.2015.0110},
doi = {10.1089/CYBER.2015.0110},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbsn/ChangCCMLCP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/ChangWLWLLCLLHW15,
author = {Hsin{-}Yi Chang and
Chia{-}Yu Wang and
Ming{-}Hsien Lee and
Hsin{-}Kai Wu and
Jyh{-}Chong Liang and
Silvia Wen{-}Yu Lee and
Guo{-}Li Chiou and
Hao{-}Chang Lo and
Jing{-}Wen Lin and
Chung{-}Yuan Hsu and
Ying{-}Tien Wu and
Sufen Chen and
Fu{-}Kwun Hwang and
Chin{-}Chung Tsai},
title = {A review of features of technology-supported learning environments
based on participants' perceptions},
journal = {Comput. Hum. Behav.},
volume = {53},
pages = {223--237},
year = {2015},
url = {https://doi.org/10.1016/j.chb.2015.06.042},
doi = {10.1016/J.CHB.2015.06.042},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/ChangWLWLLCLLHW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/HaoHCLINHYLLHLJ15,
author = {Wen{-}Rui Hao and
Yi{-}Hsin Elsa Hsu and
Kuan{-}Chen Chen and
Hsien{-}Chang Li and
Usman Iqbal and
Phung Anh Nguyen and
Chih{-}Wei Huang and
Hsuan{-}Chia Yang and
Peisan Lee and
Mei{-}Hsuan Li and
Sharoon Lungile Hlatshwayo and
Yu{-}Chuan (Jack) Li and
Wen{-}Shan Jian},
title = {LabPush: {A} pilot study of providing remote clinics with laboratory
results via short message service {(SMS)} in Swaziland, Africa - {A}
qualitative study},
journal = {Comput. Methods Programs Biomed.},
volume = {118},
number = {1},
pages = {77--83},
year = {2015},
url = {https://doi.org/10.1016/j.cmpb.2014.10.005},
doi = {10.1016/J.CMPB.2014.10.005},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/HaoHCLINHYLLHLJ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dam/LeeCH15,
author = {Chia{-}Wei Lee and
Pin{-}Liang Chen and
Sun{-}Yuan Hsieh},
title = {Weight-constrained and density-constrained paths in a tree: Enumerating,
counting, and k-maximum density paths},
journal = {Discret. Appl. Math.},
volume = {180},
pages = {126--134},
year = {2015},
url = {https://doi.org/10.1016/j.dam.2014.07.024},
doi = {10.1016/J.DAM.2014.07.024},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dam/LeeCH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/es/ChenL15,
author = {Yi{-}Chung Chen and
Chiang Lee},
title = {Neural skyline filter for accelerating skyline search algorithms},
journal = {Expert Syst. J. Knowl. Eng.},
volume = {32},
number = {1},
pages = {108--131},
year = {2015},
url = {https://doi.org/10.1111/exsy.12065},
doi = {10.1111/EXSY.12065},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/es/ChenL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icga/WeiWLCTYL15,
author = {Ting{-}Han Wei and
I{-}Chen Wu and
Chao{-}Chin Liang and
Bing{-}Tsung Chiang and
Wen{-}Jie Tseng and
Shi{-}Jim Yen and
Chang{-}Shing Lee},
title = {Job-Level Algorithms for Connect6 Opening Book Construction},
journal = {J. Int. Comput. Games Assoc.},
volume = {38},
number = {3},
pages = {165--179},
year = {2015},
url = {https://doi.org/10.3233/ICG-2015-38304},
doi = {10.3233/ICG-2015-38304},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/icga/WeiWLCTYL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/ChenLL15,
author = {Pao{-}Lung Chen and
Da{-}Chen Lee and
Wei{-}Chia Li},
title = {Flying-Adder Frequency Synthesizer with a Novel Counter-Based Randomization
Method},
journal = {{IEICE} Trans. Electron.},
volume = {98-C},
number = {6},
pages = {480--488},
year = {2015},
url = {https://doi.org/10.1587/transele.E98.C.480},
doi = {10.1587/TRANSELE.E98.C.480},
timestamp = {Sat, 11 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/ChenLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsn/LeeMJCL15,
author = {Chia{-}Yen Lee and
Ardeshir Mahdavi and
Joe{-}Air Jiang and
Mark Ming{-}Cheng Cheng and
Che{-}Hsin Lin},
title = {Sensors and Sensor Networks in Agriculture, Architecture, and Civil
Engineering},
journal = {Int. J. Distributed Sens. Networks},
volume = {11},
pages = {839167:1},
year = {2015},
url = {https://doi.org/10.1155/2015/839167},
doi = {10.1155/2015/839167},
timestamp = {Wed, 25 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijdsn/LeeMJCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijnsec/LeeCPL15,
author = {Chin{-}Feng Lee and
Chin{-}Chen Chang and
Pei{-}Yan Pai and
Chia{-}Ming Liu},
title = {Adjustment Hiding Method Based on Exploiting Modification Direction},
journal = {Int. J. Netw. Secur.},
volume = {17},
number = {5},
pages = {607--618},
year = {2015},
url = {http://ijns.jalaxy.com.tw/contents/ijns-v17-n5/ijns-2015-v17-n5-p607-618.pdf},
timestamp = {Mon, 04 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijnsec/LeeCPL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsysc/LeeHPLCC15,
author = {Lun{-}Hui Lee and
Pei{-}Hsiang Huang and
Shing{-}Tai Pan and
Handra Wijaya Lie and
Tung{-}Chien Chiang and
Cheng{-}Yuan Chang},
title = {Applying vision feedback to crane controller design},
journal = {Int. J. Syst. Sci.},
volume = {46},
number = {2},
pages = {294--302},
year = {2015},
url = {https://doi.org/10.1080/00207721.2013.779762},
doi = {10.1080/00207721.2013.779762},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsysc/LeeHPLCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/ChenL15a,
author = {Yi{-}Chung Chen and
Chiang Lee},
title = {The {\(\sigma\)}-neighborhood skyline queries},
journal = {Inf. Sci.},
volume = {322},
pages = {92--114},
year = {2015},
url = {https://doi.org/10.1016/j.ins.2015.06.015},
doi = {10.1016/J.INS.2015.06.015},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/ChenL15a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jda/WeiHLP15,
author = {Chia{-}Chen Wei and
Sun{-}Yuan Hsieh and
Chia{-}Wei Lee and
Sheng{-}Lung Peng},
title = {An improved approximation algorithm for the partial-terminal Steiner
tree problem with edge cost 1 or 2},
journal = {J. Discrete Algorithms},
volume = {35},
pages = {62--71},
year = {2015},
url = {https://doi.org/10.1016/j.jda.2015.10.003},
doi = {10.1016/J.JDA.2015.10.003},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jda/WeiHLP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/LeeCHL15,
author = {Ju{-}Hong Lee and
Chia{-}Ching Chao and
Chia{-}Cheng Huang and
Wen{-}Chen Lo},
title = {Adaptive cyclostationary array beamforming with robust capabilities},
journal = {J. Frankl. Inst.},
volume = {352},
number = {6},
pages = {2486--2503},
year = {2015},
url = {https://doi.org/10.1016/j.jfranklin.2015.03.029},
doi = {10.1016/J.JFRANKLIN.2015.03.029},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfi/LeeCHL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jihmsp/Lee0PL15,
author = {Chin{-}Feng Lee and
Chin{-}Chen Chang and
Pei{-}Yan Pai and
Chia{-}Ming Liu},
title = {An Adjustable and Reversible Data Hiding Method Based on Multiple-base
Notational System without Location Map},
journal = {J. Inf. Hiding Multim. Signal Process.},
volume = {6},
number = {1},
pages = {1--28},
year = {2015},
url = {http://bit.kuas.edu.tw/\&\#126;jihmsp/2015/vol6/JIH-MSP-2015-01-001.pdf},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jihmsp/Lee0PL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/HuangTWCLW15,
author = {Shou{-}Hung Huang and
Nai{-}Chia Teng and
Kung{-}Jeng Wang and
Kun{-}Huang Chen and
Hsin{-}Chien Lee and
Pa{-}Chun Wang},
title = {Use of Oximetry as a Screening Tool for Obstructive Sleep Apnea: a
Case Study in Taiwan},
journal = {J. Medical Syst.},
volume = {39},
number = {3},
pages = {29},
year = {2015},
url = {https://doi.org/10.1007/s10916-015-0195-5},
doi = {10.1007/S10916-015-0195-5},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/HuangTWCLW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/LaiZLT15,
author = {I{-}Wei Lai and
Liang Zheng and
Chia{-}Han Lee and
Chee Wei Tan},
title = {Beamforming Duality and Algorithms for Weighted Sum Rate Maximization
in Cognitive Radio Networks},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {33},
number = {5},
pages = {832--847},
year = {2015},
url = {https://doi.org/10.1109/JSAC.2014.2361079},
doi = {10.1109/JSAC.2014.2361079},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/LaiZLT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/MasoLLQC15,
author = {Marco Maso and
Chen{-}Feng Liu and
Chia{-}Han Lee and
Tony Q. S. Quek and
Leonardo S. Cardoso},
title = {Energy-Recycling Full-Duplex Radios for Next-Generation Networks},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {33},
number = {12},
pages = {2948--2962},
year = {2015},
url = {https://doi.org/10.1109/JSAC.2015.2482058},
doi = {10.1109/JSAC.2015.2482058},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/MasoLLQC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChiangJHWCL15,
author = {Ping{-}Chuan Chiang and
Jhih{-}Yu Jiang and
Hao{-}Wei Hung and
Chin{-}Yang Wu and
Gaun{-}Sing Chen and
Jri Lee},
title = {4{\texttimes}25 Gb/s Transceiver With Optical Front-end for 100 GbE
System in 65 nm {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {50},
number = {2},
pages = {573--585},
year = {2015},
url = {https://doi.org/10.1109/JSSC.2014.2365700},
doi = {10.1109/JSSC.2014.2365700},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChiangJHWCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeCPCW15,
author = {Jri Lee and
Ping{-}Chuan Chiang and
Pen{-}Jui Peng and
Li{-}Yang Chen and
Chih{-}Chi Weng},
title = {Design of 56 Gb/s {NRZ} and {PAM4} SerDes Transceivers in {CMOS} Technologies},
journal = {{IEEE} J. Solid State Circuits},
volume = {50},
number = {9},
pages = {2061--2073},
year = {2015},
url = {https://doi.org/10.1109/JSSC.2015.2433269},
doi = {10.1109/JSSC.2015.2433269},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LeeCPCW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jstsp/OuLSCC15,
author = {Shun{-}Hsing Ou and
Chia{-}Han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen and
Shao{-}Yi Chien},
title = {On-Line Multi-View Video Summarization for Wireless Video Sensor Network},
journal = {{IEEE} J. Sel. Top. Signal Process.},
volume = {9},
number = {1},
pages = {165--179},
year = {2015},
url = {https://doi.org/10.1109/JSTSP.2014.2331916},
doi = {10.1109/JSTSP.2014.2331916},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jstsp/OuLSCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/ChangLHHC15,
author = {Tao{-}Chih Chang and
Chang{-}Chun Lee and
Chia{-}Ping Hsieh and
Sheng{-}Che Hung and
Ren{-}Shin Cheng},
title = {Electrical characteristics and reliability performance of {IGBT} power
device packaging by chip embedding technology},
journal = {Microelectron. Reliab.},
volume = {55},
number = {12},
pages = {2582--2588},
year = {2015},
url = {https://doi.org/10.1016/j.microrel.2015.10.004},
doi = {10.1016/J.MICROREL.2015.10.004},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/ChangLHHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BidelmanL15,
author = {Gavin M. Bidelman and
Chia{-}Cheng Lee},
title = {Effects of language experience and stimulus context on the neural
organization and categorical perception of speech},
journal = {NeuroImage},
volume = {120},
pages = {191--200},
year = {2015},
url = {https://doi.org/10.1016/j.neuroimage.2015.06.087},
doi = {10.1016/J.NEUROIMAGE.2015.06.087},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BidelmanL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scn/LinLLHL15,
author = {Ying{-}Dar Lin and
Yuan{-}Cheng Lai and
Chun{-}Nan Lu and
Peng{-}Kai Hsu and
Chia{-}Yin Lee},
title = {Three-phase behavior-based detection and classification of known and
unknown malware},
journal = {Secur. Commun. Networks},
volume = {8},
number = {11},
pages = {2004--2015},
year = {2015},
url = {https://doi.org/10.1002/sec.1148},
doi = {10.1002/SEC.1148},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scn/LinLLHL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/GongLHLLCTYLC15,
author = {Cihun{-}Siyong Alex Gong and
Hsin{-}Yi Lai and
Sy{-}Han Huang and
Yu{-}Chun Lo and
Nicole Lee and
Pin{-}Yuan Chen and
Po{-}Hsun Tu and
Chia{-}Yen Yang and
James Chang{-}Chieh Lin and
You{-}Yin Chen},
title = {A Programmable High-Voltage Compliance Neural Stimulator for Deep
Brain Stimulation \emph{in Vivo}},
journal = {Sensors},
volume = {15},
number = {6},
pages = {12700--12719},
year = {2015},
url = {https://doi.org/10.3390/s150612700},
doi = {10.3390/S150612700},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/GongLHLLCTYLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LeeCCL15,
author = {Xin{-}Ru Lee and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 7.92 Gb/s 437.2 mW Stochastic {LDPC} Decoder Chip for {IEEE} 802.15.3c
Applications},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {62-I},
number = {2},
pages = {507--516},
year = {2015},
url = {https://doi.org/10.1109/TCSI.2014.2360331},
doi = {10.1109/TCSI.2014.2360331},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LeeCCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LeeYCCL15,
author = {Xin{-}Ru Lee and
Chih{-}Wen Yang and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {An Area-Efficient Relaxed Half-Stochastic Decoding Architecture for
Nonbinary {LDPC} Codes},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {62-II},
number = {3},
pages = {301--305},
year = {2015},
url = {https://doi.org/10.1109/TCSII.2014.2368616},
doi = {10.1109/TCSII.2014.2368616},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LeeYCCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LinCCL15,
author = {Chia{-}Lung Lin and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {Jointly Designed Nonbinary {LDPC} Convolutional Codes and Memory-Based
Decoder Architecture},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {62-I},
number = {10},
pages = {2523--2532},
year = {2015},
url = {https://doi.org/10.1109/TCSI.2015.2471575},
doi = {10.1109/TCSI.2015.2471575},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LinCCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/WangCHHLLCHS15,
author = {Chua{-}Chin Wang and
Chih{-}Lin Chen and
Zong{-}You Hou and
Yi Hu and
Jam{-}Wem Lee and
Wan{-}Yen Lin and
Yi{-}Feng Chang and
Chia{-}Wei Hsu and
Ming{-}Hsiang Song},
title = {A 60 {V} Tolerance Transceiver With {ESD} Protection for FlexRay-Based
Communication Systems},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {62-I},
number = {3},
pages = {752--760},
year = {2015},
url = {https://doi.org/10.1109/TCSI.2014.2370192},
doi = {10.1109/TCSI.2014.2370192},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/WangCHHLLCHS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmbmc/LinLLY15,
author = {Yang{-}Kai Lin and
Wei{-}An Lin and
Chia{-}Han Lee and
Ping{-}Cheng Yeh},
title = {Asynchronous Threshold-Based Detection for Quantity-Type-Modulated
Molecular Communication Systems},
journal = {{IEEE} Trans. Mol. Biol. Multi Scale Commun.},
volume = {1},
number = {1},
pages = {37--49},
year = {2015},
url = {https://doi.org/10.1109/TMBMC.2015.2465520},
doi = {10.1109/TMBMC.2015.2465520},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmbmc/LinLLY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/YehTLL15,
author = {Chia{-}Hung Yeh and
Tsung{-}Yih Tseng and
Cheng{-}Wei Lee and
Chih{-}Yang Lin},
title = {Predictive Texture Synthesis-Based Intra Coding Scheme for Advanced
Video Coding},
journal = {{IEEE} Trans. Multim.},
volume = {17},
number = {9},
pages = {1508--1514},
year = {2015},
url = {https://doi.org/10.1109/TMM.2015.2449659},
doi = {10.1109/TMM.2015.2449659},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmm/YehTLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/ChungWFLCL15,
author = {Szu{-}Chi Chung and
Jing{-}Yu Wu and
Hsing{-}Ping Fu and
Jen{-}Wei Lee and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {Efficient Hardware Architecture of {\(\eta\)}\({}_{\mbox{T}}\) Pairing
Accelerator Over Characteristic Three},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {23},
number = {1},
pages = {88--97},
year = {2015},
url = {https://doi.org/10.1109/TVLSI.2014.2303489},
doi = {10.1109/TVLSI.2014.2303489},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvlsi/ChungWFLCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/YangLCL15,
author = {Chi{-}Heng Yang and
Yi{-}Min Lin and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {An MPCN-Based {BCH} Codec Architecture With Arbitrary Error Correcting
Capability},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {23},
number = {7},
pages = {1235--1244},
year = {2015},
url = {https://doi.org/10.1109/TVLSI.2014.2338309},
doi = {10.1109/TVLSI.2014.2338309},
timestamp = {Wed, 11 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/YangLCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/LaiLCB15,
author = {I{-}Wei Lai and
Chia{-}Han Lee and
Kwang{-}Cheng Chen and
Ezio Biglieri},
title = {Path-Permutation Codes for End-to-End Transmission in Ad Hoc Cognitive
Radio Networks},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {14},
number = {6},
pages = {3309--3321},
year = {2015},
url = {https://doi.org/10.1109/TWC.2015.2403848},
doi = {10.1109/TWC.2015.2403848},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/twc/LaiLCB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/LiuMLLQ15,
author = {Chen{-}Feng Liu and
Marco Maso and
Subhash Lakshminarayana and
Chia{-}Han Lee and
Tony Q. S. Quek},
title = {Simultaneous Wireless Information and Power Transfer Under Different
{CSI} Acquisition Schemes},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {14},
number = {4},
pages = {1911--1926},
year = {2015},
url = {https://doi.org/10.1109/TWC.2014.2376953},
doi = {10.1109/TWC.2014.2376953},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/twc/LiuMLLQ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/3dic/TsaiLLYC15,
author = {Tsung{-}Yen Tsai and
Chien{-}Hung Lin and
Chia{-}Lin Lee and
Shan{-}Chun Yang and
Kuan{-}Neng Chen},
title = {An ultra-fast temporary bonding and release process based on thin
photolysis polymer in 3D integration},
booktitle = {2015 International 3D Systems Integration Conference, 3DIC 2015, Sendai,
Japan, August 31 - September 2, 2015},
pages = {TS8.8.1--TS8.8.5},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/3DIC.2015.7334613},
doi = {10.1109/3DIC.2015.7334613},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/3dic/TsaiLLYC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apnoms/HuangLFHH15,
author = {Yi{-}Ying Huang and
Meng{-}Wei Lee and
Tao{-}Ya Fan{-}Chiang and
Xin Huang and
Cheng{-}Hsin Hsu},
title = {Minimizing flow initialization latency in Software Defined Networks},
booktitle = {17th Asia-Pacific Network Operations and Management Symposium, {APNOMS}
2015, Busan, South Korea, August 19-21, 2015},
pages = {303--308},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/APNOMS.2015.7275444},
doi = {10.1109/APNOMS.2015.7275444},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/apnoms/HuangLFHH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ase-bigdata/HsiehLMLKD15,
author = {Chih{-}Hung Hsieh and
Kuo{-}Chen Lee and
Ching{-}Hao Mao and
Chia{-}Min Lai and
Chiun{-}How Kao and
Jyun{-}Han Dai},
title = {Sec-Buzzers: a Web Service for Exploring Cyber Security Emerging Topics
based on Social Network Mining},
booktitle = {Proceedings of the {ASE} BigData {\&} SocialInformatics 2015,
{ASE} BD{\&}SI 2015, Kaohsiung, Taiwan, October 7-9, 2015},
pages = {27:1--27:6},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2818869.2818897},
doi = {10.1145/2818869.2818897},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ase-bigdata/HsiehLMLKD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aspdac/ChangLLHCKCTKCL15,
author = {Meng{-}Fan Chang and
Albert Lee and
Chien{-}Chen Lin and
Mon{-}Shu Ho and
Ping{-}Cheng Chen and
Chia{-}Chen Kuo and
Ming{-}Pin Chen and
Pei{-}Ling Tseng and
Tzu{-}Kun Ku and
Chien{-}Fu Chen and
Kai{-}Shin Li and
Jia{-}Min Shieh},
title = {Read circuits for resistive memory (ReRAM) and memristor-based nonvolatile
Logics},
booktitle = {The 20th Asia and South Pacific Design Automation Conference, {ASP-DAC}
2015, Chiba, Japan, January 19-22, 2015},
pages = {569--574},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ASPDAC.2015.7059068},
doi = {10.1109/ASPDAC.2015.7059068},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aspdac/ChangLLHCKCTKCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aspdac/ChienCTLSC15,
author = {Shao{-}Yi Chien and
Wei{-}Kai Chan and
Yu{-}Hsiang Tseng and
Chia{-}Han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen},
title = {Distributed computing in IoT: System-on-a-chip for smart cameras as
an example},
booktitle = {The 20th Asia and South Pacific Design Automation Conference, {ASP-DAC}
2015, Chiba, Japan, January 19-22, 2015},
pages = {130--135},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ASPDAC.2015.7058993},
doi = {10.1109/ASPDAC.2015.7058993},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aspdac/ChienCTLSC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asru/ChungTLLLL15,
author = {Cheng{-}Tao Chung and
Cheng{-}Yu Tsai and
Hsiang{-}Hung Lu and
Chia{-}Hsiang Liu and
Hung{-}yi Lee and
Lin{-}Shan Lee},
title = {An iterative deep learning framework for unsupervised discovery of
speech features and linguistic units with applications on spoken term
detection},
booktitle = {2015 {IEEE} Workshop on Automatic Speech Recognition and Understanding,
{ASRU} 2015, Scottsdale, AZ, USA, December 13-17, 2015},
pages = {245--251},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ASRU.2015.7404801},
doi = {10.1109/ASRU.2015.7404801},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/asru/ChungTLLLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/LaiSLHKYWLCL15,
author = {Kelvin Yi{-}Tse Lai and
Ming{-}Feng Shiu and
Yi{-}Wen Lu and
Yingchieh Ho and
Yu{-}Chi Kao and
Yu{-}Tao Yang and
Gary Wang and
Keng{-}Ming Liu and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A field-programmable lab-on-a-chip with built-in self-test circuit
and low-power sensor-fusion solution in 0.35{\(\mu\)}m standard {CMOS}
process},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2015, Xia'men,
China, November 9-11, 2015},
pages = {1--4},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ASSCC.2015.7387477},
doi = {10.1109/ASSCC.2015.7387477},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/asscc/LaiSLHKYWLCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chinasip/LeeFC15,
author = {Yi{-}Chiao Lee and
Wen{-}Hsien Fang and
Yie{-}Tarng Chen},
title = {Improved {HISS} technique for multidimensional harmonic retrieval
problems},
booktitle = {{IEEE} China Summit and International Conference on Signal and Information
Processing, ChinaSIP 2015, Chengdu, China, July 12-15, 2015},
pages = {109--112},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ChinaSIP.2015.7230372},
doi = {10.1109/CHINASIP.2015.7230372},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/chinasip/LeeFC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/LeeYCCL15,
author = {Xin{-}Ru Lee and
Chih{-}Wen Yang and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
editor = {Wolfgang Pribyl and
Franz Dielacher and
Gernot Hueber},
title = {A 1.31Gb/s, 96.6{\%} utilization stochastic nonbinary {LDPC} decoder
for small cell applications},
booktitle = {{ESSCIRC} Conference 2015 - 41\({}^{\mbox{st}}\) European Solid-State
Circuits Conference, Graz, Austria, September 14-18, 2015},
pages = {96--99},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ESSCIRC.2015.7313837},
doi = {10.1109/ESSCIRC.2015.7313837},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/LeeYCCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/ChenLC15,
author = {Wei{-}Ren Chen and
Chuan{-}Ren Lee and
Jui{-}Chiu Chiang},
title = {Scene-aware high dynamic range imaging},
booktitle = {23rd European Signal Processing Conference, {EUSIPCO} 2015, Nice,
France, August 31 - September 4, 2015},
pages = {609--613},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/EUSIPCO.2015.7362455},
doi = {10.1109/EUSIPCO.2015.7362455},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/ChenLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/LiuMLQC15,
author = {Chen{-}Feng Liu and
Marco Maso and
Chia{-}Han Lee and
Tony Q. S. Quek and
Leonardo S. Cardoso},
title = {A Novel Approach to Self-Interference Cancellation for Energy-Saving
Full-Duplex Systems},
booktitle = {2015 {IEEE} Globecom Workshops, San Diego, CA, USA, December 6-10,
2015},
pages = {1--7},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/GLOCOMW.2015.7414058},
doi = {10.1109/GLOCOMW.2015.7414058},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/LiuMLQC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/LiaoLLLC15,
author = {Keng{-}Te Liao and
Chia{-}Han Lee and
Tzu{-}Ming Lin and
Chien{-}Min Lee and
Wen{-}Tsuen Chen},
title = {Non-orthogonal direct access for small data transmission in cellular
{MTC} networks},
booktitle = {2015 {IEEE} International Conference on Communications, {ICC} 2015,
London, United Kingdom, June 8-12, 2015},
pages = {2264--2270},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICC.2015.7248662},
doi = {10.1109/ICC.2015.7248662},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/icc/LiaoLLLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/LeeLCLW15,
author = {Yuan{-}Shan Lee and
Rocky Lo and
Chia{-}Yen Chen and
Po{-}Chuan Lin and
Jia{-}Ching Wang},
title = {News topics categorization using latent Dirichlet allocation and sparse
representation classifier},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2015, Taipei, Taiwan, June 6-8, 2015},
pages = {136--137},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICCE-TW.2015.7216819},
doi = {10.1109/ICCE-TW.2015.7216819},
timestamp = {Fri, 26 Nov 2021 09:37:33 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/LeeLCLW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/OuLSCC15,
author = {Shun{-}Hsing Ou and
Chia{-}Han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen and
Shao{-}Yi Chien},
title = {Video sensor node with distributed video summary for Internet-of-Things
applications},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2015, Taipei, Taiwan, June 6-8, 2015},
pages = {304--305},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICCE-TW.2015.7216912},
doi = {10.1109/ICCE-TW.2015.7216912},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/OuLSCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccst/HsiehLMKL15,
author = {Chih{-}Hung Hsieh and
Chia{-}Min Lai and
Ching{-}Hao Mao and
Tien{-}Cheu Kao and
Kuo{-}Chen Lee},
title = {{AD2:} Anomaly detection on active directory log data for insider
threat monitoring},
booktitle = {International Carnahan Conference on Security Technology, {ICCST}
2015, Taipei, Taiwan, September 21-24, 2015},
pages = {287--292},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/CCST.2015.7389698},
doi = {10.1109/CCST.2015.7389698},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iccst/HsiehLMKL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icgec/YuanLF15,
author = {Shyan{-}Ming Yuan and
Chiou{-}Yng Lee and
Chia{-}Chen Fan},
editor = {Thi Thi Zin and
Jerry Chun{-}Wei Lin and
Jeng{-}Shyang Pan and
Pyke Tin and
Mitsuhiro Yokota},
title = {Efficient Digit-Serial Multiplier Employing Karatsuba Algorithm},
booktitle = {Genetic and Evolutionary Computing - Proceedings of the Ninth International
Conference on Genetic and Evolutionary Computing, {ICGEC} 2015, August
26-28, 2015, Yangon, Myanmar - Volume {II}},
series = {Advances in Intelligent Systems and Computing},
volume = {388},
pages = {221--231},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-23207-2\_22},
doi = {10.1007/978-3-319-23207-2\_22},
timestamp = {Tue, 07 Apr 2020 12:12:38 +0200},
biburl = {https://dblp.org/rec/conf/icgec/YuanLF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/HsiehTHCCL15,
author = {Sun{-}Yuan Hsieh and
I{-}Pien Tsai and
Hao{-}Che Hung and
Yi{-}Chun Chen and
Hsin{-}Hung Chou and
Chia{-}Wei Lee},
editor = {De{-}Shuang Huang and
Kang{-}Hyun Jo and
Abir Jaafar Hussain},
title = {An Enhanced Algorithm for Reconstructing a Phylogenetic Tree Based
on the Tree Rearrangement and Maximum Likelihood Method},
booktitle = {Intelligent Computing Theories and Methodologies - 11th International
Conference, {ICIC} 2015, Fuzhou, China, August 20-23, 2015, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9226},
pages = {530--541},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-22186-1\_53},
doi = {10.1007/978-3-319-22186-1\_53},
timestamp = {Sat, 19 Oct 2019 20:26:13 +0200},
biburl = {https://dblp.org/rec/conf/icic/HsiehTHCCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/ChouLCCL15,
author = {Chien{-}Li Chou and
Chin{-}Hsien Lin and
Tzu{-}Hsuan Chiang and
Hua{-}Tsung Chen and
Suh{-}Yin Lee},
title = {Coherent event-based surveillance video synopsis using trajectory
clustering},
booktitle = {2015 {IEEE} International Conference on Multimedia {\&} Expo Workshops,
{ICME} Workshops 2015, Turin, Italy, June 29 - July 3, 2015},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/ICMEW.2015.7169855},
doi = {10.1109/ICMEW.2015.7169855},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmcs/ChouLCCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/ChangWL15,
author = {Chia{-}Yang Chang and
Cheng{-}Ru Wang and
Shie{-}Jue Lee},
title = {Novel imputation for time series data},
booktitle = {2015 International Conference on Machine Learning and Cybernetics,
{ICMLC} 2015, Guangzhou, China, July 12-15, 2015},
pages = {916--920},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICMLC.2015.7340675},
doi = {10.1109/ICMLC.2015.7340675},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/icmlc/ChangWL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsse/JhengLCHL15,
author = {Chen{-}Wei Jheng and
Chih{-}Wen Li and
Chen{-}Chia Chuang and
Chih{-}Ching Hsiao and
Tsu{-}Tian Lee},
editor = {Hamido Fujita and
Shun{-}Feng Su},
title = {iOS based Forward Collision Warning System},
booktitle = {New Trends on System Sciences and Engineering - Proceedings of {ICSSE}
2015 [International Conference on System Science and Engineering,
Morioka, Japan, July 6-8 2015]},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {276},
pages = {47--54},
publisher = {{IOS} Press},
year = {2015},
url = {https://doi.org/10.3233/978-1-61499-522-7-47},
doi = {10.3233/978-1-61499-522-7-47},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsse/JhengLCHL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsse/YouHLCL15,
author = {Chang{-}Min You and
Fu{-}Cheng Hung and
Lian{-}Wang Lee and
Hsin{-}Han Chiang and
Yi{-}Jie Lin},
editor = {Hamido Fujita and
Shun{-}Feng Su},
title = {Design and Implementation of a Haar Wavelet Series-based Adaptive
Sliding-Mode Controller for Pneumatic Actuator Systems},
booktitle = {New Trends on System Sciences and Engineering - Proceedings of {ICSSE}
2015 [International Conference on System Science and Engineering,
Morioka, Japan, July 6-8 2015]},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {276},
pages = {470--484},
publisher = {{IOS} Press},
year = {2015},
url = {https://doi.org/10.3233/978-1-61499-522-7-470},
doi = {10.3233/978-1-61499-522-7-470},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsse/YouHLCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictir/ChenLC15,
author = {Ruey{-}Cheng Chen and
Chia{-}Jung Lee and
W. Bruce Croft},
editor = {James Allan and
W. Bruce Croft and
Arjen P. de Vries and
Chengxiang Zhai},
title = {On Divergence Measures and Static Index Pruning},
booktitle = {Proceedings of the 2015 International Conference on The Theory of
Information Retrieval, {ICTIR} 2015, Northampton, Massachusetts, USA,
September 27-30, 2015},
pages = {151--160},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2808194.2809472},
doi = {10.1145/2808194.2809472},
timestamp = {Tue, 06 Nov 2018 11:07:20 +0100},
biburl = {https://dblp.org/rec/conf/ictir/ChenLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/HoCLCL15,
author = {Kin{-}Chu Ho and
Chih{-}Lung Chen and
Yen{-}Chin Liao and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 3.46 Gb/s (9141, 8224) LDPC-based {ECC} scheme and on-line channel
estimation for solid-state drive applications},
booktitle = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2015, Lisbon, Portugal, May 24-27, 2015},
pages = {1450--1453},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISCAS.2015.7168917},
doi = {10.1109/ISCAS.2015.7168917},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/HoCLCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/YangLLC15,
author = {Richard Hsin{-}Hsyong Yang and
Ming{-}Tsai Lee and
Chia{-}Kun Lee and
Shiunn{-}Jang Chern},
title = {Low complexity receiver for continuous phase modulation using 3RC-TL
phase shaping pulses},
booktitle = {2015 International Symposium on Intelligent Signal Processing and
Communication Systems, {ISPACS} 2015, Nusa Dua Bali, Indonesia, November
9-12, 2015},
pages = {608--613},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISPACS.2015.7432844},
doi = {10.1109/ISPACS.2015.7432844},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/YangLLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChangLLKYTCSTLK15,
author = {Meng{-}Fan Chang and
Chien{-}Chen Lin and
Albert Lee and
Chia{-}Chen Kuo and
Geng{-}Hau Yang and
Hsiang{-}Jen Tsai and
Tien{-}Fu Chen and
Shyh{-}Shyuan Sheu and
Pei{-}Ling Tseng and
Heng{-}Yuan Lee and
Tzu{-}Kun Ku},
title = {17.5 {A} 3T1R nonvolatile {TCAM} using {MLC} ReRAM with Sub-1ns search
time},
booktitle = {2015 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2015, Digest of Technical Papers, San Francisco, CA, USA, February
22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISSCC.2015.7063054},
doi = {10.1109/ISSCC.2015.7063054},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChangLLKYTCSTLK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/JuLLCCWWLHCLCLC15,
author = {Chi{-}Cheng Ju and
Tsu{-}Ming Liu and
Kun{-}Bin Lee and
Yung{-}Chang Chang and
Han{-}Liang Chou and
Chih{-}Ming Wang and
Tung{-}Hsing Wu and
Hue{-}Min Lin and
Yi{-}Hsin Huang and
Chia{-}Yun Cheng and
Ting{-}An Lin and
Chun{-}Chia Chen and
Yu{-}Kun Lin and
Min{-}Hao Chiu and
Wei{-}Cing Li and
Sheng{-}Jen Wang and
Yen{-}Chieh Lai and
Ping Chao and
Chih{-}Da Chien and
Meng{-}Jye Hu and
Peng{-}Hao Wang and
Fu{-}Chun Yeh and
Yen{-}Chao Huang and
Shun{-}Hsiang Chuang and
Lien{-}Fei Chen and
Hsiu{-}Yi Lin and
Ming{-}Long Wu and
Che{-}Hong Chen and
Ryan Chen and
H. Y. Hsu and
Kevin Jou},
title = {18.6 {A} 0.5nJ/pixel 4K {H.265/HEVC} codec {LSI} for multi-format
smartphone applications},
booktitle = {2015 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2015, Digest of Technical Papers, San Francisco, CA, USA, February
22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISSCC.2015.7063063},
doi = {10.1109/ISSCC.2015.7063063},
timestamp = {Thu, 20 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/JuLLCCWWLHCLCLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/misnc/LiaoCL15,
author = {Heng{-}Ching Liao and
Yi{-}Chung Chen and
Chiang Lee},
editor = {Leon S. L. Wang and
Shiro Uesugi and
I{-}Hsien Ting and
Koji Okuhara and
Kai Wang},
title = {Multiple Days Trip Recommendation Based on Check-in Data},
booktitle = {Multidisciplinary Social Networks Research - Second International
Conference, {MISNC} 2015, Matsuyama, Japan, September 1-3, 2015. Proceedings},
series = {Communications in Computer and Information Science},
volume = {540},
pages = {316--330},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-662-48319-0\_25},
doi = {10.1007/978-3-662-48319-0\_25},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/misnc/LiaoCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ococosda/KungLWCC15,
author = {Fu{-}Ja Kung and
Pa{-}Hwa Lee and
Yih{-}Ru Wang and
Sin{-}Horng Chen and
Chen{-}Yu Chiang},
title = {On finding word-level break-type formation rules for mandarin read
speech},
booktitle = {2015 International Conference Oriental {COCOSDA} held jointly with
2015 Conference on Asian Spoken Language Research and Evaluation (O-COCOSDA/CASLRE),
Shanghai, China, October 28-30, 2015},
pages = {53--57},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICSDA.2015.7357864},
doi = {10.1109/ICSDA.2015.7357864},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/ococosda/KungLWCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pimrc/ChaoLWWC15,
author = {Cheng{-}Chih Chao and
Chia{-}Han Lee and
Hung{-}Yu Wei and
Chih{-}Yu Wang and
Wen{-}Tsuen Chen},
title = {Distributed dynamic-TDD resource allocation in femtocell networks
using evolutionary game},
booktitle = {26th {IEEE} Annual International Symposium on Personal, Indoor, and
Mobile Radio Communications, {PIMRC} 2015, Hong Kong, China, August
30 - September 2, 2015},
pages = {1157--1162},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/PIMRC.2015.7343473},
doi = {10.1109/PIMRC.2015.7343473},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/pimrc/ChaoLWWC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/ChiuLRYLC15,
author = {Chun{-}Chia Chiu and
Yi{-}Hsiang Lo and
Wei{-}Ting Ruan and
Cheng{-}Han Yang and
Ruen{-}Rone Lee and
Hung{-}Kuo Chu},
title = {Continuous circular scribble arts},
booktitle = {Special Interest Group on Computer Graphics and Interactive Techniques
Conference, {SIGGRAPH} '15, Los Angeles, CA, USA, August 9-13, 2015,
Posters Proceedings},
pages = {1:1},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2787626.2792600},
doi = {10.1145/2787626.2792600},
timestamp = {Fri, 12 Mar 2021 10:46:10 +0100},
biburl = {https://dblp.org/rec/conf/siggraph/ChiuLRYLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sips/HungLYSCC15,
author = {Pei{-}Hen Hung and
Chia{-}Han Lee and
Shao{-}Wen Yang and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen and
Shao{-}Yi Chien},
title = {Bridge deep learning to the physical world: An efficient method to
quantize network},
booktitle = {2015 {IEEE} Workshop on Signal Processing Systems, SiPS 2015, Hangzhou,
China, October 14-16, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/SiPS.2015.7345005},
doi = {10.1109/SIPS.2015.7345005},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sips/HungLYSCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sips/SheikhALXCVST15,
author = {Farhana Sheikh and
Oskar Andersson and
Ching{-}En Lee and
Feng Xue and
Chia{-}Hsiang Chen and
Anuja Vaidya and
Ankit Sharma and
Tom Tetzlaff},
title = {Reconf{\i}gurable and selectively-adaptive signal processing for multi-mode
wireless communication},
booktitle = {2015 {IEEE} Workshop on Signal Processing Systems, SiPS 2015, Hangzhou,
China, October 14-16, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/SiPS.2015.7344987},
doi = {10.1109/SIPS.2015.7344987},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sips/SheikhALXCVST15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/JanACCCDHIJKSKK15,
author = {Chia{-}Hong Jan and
F. Al{-}amoody and
H.{-}Y. Chang and
T. Chang and
Y.{-}W. Chen and
N. Dias and
Walid M. Hafez and
Doug B. Ingerly and
M. Jang and
Eric Karl and
S. K.{-}Y. Shi and
K. Komeyli and
H. Kilambi and
A. Kumar and
K. Byon and
C.{-}G. Lee and
J. Lee and
T. Leo and
P.{-}C. Liu and
N. Nidhi and
R. Olac{-}vaw and
C. Petersburg and
K. Phoa and
Chetan Prasad and
C. Quincy and
R. Ramaswamy and
T. Rana and
L. Rockford and
Aravinth Subramaniam and
C. Tsai and
Peter Vandervoorn and
L. Yang and
A. Zainuddin and
Peng Bai},
title = {A 14 nm SoC platform technology featuring 2\({}^{\mbox{nd}}\) generation
Tri-Gate transistors, 70 nm gate pitch, 52 nm metal pitch, and 0.0499
um\({}^{\mbox{2}}\) {SRAM} cells, optimized for low power, high performance
and high density SoC products},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {12},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231380},
doi = {10.1109/VLSIC.2015.7231380},
timestamp = {Thu, 02 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsic/JanACCCDHIJKSKK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/LeeCLCHKTSK15,
author = {Albert Lee and
Meng{-}Fan Chang and
Chien{-}Chen Lin and
Chien{-}Fu Chen and
Mon{-}Shu Ho and
Chia{-}Chen Kuo and
Pei{-}Ling Tseng and
Shyh{-}Shyuan Sheu and
Tzu{-}Kun Ku},
title = {RRAM-based 7T1R nonvolatile {SRAM} with 2x reduction in store energy
and 94x reduction in restore energy for frequent-off instant-on applications},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {76},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231368},
doi = {10.1109/VLSIC.2015.7231368},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/LeeCLCHKTSK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/LuoCSWSLLLLLCSK15,
author = {Pei{-}Wen Luo and
Chi{-}Kang Chen and
Yu{-}Hui Sung and
Wei Wu and
Hsiu{-}Chuan Shih and
Chia{-}Hsin Lee and
Kuo{-}Hua Lee and
Ming{-}Wei Li and
Mei{-}Chiang Lung and
Chun{-}Nan Lu and
Yung{-}Fa Chou and
Po{-}Lin Shih and
Chung{-}Hu Ke and
Chun Shiah and
Patrick Stolt and
Shigeki Tomishima and
Ding{-}Ming Kwai and
Bor{-}Doou Rong and
Nicky Lu and
Shih{-}Lien Lu and
Cheng{-}Wen Wu},
title = {A computer designed half Gb 16-channel 819Gb/s high-bandwidth and
10ns low-latency {DRAM} for 3D stacked memory devices using TSVs},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {186},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231256},
doi = {10.1109/VLSIC.2015.7231256},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/LuoCSWSLLLLLCSK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LeeH15c,
author = {Chia{-}Chen Lee and
Wen{-}Liang Hwang},
title = {Sparse Representation of a Blur Kernel for Blind Image Restoration},
journal = {CoRR},
volume = {abs/1512.04418},
year = {2015},
url = {http://arxiv.org/abs/1512.04418},
eprinttype = {arXiv},
eprint = {1512.04418},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/LeeH15c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/ChangCHSCL14,
author = {Kuo{-}En Chang and
Chia{-}Tzu Chang and
Huei{-}Tse Hou and
Yao{-}Ting Sung and
Huei{-}Lin Chao and
Cheng{-}Ming Lee},
title = {Development and behavioral pattern analysis of a mobile guide system
with augmented reality for painting appreciation instruction in an
art museum},
journal = {Comput. Educ.},
volume = {71},
pages = {185--197},
year = {2014},
url = {https://doi.org/10.1016/j.compedu.2013.09.022},
doi = {10.1016/J.COMPEDU.2013.09.022},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ce/ChangCHSCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/ChenHL14,
author = {Kuei{-}Hao Chen and
Guan{-}Shieng Huang and
Richard Chia{-}Tung Lee},
title = {Bit-Parallel Algorithms for Exact Circular String Matching},
journal = {Comput. J.},
volume = {57},
number = {5},
pages = {731--743},
year = {2014},
url = {https://doi.org/10.1093/comjnl/bxt023},
doi = {10.1093/COMJNL/BXT023},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/ChenHL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/ChouHCWCL14,
author = {Chia{-}Yu Chou and
Boe{-}Shong Hong and
Pei{-}Ju Chiang and
Wen{-}Teng Wang and
Liang{-}Kuang Chen and
Chia{-}Yen Lee},
title = {Distributed Control of Heat Conduction in Thermal Inductive Materials
with 2D Geometrical Isomorphism},
journal = {Entropy},
volume = {16},
number = {9},
pages = {4937--4959},
year = {2014},
url = {https://doi.org/10.3390/e16094937},
doi = {10.3390/E16094937},
timestamp = {Tue, 14 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/ChouHCWCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ets/WangWLHCWCCLLLT14,
author = {Chia{-}Yu Wang and
Hsin{-}Kai Wu and
Silvia Wen{-}Yu Lee and
Fu{-}Kwun Hwang and
Hsin{-}Yi Chang and
Ying{-}Tien Wu and
Guo{-}Li Chiou and
Sufen Chen and
Jyh{-}Chong Liang and
Jing{-}Wen Lin and
Hao{-}Chang Lo and
Chin{-}Chung Tsai},
title = {A Review of Research on Technology-Assisted School Science Laboratories},
journal = {J. Educ. Technol. Soc.},
volume = {17},
number = {2},
pages = {307--320},
year = {2014},
url = {http://www.ifets.info/download\_pdf.php?j\_id=63\&a\_id=1481},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ets/WangWLHCWCCLLLT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmc/KuoLCS14,
author = {Che{-}Nan Kuo and
Chia{-}Wei Lee and
Nai{-}Wen Chang and
Kuang{-}Husn Shih},
title = {Extended fault-tolerant bipanconnectivity and panconnectivity of folded
hypercubes},
journal = {Int. J. Mob. Commun.},
volume = {12},
number = {4},
pages = {397--410},
year = {2014},
url = {https://doi.org/10.1504/IJMC.2014.063655},
doi = {10.1504/IJMC.2014.063655},
timestamp = {Mon, 29 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmc/KuoLCS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/WeiLCCY14,
author = {Chih{-}Ping Wei and
Yen{-}Hsien Lee and
Yu{-}Sheng Chiang and
Chun{-}Ta Chen and
Christopher C. Yang},
title = {Exploiting temporal characteristics of features for effectively discovering
event episodes from news corpora},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {65},
number = {3},
pages = {621--634},
year = {2014},
url = {https://doi.org/10.1002/asi.22995},
doi = {10.1002/ASI.22995},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/WeiLCCY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/ChenLSLO14,
author = {Yuan{-}Ho Chen and
Chih{-}Wen Lu and
Shian{-}Shing Shyu and
Chung{-}Lin Lee and
Ting{-}Chia Ou},
title = {A Multi-stage Fault-Tolerant Multiplier with Triple Module Redundancy
{(TMR)} Technique},
journal = {J. Circuits Syst. Comput.},
volume = {23},
number = {5},
year = {2014},
url = {https://doi.org/10.1142/S0218126614500741},
doi = {10.1142/S0218126614500741},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcsc/ChenLSLO14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/ChouCCCFGLLSSTWWY14,
author = {Cheng{-}Wei Chou and
Ping{-}Chiang Chou and
Jean{-}Joseph Christophe and
Adrien Cou{\"{e}}toux and
Pierre de Freminville and
Nicolas Galichet and
Chang{-}Shing Lee and
Jialin Liu and
David Lupien Saint{-}Pierre and
Mich{\`{e}}le Sebag and
Olivier Teytaud and
Mei{-}Hui Wang and
Li{-}Wen Wu and
Shi{-}Jim Yen},
title = {Strategic Choices in Optimization},
journal = {J. Inf. Sci. Eng.},
volume = {30},
number = {3},
pages = {727--747},
year = {2014},
url = {http://www.iis.sinica.edu.tw/page/jise/2014/201405\_10.html},
timestamp = {Fri, 16 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/ChouCCCFGLLSSTWWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmm2/ChiangWL14,
author = {Cheng{-}Chieh Chiang and
Kai{-}Ming Wang and
Greg C. Lee},
title = {Multi-Pose Face Detection and Tracking Using Condensation},
journal = {J. Multim.},
volume = {9},
number = {10},
pages = {1135--1141},
year = {2014},
url = {https://doi.org/10.4304/jmm.9.10.1135-1141},
doi = {10.4304/JMM.9.10.1135-1141},
timestamp = {Fri, 18 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmm2/ChiangWL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ker/ChenWLCC14,
author = {Chi{-}Yuan Chen and
Tin{-}Yu Wu and
Wei{-}Tsong Lee and
Han{-}Chieh Chao and
Jen{-}Chun Chiang},
title = {QoS-based active dropping mechanism for {NGN} video streaming optimization},
journal = {Knowl. Eng. Rev.},
volume = {29},
number = {4},
pages = {484--495},
year = {2014},
url = {https://doi.org/10.1017/S0269888914000186},
doi = {10.1017/S0269888914000186},
timestamp = {Thu, 27 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ker/ChenWLCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ors/LeeC14,
author = {Chia{-}Yen Lee and
Chen{-}Fu Chien},
title = {Stochastic programming for vendor portfolio selection and order allocation
under delivery uncertainty},
journal = {{OR} Spectr.},
volume = {36},
number = {3},
pages = {761--797},
year = {2014},
url = {https://doi.org/10.1007/s00291-013-0342-7},
doi = {10.1007/S00291-013-0342-7},
timestamp = {Tue, 04 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ors/LeeC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/LeeCXSA14,
author = {Shihyan Lee and
Kwo{-}Fu Chiang and
Xiaoxiong Xiong and
Chengbo Sun and
Samuel Anderson},
title = {The {S-NPP} {VIIRS} Day-Night Band On-Orbit Calibration/Characterization
and Current State of {SDR} Products},
journal = {Remote. Sens.},
volume = {6},
number = {12},
pages = {12427--12446},
year = {2014},
url = {https://doi.org/10.3390/rs61212427},
doi = {10.3390/RS61212427},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/LeeCXSA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/YenTCPCL14,
author = {Li{-}Chen Yen and
Ming{-}Tsyr Tang and
Fang{-}Yu Chang and
Tung{-}Ming Pan and
Tien{-}Sheng Chao and
Chiang{-}Hsuan Lee},
title = {Improvement in pH Sensitivity of Low-Temperature Polycrystalline-Silicon
Thin-Film Transistor Sensors Using H\({}_{\mbox{2}}\) Sintering},
journal = {Sensors},
volume = {14},
number = {3},
pages = {3825--3832},
year = {2014},
url = {https://doi.org/10.3390/s140303825},
doi = {10.3390/S140303825},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/YenTCPCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sj/ChiangCWL14,
author = {Hsin{-}Han Chiang and
Yen{-}Lin Chen and
Bing{-}Fei Wu and
Tsu{-}Tian Lee},
title = {Embedded Driver-Assistance System Using Multiple Sensors for Safe
Overtaking Maneuver},
journal = {{IEEE} Syst. J.},
volume = {8},
number = {3},
pages = {681--698},
year = {2014},
url = {https://doi.org/10.1109/JSYST.2012.2212636},
doi = {10.1109/JSYST.2012.2212636},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sj/ChiangCWL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ChenHWL14,
author = {Chia{-}Ping Chen and
Yi{-}Chin Huang and
Chung{-}Hsien Wu and
Kuan{-}De Lee},
title = {Polyglot Speech Synthesis Based on Cross-Lingual Frame Selection Using
Auditory and Articulatory Features},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {22},
number = {10},
pages = {1558--1570},
year = {2014},
url = {https://doi.org/10.1109/TASLP.2014.2339738},
doi = {10.1109/TASLP.2014.2339738},
timestamp = {Thu, 25 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/ChenHWL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/ChengYLYU14,
author = {Chung{-}Chao Cheng and
Jeng{-}Da Yang and
Huang{-}Chang Lee and
Chia{-}Hsiang Yang and
Yeong{-}Luh Ueng},
title = {A Fully Parallel {LDPC} Decoder Architecture Using Probabilistic Min-Sum
Algorithm for High-Throughput Applications},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {61-I},
number = {9},
pages = {2738--2746},
year = {2014},
url = {https://doi.org/10.1109/TCSI.2014.2312479},
doi = {10.1109/TCSI.2014.2312479},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/ChengYLYU14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LinHCL14,
author = {Yi{-}Min Lin and
Chih{-}Hsiang Hsu and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 2.56 Gb/s Soft {RS} (255, 239) Decoder Chip for Optical Communication
Systems},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {61-I},
number = {7},
pages = {2110--2118},
year = {2014},
url = {https://doi.org/10.1109/TCSI.2014.2298282},
doi = {10.1109/TCSI.2014.2298282},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LinHCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/LeeCCL14,
author = {Jen{-}Wei Lee and
Szu{-}Chi Chung and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {Efficient Power-Analysis-Resistant Dual-Field Elliptic Curve Cryptographic
Processor Using Heterogeneous Dual-Processing-Element Architecture},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {22},
number = {1},
pages = {49--61},
year = {2014},
url = {https://doi.org/10.1109/TVLSI.2013.2237930},
doi = {10.1109/TVLSI.2013.2237930},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvlsi/LeeCCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/LuoCTGFCCTIL14,
author = {Tseng{-}Chin Luo and
Mango Chia{-}Tso Chao and
Huan{-}Chi Tseng and
Masaharu Goto and
Philip A. Fisher and
Yuan{-}Yao Chang and
Chi{-}Min Chang and
Takayuki Takao and
Katsuhito Iwasaki and
Cheng Mao Lee},
title = {Fast Transistor Threshold Voltage Measurement Method for High-Speed,
High-Accuracy Advanced Process Characterization},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {22},
number = {5},
pages = {1138--1149},
year = {2014},
url = {https://doi.org/10.1109/TVLSI.2013.2265299},
doi = {10.1109/TVLSI.2013.2265299},
timestamp = {Wed, 11 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/LuoCTGFCCTIL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/LinLCC14,
author = {Tzu{-}Ming Lin and
Chia{-}Han Lee and
Jen{-}Po Cheng and
Wen{-}Tsuen Chen},
title = {{PRADA:} Prioritized Random Access With Dynamic Access Barring for
{MTC} in 3GPP {LTE-A} Networks},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {63},
number = {5},
pages = {2467--2472},
year = {2014},
url = {https://doi.org/10.1109/TVT.2013.2290128},
doi = {10.1109/TVT.2013.2290128},
timestamp = {Thu, 25 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/LinLCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/LaiCLCB14,
author = {I{-}Wei Lai and
Chien{-}Lun Chen and
Chia{-}Han Lee and
Kwang{-}Cheng Chen and
Ezio Biglieri},
title = {End-to-End Virtual {MIMO} Transmission in Ad Hoc Cognitive Radio Networks},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {13},
number = {1},
pages = {330--341},
year = {2014},
url = {https://doi.org/10.1109/TWC.2013.112513.130519},
doi = {10.1109/TWC.2013.112513.130519},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/twc/LaiCLCB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wcl/LeeS14,
author = {Chia{-}Han Lee and
Cheng{-}Yu Shih},
title = {Coverage Analysis of Cognitive Femtocell Networks},
journal = {{IEEE} Wirel. Commun. Lett.},
volume = {3},
number = {2},
pages = {177--180},
year = {2014},
url = {https://doi.org/10.1109/WCL.2013.123013.130800},
doi = {10.1109/WCL.2013.123013.130800},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wcl/LeeS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/winet/HuangHTWCL14,
author = {Chen{-}Che Huang and
Jiun{-}Long Huang and
Chin{-}Liang Tsai and
Guan{-}Zhong Wu and
Chia{-}Min Chen and
Wang{-}Chien Lee},
title = {Energy-efficient and cost-effective web {API} invocations with transfer
size reduction for mobile mashup applications},
journal = {Wirel. Networks},
volume = {20},
number = {3},
pages = {361--378},
year = {2014},
url = {https://doi.org/10.1007/s11276-013-0608-7},
doi = {10.1007/S11276-013-0608-7},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/winet/HuangHTWCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/LeeTSCS14,
author = {Ying{-}Li Lee and
Hou{-}Chiang Tseng and
Yao{-}Ting Sung and
Ju{-}Ling Chen and
Shao Hui Shu},
title = {The Readability of Diabetes Patient Education Materials on the World
Wide Web based on {LSA} and {SVM} technique},
booktitle = {{AMIA} 2014, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 15-19, 2014},
publisher = {{AMIA}},
year = {2014},
url = {https://knowledge.amia.org/56638-amia-1.1540970/t-005-1.1543914/f-005-1.1543915/a-416-1.1544423/a-417-1.1544420},
timestamp = {Wed, 17 Apr 2024 11:47:48 +0200},
biburl = {https://dblp.org/rec/conf/amia/LeeTSCS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/YehLFSH14,
author = {Chia{-}Hung Yeh and
Cheng{-}Wei Lee and
Shu{-}Jhen Fan{-}Jiang and
Yu{-}Hsien Sung and
Wen{-}Jung Huang},
title = {Second order residual prediction for {HEVC} inter coding},
booktitle = {Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} 2014, Chiang Mai, Thailand, December
9-12, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/APSIPA.2014.7041747},
doi = {10.1109/APSIPA.2014.7041747},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/apsipa/YehLFSH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/ChenWCL14,
author = {Chih{-}Lung Chen and
Sheng{-}Jhan Wu and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 1-100Mb/s 0.5-9.9mW {LDPC} convolutional code decoder for body area
network},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2014, KaoHsiung,
Taiwan, November 10-12, 2014},
pages = {229--232},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ASSCC.2014.7008902},
doi = {10.1109/ASSCC.2014.7008902},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/asscc/ChenWCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/ChiuehSCLHCWCLT14,
author = {Tzi{-}Dar Chiueh and
Toru Shimizu and
Gregory Chen and
Chen{-}Yi Lee and
Charles Hsu and
Tihao Chiang and
Zhihua Wang and
Junghwan Choi and
Jongwoo Lee and
Yasumoto Tomita and
Takayuki Kawahara},
title = {What is a good way to expand a silicon value to a solution value?},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2014, KaoHsiung,
Taiwan, November 10-12, 2014},
pages = {389--394},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ASSCC.2014.7008941},
doi = {10.1109/ASSCC.2014.7008941},
timestamp = {Wed, 27 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/ChiuehSCLHCWCLT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/LaiYCSSHCL14,
author = {Kelvin Yi{-}Tse Lai and
Yu{-}Tao Yang and
Bang{-}Jing Chen and
Chun{-}Jen Shen and
Ming{-}Feng Shiu and
Zih{-}Cheng He and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 3.3V 15.6b 6.1pJ/0.02{\%}RH with 10ms response humidity sensor for
respiratory monitoring},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2014, KaoHsiung,
Taiwan, November 10-12, 2014},
pages = {293--296},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ASSCC.2014.7008918},
doi = {10.1109/ASSCC.2014.7008918},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/LaiYCSSHCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/LinSKTCSLTLLCLH14,
author = {Wen{-}Pin Lin and
Shyh{-}Shyuan Sheu and
Chia{-}Chen Kuo and
Pei{-}Ling Tseng and
Meng{-}Fan Chang and
Keng{-}Li Su and
Chih{-}Sheng Lin and
Kan{-}Hsueh Tsai and
Sih{-}Han Lee and
Szu{-}Chieh Liu and
Yu{-}Sheng Chen and
Heng{-}Yuan Lee and
Ching{-}Chih Hsu and
Frederick T. Chen and
Tzu{-}Kun Ku and
Ming{-}Jinn Tsai and
Ming{-}Jer Kao},
title = {A nonvolatile look-up table using ReRAM for reconfigurable logic},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2014, KaoHsiung,
Taiwan, November 10-12, 2014},
pages = {133--136},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ASSCC.2014.7008878},
doi = {10.1109/ASSCC.2014.7008878},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/LinSKTCSLTLLCLH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/WuCCLLC14,
author = {Ching{-}Wei Wu and
Ming{-}Hung Chang and
Chia{-}Cheng Chen and
Robin Lee and
Hung{-}Jen Liao and
Jonathan Chang},
title = {A configurable 2-in-1 {SRAM} compiler with constant-negative-level
write driver for low Vmin in 16nm Fin-FET {CMOS}},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2014, KaoHsiung,
Taiwan, November 10-12, 2014},
pages = {145--148},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ASSCC.2014.7008881},
doi = {10.1109/ASSCC.2014.7008881},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/WuCCLLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/brain/HuangLC14,
author = {Hen{-}Hsen Huang and
Chia{-}Chun Lee and
Hsin{-}Hsi Chen},
editor = {Dominik Slezak and
Ah{-}Hwee Tan and
James F. Peters and
Lars Schwabe},
title = {Mining Professional Knowledge from Medical Records},
booktitle = {Brain Informatics and Health - International Conference, {BIH} 2014,
Warsaw, Poland, August 11-14, 2014, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8609},
pages = {152--163},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-09891-3\_15},
doi = {10.1007/978-3-319-09891-3\_15},
timestamp = {Sat, 19 Oct 2019 20:25:48 +0200},
biburl = {https://dblp.org/rec/conf/brain/HuangLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/case/LiuLHPC14,
author = {Chai{-}Yuan Liu and
Chia{-}Yuan Lee and
Li{-}Te Huang and
Hao{-}Hsuan Peng and
Hui{-}Chuan Chen},
title = {The study of green logistics services to manage reverse logistics
of {TFT-LCD} panel industry},
booktitle = {2014 {IEEE} International Conference on Automation Science and Engineering,
{CASE} 2014, New Taipei, Taiwan, August 18-22, 2014},
pages = {603--606},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CoASE.2014.6899389},
doi = {10.1109/COASE.2014.6899389},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/case/LiuLHPC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/LeeLC14,
author = {Chia{-}Yi Lee and
Tai{-}Hung Li and
Tai{-}Chen Chen},
editor = {Gerhard P. Fettweis and
Wolfgang Nebel},
title = {Design-for-debug routing for {FIB} probing},
booktitle = {Design, Automation {\&} Test in Europe Conference {\&} Exhibition,
{DATE} 2014, Dresden, Germany, March 24-28, 2014},
pages = {1--4},
publisher = {European Design and Automation Association},
year = {2014},
url = {https://doi.org/10.7873/DATE.2014.333},
doi = {10.7873/DATE.2014.333},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/date/LeeLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecai/WeiWLCTYL14,
author = {Ting{-}Han Wei and
I{-}Chen Wu and
Chao{-}Chin Liang and
Bing{-}Tsung Chiang and
Wen{-}Jie Tseng and
Shi{-}Jim Yen and
Chang{-}Shing Lee},
editor = {Tristan Cazenave and
Mark H. M. Winands and
Yngvi Bj{\"{o}}rnsson},
title = {Job-Level Algorithms for Connect6 Opening Position Analysis},
booktitle = {Computer Games - Third Workshop on Computer Games, {CGW} 2014, Held
in Conjunction with the 21st European Conference on Artificial Intelligence,
{ECAI} 2014, Prague, Czech Republic, August 18, 2014, Revised Selected
Papers},
series = {Communications in Computer and Information Science},
volume = {504},
pages = {29--44},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-14923-3\_3},
doi = {10.1007/978-3-319-14923-3\_3},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecai/WeiWLCTYL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecc/ChenYL14,
author = {Yen{-}Liang Chen and
Yao{-}Chiang Yang and
Wei{-}Tsong Lee},
editor = {Jeng{-}Shyang Pan and
V{\'{a}}clav Sn{\'{a}}sel and
Emilio Corchado and
Ajith Abraham and
Shyue{-}Liang Wang},
title = {The Study of Using Game Theory for Live Migration Prediction over
Cloud Computing},
booktitle = {Intelligent Data analysis and its Applications, Volume {II} - Proceeding
of the First Euro-China Conference on Intelligent Data Analysis and
Applications, June 13-15, 2014, Shenzhen, China},
series = {Advances in Intelligent Systems and Computing},
volume = {298},
pages = {417--425},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-07773-4\_41},
doi = {10.1007/978-3-319-07773-4\_41},
timestamp = {Wed, 07 Dec 2022 23:12:48 +0100},
biburl = {https://dblp.org/rec/conf/ecc/ChenYL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eenergy/KuoLFHC14,
author = {Chien{-}Yu Kuo and
Ming{-}Feng Lee and
Chia{-}Lin Fu and
Yao{-}Hua Ho and
Ling{-}Jyh Chen},
editor = {Jon Crowcroft and
Richard V. Penty and
Jean{-}Yves Le Boudex and
Prashant J. Shenoy},
title = {An in-depth study of forecasting household electricity demand using
realistic datasets},
booktitle = {The Fifth International Conference on Future Energy Systems, e-Energy
'14, Cambridge, United Kingdom - June 11 - 13, 2014},
pages = {145--155},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2602044.2602055},
doi = {10.1145/2602044.2602055},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eenergy/KuoLFHC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/LinLLYY14,
author = {Yuan{-}Hsiang Lin and
Yuan Long Luo and
Chia{-}cheng Lee and
Shih{-}fan Yang and
Dasen Yu},
title = {A PC-based laparoscopic surgery skills training and assessment system},
booktitle = {36th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2014, Chicago, IL, USA, August
26-30, 2014},
pages = {498--501},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/EMBC.2014.6943637},
doi = {10.1109/EMBC.2014.6943637},
timestamp = {Wed, 07 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/LinLLYY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eos/LeeSCX14,
author = {Shihyan Lee and
Chengbo Sun and
Vincent Kwofu Chiang and
Xiaoxiong Xiong},
editor = {James J. Butler and
Xiaoxiong (Jack) Xiong and
Xingfa Gu},
title = {An overview of {NASA} {VCST} {SNPP} {VIIRS} day-night band on-orbit
calibration methodology},
booktitle = {Earth Observing Systems XIX, {SPIE} Optical Engineering + Applications,
San Diego, California, USA, 17-21 August 2014},
series = {{SPIE} Proceedings},
volume = {9218},
pages = {921808},
publisher = {{SPIE}},
year = {2014},
url = {https://doi.org/10.1117/12.2061912},
doi = {10.1117/12.2061912},
timestamp = {Thu, 19 May 2022 21:17:47 +0200},
biburl = {https://dblp.org/rec/conf/eos/LeeSCX14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/estimedia/HsuLCLL14,
author = {Chia{-}Chen Hsu and
Cheng{-}Yen Lin and
Shin{-}Kai Chen and
Chih{-}Wei Liu and
Jenq Kuen Lee},
title = {Optimized memory access support for data layout conversion on heterogeneous
multi-core systems},
booktitle = {12th {IEEE} Symposium on Embedded Systems for Real-time Multimedia,
ESTIMedia 2014, Greater Noida, India, October 16-17, 2014},
pages = {128--137},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ESTIMedia.2014.6962353},
doi = {10.1109/ESTIMEDIA.2014.6962353},
timestamp = {Thu, 17 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/estimedia/HsuLCLL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcce/LiLCL14,
author = {Cheng{-}Yen Li and
Yi{-}Shiun Lee and
Kun{-}Hsiang Chang and
Chia{-}Hung Lien},
title = {Design and implementation of mobile traffic warning triangle},
booktitle = {{IEEE} 3rd Global Conference on Consumer Electronics, {GCCE} 2014,
Tokyo, Japan, 7-10 October 2014},
pages = {69--70},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/GCCE.2014.7031285},
doi = {10.1109/GCCE.2014.7031285},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/gcce/LiLCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ChenLCCL14,
author = {Yi{-}Chi Chen and
I{-}Wei Lai and
Kwang{-}Cheng Chen and
Wen{-}Tsuen Chen and
Chia{-}Han Lee},
title = {Transmission latency and reliability trade-off in path-time coded
cognitive radio ad hoc networks},
booktitle = {{IEEE} Global Communications Conference, {GLOBECOM} 2014, Austin,
TX, USA, December 8-12, 2014},
pages = {1084--1089},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/GLOCOM.2014.7036953},
doi = {10.1109/GLOCOM.2014.7036953},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/globecom/ChenLCCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/LiuMLLQ14,
author = {Chen{-}Feng Liu and
Marco Maso and
Subhash Lakshminarayana and
Chia{-}Han Lee and
Tony Q. S. Quek},
title = {Performance analysis of simultaneous wireless information and power
transfer in {MISO} systems},
booktitle = {2014 {IEEE} {GLOBECOM} Workshops, Austin, TX, USA, December 8-12,
2014},
pages = {1094--1101},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/GLOCOMW.2014.7063579},
doi = {10.1109/GLOCOMW.2014.7063579},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/globecom/LiuMLLQ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/OuLSCC14,
author = {Shun{-}Hsing Ou and
Chia{-}Han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen and
Shao{-}Yi Chien},
title = {Low complexity on-line video summarization with Gaussian mixture model
based clustering},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2014, Florence, Italy, May 4-9, 2014},
pages = {1260--1264},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICASSP.2014.6853799},
doi = {10.1109/ICASSP.2014.6853799},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/OuLSCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/LiuL14a,
author = {Chen{-}Feng Liu and
Chia{-}Han Lee},
title = {{MISO} information and power transfer with finite-rate feedback under
fading channel},
booktitle = {{IEEE} International Conference on Communications, {ICC} 2014, Sydney,
Australia, June 10-14, 2014},
pages = {3794--3799},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICC.2014.6883912},
doi = {10.1109/ICC.2014.6883912},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/icc/LiuL14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icca/ChuangHJL14,
author = {Chen{-}Chia Chuang and
Guan{-}Yi Hu and
Jin{-}Tsong Jeng and
Heng Wei Lee},
title = {{LTS-SVM} learning mechanism with wavelet for modeling of nonlinear
systems with noise and outliers},
booktitle = {11th {IEEE} International Conference on Control {\&} Automation,
{ICCA} 2014, Taichung, Taiwan, June 18-20, 2014},
pages = {1449--1453},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICCA.2014.6871136},
doi = {10.1109/ICCA.2014.6871136},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icca/ChuangHJL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/HuangLLLCLK14,
author = {Chia{-}Chi Huang and
Chang{-}Tzu Lin and
Wei{-}Syun Liao and
Chieh{-}Jui Lee and
Hung{-}Ming Chen and
Chia{-}Hsin Lee and
Ding{-}Ming Kwai},
title = {Improving power delivery network design by practical methodologies},
booktitle = {32nd {IEEE} International Conference on Computer Design, {ICCD} 2014,
Seoul, South Korea, October 19-22, 2014},
pages = {237--242},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ICCD.2014.6974687},
doi = {10.1109/ICCD.2014.6974687},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/HuangLLLCLK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnsc/ChenHCL14,
author = {Yen{-}Lin Chen and
Yo{-}Ping Huang and
Hsin{-}Han Chiang and
Tsu{-}Tian Lee},
title = {Ubiquitous knowledge-based framework for personalized home healthcare
systems},
booktitle = {Proceedings of 11th {IEEE} International Conference on Networking,
Sensing and Control, {ICNSC} 2014, Miami, FL, USA, April 7-9, 2014},
pages = {673--678},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICNSC.2014.6819706},
doi = {10.1109/ICNSC.2014.6819706},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icnsc/ChenHCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/HongTZHL14,
author = {Yao{-}Win Peter Hong and
Chee Wei Tan and
Liang Zheng and
Cheng{-}Lin Hsieh and
Chia{-}Han Lee},
title = {A unified framework for wireless max-min utility optimization with
general monotonic constraints},
booktitle = {2014 {IEEE} Conference on Computer Communications, {INFOCOM} 2014,
Toronto, Canada, April 27 - May 2, 2014},
pages = {2076--2084},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/INFOCOM.2014.6848149},
doi = {10.1109/INFOCOM.2014.6848149},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/infocom/HongTZHL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intcompsymp/ChiangLTLHC14,
author = {Ya{-}Tien Chiang and
Chi{-}Heng Lu and
Chiu{-}Ching Tuan and
Tsair{-}Fwu Lee and
Yu{-}Chih Huang and
Mei{-}Chuan Chen},
editor = {William Cheng{-}Chung Chu and
Han{-}Chieh Chao and
Stephen Jenn{-}Hwa Yang},
title = {Non-invasive Detection of Sound Signals for Diagnosis of Ligament
Injuries around Knee based on Mel-frequency Cepstrum},
booktitle = {Intelligent Systems and Applications - Proceedings of the International
Computer Symposium {(ICS)} held at Taichung, Taiwan, December 12-14,
2014},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {274},
pages = {1940--1949},
publisher = {{IOS} Press},
year = {2014},
url = {https://doi.org/10.3233/978-1-61499-484-8-1940},
doi = {10.3233/978-1-61499-484-8-1940},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/intcompsymp/ChiangLTLHC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intcompsymp/MaCLL14,
author = {Shang{-}Pin Ma and
Ping{-}Chang Chen and
Chi{-}Chia Li and
Wen{-}Tin Lee},
editor = {William Cheng{-}Chung Chu and
Han{-}Chieh Chao and
Stephen Jenn{-}Hwa Yang},
title = {Context-Aware RESTful Service Delivery Mechanism for Smartphones},
booktitle = {Intelligent Systems and Applications - Proceedings of the International
Computer Symposium {(ICS)} held at Taichung, Taiwan, December 12-14,
2014},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {274},
pages = {1885--1894},
publisher = {{IOS} Press},
year = {2014},
url = {https://doi.org/10.3233/978-1-61499-484-8-1885},
doi = {10.3233/978-1-61499-484-8-1885},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/intcompsymp/MaCLL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intcompsymp/MuchtarYLXSK14,
author = {Kahlil Muchtar and
Chia{-}Hung Yeh and
Cheng{-}Wei Lee and
Wen{-}Hung Xu and
Po{-}Yi Sung and
Chia{-}Chen Kuo},
editor = {William Cheng{-}Chung Chu and
Han{-}Chieh Chao and
Stephen Jenn{-}Hwa Yang},
title = {Heartbeat measurement based on laser speckle fingerprint},
booktitle = {Intelligent Systems and Applications - Proceedings of the International
Computer Symposium {(ICS)} held at Taichung, Taiwan, December 12-14,
2014},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {274},
pages = {2030--2036},
publisher = {{IOS} Press},
year = {2014},
url = {https://doi.org/10.3233/978-1-61499-484-8-2030},
doi = {10.3233/978-1-61499-484-8-2030},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/intcompsymp/MuchtarYLXSK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/JianSLCC14,
author = {Jhong{-}Ting Jian and
Yu{-}Lin Song and
Chia{-}Fone Lee and
Yuan{-}Fang Chou and
Wei{-}Zen Chen},
title = {A 0.6 V, 1.66mW energy harvester and audio driver for tympanic membrane
transducer with wirelessly optical signal and power transfer},
booktitle = {{IEEE} International Symposium on Circuits and Systemss, {ISCAS} 2014,
Melbourne, Victoria, Australia, June 1-5, 2014},
pages = {874--877},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISCAS.2014.6865275},
doi = {10.1109/ISCAS.2014.6865275},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/JianSLCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/WuLSCC14,
author = {Hsin{-}Fang Wu and
Chia{-}Han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen and
Shao{-}Yi Chien},
title = {Error resilience for key frames in distributed video coding with rate-distortion
optimized mode decision},
booktitle = {{IEEE} International Symposium on Circuits and Systemss, {ISCAS} 2014,
Melbourne, Victoria, Australia, June 1-5, 2014},
pages = {1118--1121},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISCAS.2014.6865336},
doi = {10.1109/ISCAS.2014.6865336},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/WuLSCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/YangLCCL14,
author = {Chih{-}Wen Yang and
Xin{-}Ru Lee and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {Area-efficient TFM-based stochastic decoder design for non-binary
{LDPC} codes},
booktitle = {{IEEE} International Symposium on Circuits and Systemss, {ISCAS} 2014,
Melbourne, Victoria, Australia, June 1-5, 2014},
pages = {409--412},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISCAS.2014.6865152},
doi = {10.1109/ISCAS.2014.6865152},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/YangLCCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isicir/ChangL14,
author = {Chia{-}Lun Chang and
Tai{-}Cheng Lee},
title = {A compact multi-input thermoelectric energy harvesting system with
58.5{\%} power conversion efficiency and 32.4-mW output power capability},
booktitle = {2014 International Symposium on Integrated Circuits (ISIC), Singapore,
December 10-12, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISICIR.2014.7029491},
doi = {10.1109/ISICIR.2014.7029491},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/isicir/ChangL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/LaiLCB14,
author = {I{-}Wei Lai and
Chia{-}Han Lee and
Kwang{-}Cheng Chen and
Ezio Biglieri},
title = {Performance of path-time codes for end-to-end transmission in ad hoc
multihop networks},
booktitle = {2014 {IEEE} International Symposium on Information Theory, Honolulu,
HI, USA, June 29 - July 4, 2014},
pages = {66--70},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISIT.2014.6874796},
doi = {10.1109/ISIT.2014.6874796},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isit/LaiLCB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispd/HoLWC14,
author = {Chia{-}Tung Ho and
Yu{-}Min Lee and
Shu{-}Han Wei and
Liang{-}Chia Cheng},
editor = {Cliff C. N. Sze and
Azadeh Davoodi},
title = {Incremental transient simulation of power grid},
booktitle = {International Symposium on Physical Design, ISPD'14, Petaluma, CA,
USA, March 30 - April 02, 2014},
pages = {93--100},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2560519.2560525},
doi = {10.1145/2560519.2560525},
timestamp = {Tue, 06 Nov 2018 11:07:47 +0100},
biburl = {https://dblp.org/rec/conf/ispd/HoLWC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChiangHCCL14,
author = {Ping{-}Chuan Chiang and
Hao{-}Wei Hung and
Hsiang{-}Yun Chu and
Guan{-}Sing Chen and
Jri Lee},
title = {2.3 60Gb/s {NRZ} and {PAM4} transmitters for 400GbE in 65nm {CMOS}},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {42--43},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757329},
doi = {10.1109/ISSCC.2014.6757329},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChiangHCCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WangLOHWCCHTTTL14,
author = {Alice Wang and
Tsung{-}Yao Lin and
Shichin Ouyang and
Wei{-}Hung Huang and
Jidong Wang and
Shu{-}Hsin Chang and
Sheng{-}Ping Chen and
Chun{-}Hsiung Hu and
J. C. Tai and
Koan{-}Sin Tan and
Meng{-}Nan Tsou and
Ming{-}Hsien Lee and
Gordon Gammie and
Chi{-}Wei Yang and
Chih{-}Chieh Yang and
Yeh{-}Chi Chou and
Shih{-}Hung Lin and
Wuan Kuo and
Chi{-}Jui Chung and
Lee{-}Kee Yong and
Chia{-}Wei Wang and
Kin Hooi Dia and
Cheng{-}Hsing Chien and
You{-}Ming Tsao and
N. K. Singh and
Rolf Lagerquist and
Chih{-}Cheng Chen and
Uming Ko},
title = {10.3 heterogeneous multi-processing quad-core {CPU} and dual-GPU design
for optimal performance, power, and thermal tradeoffs in a 28nm mobile
application processor},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {180--181},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757390},
doi = {10.1109/ISSCC.2014.6757390},
timestamp = {Mon, 10 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/WangLOHWCCHTTTL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/LinCWLLPW14,
author = {Bing{-}Yang Lin and
Wan{-}Ting Chiang and
Cheng{-}Wen Wu and
Mincent Lee and
Hung{-}Chih Lin and
Ching{-}Nen Peng and
Min{-}Jer Wang},
title = {Redundancy architectures for channel-based 3D {DRAM} yield improvement},
booktitle = {2014 International Test Conference, {ITC} 2014, Seattle, WA, USA,
October 20-23, 2014},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/TEST.2014.7035331},
doi = {10.1109/TEST.2014.7035331},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itc/LinCWLLPW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ivcnz/HsiehLCLC14,
author = {Jun{-}Wei Hsieh and
C.{-}Hung Lee and
Yun{-}Chih Chen and
W.{-}Shan Lee and
Hui{-}Fen Chiang},
editor = {Michael J. Cree and
Lee V. Streeter and
John A. Perrone and
Michael Mayo and
Anthony M. Blake},
title = {Stage Classification in Chronic Kidney Disease by Ultrasound Image},
booktitle = {Proceedings of the 29th International Conference on Image and Vision
Computing New Zealand, {IVCNZ} 2014, Hamilton, New Zealand, November
19-21, 2014},
pages = {271},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2683405.2683457},
doi = {10.1145/2683405.2683457},
timestamp = {Thu, 25 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ivcnz/HsiehLCLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/KuoCCLWLHCTHHH14,
author = {Yin{-}Hsi Kuo and
Yan{-}Ying Chen and
Bor{-}Chun Chen and
Wen{-}Yu Lee and
Chun{-}Che Wu and
Chia{-}Hung Lin and
Yu{-}Lin Hou and
Wen{-}Feng Cheng and
Yi{-}Chih Tsai and
Chung{-}Yen Hung and
Liang{-}Chi Hsieh and
Winston H. Hsu},
editor = {Kien A. Hua and
Yong Rui and
Ralf Steinmetz and
Alan Hanjalic and
Apostol Natsev and
Wenwu Zhu},
title = {Discovering the City by Mining Diverse and Multimodal Data Streams},
booktitle = {Proceedings of the {ACM} International Conference on Multimedia, {MM}
'14, Orlando, FL, USA, November 03 - 07, 2014},
pages = {201--204},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2647868.2656406},
doi = {10.1145/2647868.2656406},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/KuoCCLWLHCTHHH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/momm/ZhuL14,
author = {Chia{-}Cheng Zhu and
Chung{-}Nan Lee},
editor = {Shyue{-}Liang Leon Wang and
Yu{-}Hui Tao and
Liming Chen and
Chung{-}Nan Lee},
title = {Improvement of Small-write Performance Using the ECL-based Technique},
booktitle = {Proceedings of the 12th International Conference on Advances in Mobile
Computing and Multimedia, Kaohsiung, Taiwan, December 8-10, 2014},
pages = {203--210},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2684103.2684125},
doi = {10.1145/2684103.2684125},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/momm/ZhuL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/LinFL14,
author = {Che{-}Hsin Lin and
Lung{-}Ming Fu and
Chia{-}Yen Lee},
title = {MEMS-based humidity sensor based on thiol-coated gold nanoparticles},
booktitle = {9th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {NEMS} 2014, Waikiki Beach, HI, USA, April 13-16, 2014},
pages = {191--194},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/NEMS.2014.6908788},
doi = {10.1109/NEMS.2014.6908788},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/nems/LinFL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/netgames/HongFLCHH14,
author = {Hua{-}Jun Hong and
Tao{-}Ya Fan{-}Chiang and
Che{-}Run Lee and
Kuan{-}Ta Chen and
Chun{-}Ying Huang and
Cheng{-}Hsin Hsu},
editor = {Yutaka Ishibashi and
Adrian David Cheok},
title = {{GPU} consolidation for cloud games: Are we there yet?},
booktitle = {13th Annual Workshop on Network and Systems Support for Games, NetGames
2014, Nagoya, Japan, December 4-5, 2014},
pages = {1--6},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/NetGames.2014.7008969},
doi = {10.1109/NETGAMES.2014.7008969},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/netgames/HongFLCHH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/ChenSZCLZCHLLLW14,
author = {Chin{-}Ta Chen and
Po{-}Kuan Shen and
Teng{-}Zhang Zhu and
Chia{-}Chi Chang and
Shu{-}Shuan Lin and
Mao{-}Yuan Zeng and
Chien{-}Yu Chiu and
Hsu{-}Liang Hsiao and
Hsiao{-}Chin Lan and
Yun{-}Chih Lee and
Yo{-}Shen Lin and
Mount{-}Learn Wu},
title = {Chip-level 10-Gbit/s optical interconnects using 1 {\texttimes} 2
polymer vertical splitter on silicon substrate},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014,
San Francisco, CA, USA, March 9-13, 2014},
pages = {1--3},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1364/OFC.2014.M2K.4},
doi = {10.1364/OFC.2014.M2K.4},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/ofc/ChenSZCLZCHLLLW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/ShenCCCCLLW14,
author = {Po{-}Kuan Shen and
Chin{-}Ta Chen and
Chia{-}Hao Chang and
Chien{-}Yu Chiu and
Chia{-}Chi Chang and
Hsiao{-}Chin Lan and
Yun{-}Chih Lee and
Mount{-}Learn Wu},
title = {On-chip optical interconnects integrated with laser and photodetector
using three-dimensional silicon waveguides},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014,
San Francisco, CA, USA, March 9-13, 2014},
pages = {1--3},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1364/OFC.2014.M2K.6},
doi = {10.1364/OFC.2014.M2K.6},
timestamp = {Fri, 09 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/ShenCCCCLLW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/persuasive/ChenCCLLYCLLLTJSCH14,
author = {Yong{-}Xiang Chen and
Siek{-}Siang Chiang and
Shu{-}Yun Chih and
Wen{-}Ching Liao and
Shih{-}Yao Lin and
Shang{-}Hua Yang and
Shun{-}Wen Cheng and
Shih{-}Sung Lin and
Yu{-}Shan Lin and
Ming{-}Sui Lee and
Jau{-}Yih Tsauo and
Cheng{-}Min Jen and
Chia{-}Shiang Shih and
King{-}Jen Chang and
Yi{-}Ping Hung},
editor = {Anna Spagnolli and
Luca Chittaro and
Luciano Gamberini},
title = {Opportunities for Persuasive Technology to Motivate Heavy Computer
Users for Stretching Exercise},
booktitle = {Persuasive Technology - 9th International Conference, {PERSUASIVE}
2014, Padua, Italy, May 21-23, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8462},
pages = {25--30},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-07127-5\_3},
doi = {10.1007/978-3-319-07127-5\_3},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/persuasive/ChenCCLLYCLLLTJSCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scisisis/TaoLCLC14,
author = {Chin{-}Wang Tao and
Ming{-}Yen Lin and
Chen{-}Chia Chuang and
Tsu{-}Tian Lee and
Chia{-}Wen Chang},
title = {Design of a DSP-based biaxial solar tracking system},
booktitle = {2014 Joint 7th International Conference on Soft Computing and Intelligent
Systems {(SCIS)} and 15th International Symposium on Advanced Intelligent
Systems (ISIS), Kita-Kyushu, Japan, December 3-6, 2014},
pages = {892--895},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/SCIS-ISIS.2014.7044679},
doi = {10.1109/SCIS-ISIS.2014.7044679},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/scisisis/TaoLCLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/ChenYCLSCL14,
author = {Yen{-}Lin Chen and
Chao{-}Wei Yu and
Chuan{-}Yen Chiang and
Chin{-}Hsuan Liu and
Wei{-}Chen Sun and
Hsin{-}Han Chiang and
Tsu{-}Tian Lee},
title = {Real-time eye detection and event identification for human-computer
interactive control for driver assistance},
booktitle = {2014 {IEEE} International Conference on Systems, Man, and Cybernetics,
{SMC} 2014, San Diego, CA, USA, October 5-8, 2014},
pages = {2144--2149},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/SMC.2014.6974239},
doi = {10.1109/SMC.2014.6974239},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc/ChenYCLSCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/soca/LeeHKC14,
author = {Haw Lee and
Wei{-}Chih Hong and
Chia{-}Hung Kao and
Chen{-}Mou Cheng},
title = {A User-Friendly Authentication Solution Using {NFC} Card Emulation
on Android},
booktitle = {7th {IEEE} International Conference on Service-Oriented Computing
and Applications, {SOCA} 2014, Matsue, Japan, November 17-19, 2014},
pages = {271--278},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/SOCA.2014.16},
doi = {10.1109/SOCA.2014.16},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/soca/LeeHKC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socc/WuTCLLC14,
author = {Guo{-}Zua Wu and
Song{-}Nien Tang and
Chih{-}Chi Chang and
Chien{-}Ju Lee and
Kuan{-}Hsien Lin and
Oscal T.{-}C. Chen},
editor = {Kaijian Shi and
Thomas B{\"{u}}chner and
Danella Zhao and
Ramalingam Sridhar},
title = {High-frequency and power-efficiency ultrasound beam-forming processor
for handheld applications},
booktitle = {27th {IEEE} International System-on-Chip Conference, {SOCC} 2014,
Las Vegas, NV, USA, September 2-5, 2014},
pages = {420--424},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/SOCC.2014.6948966},
doi = {10.1109/SOCC.2014.6948966},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/socc/WuTCLLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socialcom/LeeLCCLCC14,
author = {Eric L. Lee and
Jing{-}Kai Lou and
Wei{-}Ming Chen and
Yen{-}Chi Chen and
Shou{-}De Lin and
Yen{-}Sheng Chiang and
Kuan{-}Ta Chen},
editor = {Su Yang and
Kristina Lerman and
James She and
Martin Atzmueller},
title = {Fairness-Aware Loan Recommendation for Microfinance Services},
booktitle = {Proceedings of the 2014 International Conference on Social Computing,
Beijing, China, August 04 - 07, 2014},
pages = {3:1--3:4},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2639968.2640064},
doi = {10.1145/2639968.2640064},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/socialcom/LeeLCCLCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/HuangLYLW14,
author = {Cheng{-}Yi Huang and
Yi{-}Cheng Lee and
Chia{-}An Yu and
Yi{-}Zheng Lee and
Sai{-}Keung Wong},
editor = {Shin{-}Ming Cheng and
Min{-}Yuh Day},
title = {Wonders of Seabed: Difficulty Evaluation of Management Games Using
Neural Network},
booktitle = {Technologies and Applications of Artificial Intelligence, 19th International
Conference, {TAAI} 2014, Taipei, Taiwan, November 21-23, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8916},
pages = {164--177},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-13987-6\_16},
doi = {10.1007/978-3-319-13987-6\_16},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/taai/HuangLYLW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/OuLWCLYLGSC14,
author = {Shun{-}Hsing Ou and
Yu{-}Chen Lu and
Jui{-}Pin Wang and
Shao{-}Yi Chien and
Shou{-}De Lin and
Mi{-}Yen Yeh and
Chia{-}Han Lee and
Phillip B. Gibbons and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen},
title = {Communication-efficient multi-view keyframe extraction in distributed
video sensors},
booktitle = {2014 {IEEE} Visual Communications and Image Processing Conference,
{VCIP} 2014, Valletta, Malta, December 7-10, 2014},
pages = {13--16},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/VCIP.2014.7051492},
doi = {10.1109/VCIP.2014.7051492},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vcip/OuLWCLYLGSC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/TsaiWHCKLCWCL14,
author = {Chang{-}Hung Tsai and
Tung{-}Yu Wu and
Shu{-}Yu Hsu and
Chia{-}Ching Chu and
Fang{-}Ju Ku and
Ying{-}Siou Laio and
Chih{-}Lung Chen and
Wing Hung Wong and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 7.11mJ/Gb/query data-driven machine learning processor (D\({}^{\mbox{2}}\)MLP)
for big data analysis and applications},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2014, Digest of Technical Papers,
Honolulu, HI, USA, June 10-13, 2014},
pages = {1--2},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/VLSIC.2014.6858422},
doi = {10.1109/VLSIC.2014.6858422},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/TsaiWHCKLCWCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ChuLC14,
author = {Feng Seng Chu and
Chia{-}Han Lee and
Kwang{-}Cheng Chen},
title = {Backhaul-constrained resource optimization for distributed femtocell
interference mitigation},
booktitle = {{IEEE} Wireless Communications and Networking Conference, {WCNC} 2014,
Istanbul, Turkey, April 6-9, 2014},
pages = {1485--1489},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/WCNC.2014.6952409},
doi = {10.1109/WCNC.2014.6952409},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wcnc/ChuLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wf-iot/ChenTHLWYCLSCLPGCYCH14,
author = {Kuan{-}Wen Chen and
Hsin{-}Mu Tsai and
Chih{-}Hung Hsieh and
Shou{-}De Lin and
Chieh{-}Chih Wang and
Shao{-}Wen Yang and
Shao{-}Yi Chien and
Chia{-}Han Lee and
Yu{-}Chi Su and
Chun{-}Ting Chou and
Yuh{-}Jye Lee and
Hsing{-}Kuo Pao and
Ruey{-}Shan Guo and
Chung{-}Jen Chen and
Ming{-}Hsuan Yang and
Bing{-}Yu Chen and
Yi{-}Ping Hung},
title = {Connected vehicle safety science, system, and framework},
booktitle = {{IEEE} World Forum on Internet of Things, WF-IoT 2014, Seoul, South
Korea, March 6-8, 2014},
pages = {235--240},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/WF-IoT.2014.6803165},
doi = {10.1109/WF-IOT.2014.6803165},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wf-iot/ChenTHLWYCLSCLPGCYCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HsuLY14,
author = {Bo{-}Kai Hsu and
Chia{-}Han Lee and
Ping{-}Cheng Yeh},
title = {On Timing Synchronization for Quantity-based Modulation in Additive
Inverse Gaussian Channel with Drift},
journal = {CoRR},
volume = {abs/1411.2443},
year = {2014},
url = {http://arxiv.org/abs/1411.2443},
eprinttype = {arXiv},
eprint = {1411.2443},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HsuLY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/AngSCYC13,
author = {Li{-}Minn Ang and
Kah Phooi Seng and
Li Wern Chew and
Lee Seng Yeong and
Wai Chong Chia},
title = {Wireless Multimedia Sensor Networks on Reconfigurable Hardware - Information
Reduction Techniques},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38203-1},
doi = {10.1007/978-3-642-38203-1},
isbn = {978-3-642-38202-4},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/AngSCYC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChenLLCCC13,
author = {Wen{-}Tsuen Chen and
Youn{-}Long Lin and
Chen{-}Yi Lee and
Jeng{-}Long Chiang and
Meng{-}Fan Chang and
Shih{-}Chieh Chang},
title = {Strengthening Modern Electronics Industry Through the National Program
for Intelligent Electronics in Taiwan},
journal = {{IEEE} Access},
volume = {1},
pages = {123--130},
year = {2013},
url = {https://doi.org/10.1109/ACCESS.2013.2260591},
doi = {10.1109/ACCESS.2013.2260591},
timestamp = {Wed, 04 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChenLLCCC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/LeeHCHC13,
author = {Yen{-}Hsien Lee and
Paul Jen{-}Hwa Hu and
Tsang{-}Hsiang Cheng and
Te{-}Chia Huang and
Wei{-}Yao Chuang},
title = {A preclustering-based ensemble learning technique for acute appendicitis
diagnoses},
journal = {Artif. Intell. Medicine},
volume = {58},
number = {2},
pages = {115--124},
year = {2013},
url = {https://doi.org/10.1016/j.artmed.2013.03.007},
doi = {10.1016/J.ARTMED.2013.03.007},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/artmed/LeeHCHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/WengLLN13,
author = {Chia{-}Wei Weng and
Shan{-}Chih Lee and
Yu{-}Liang Lee and
Ka{-}Lok Ng},
title = {Analysis of the {NCI-60} dataset for cancer-related microRNA and mRNA
using expression profiles},
journal = {Comput. Biol. Chem.},
volume = {44},
pages = {15--21},
year = {2013},
url = {https://doi.org/10.1016/j.compbiolchem.2013.02.001},
doi = {10.1016/J.COMPBIOLCHEM.2013.02.001},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/candc/WengLLN13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/HongHCLLC13,
author = {Jon{-}Chao Hong and
Ming{-}Yueh Hwang and
Wen{-}Chi Chen and
Chia{-}Ching Lee and
Pei{-}Hsin Lin and
Yi{-}Ling Chen},
title = {Comparing the retention and flow experience in playing Solitary and
Heart Attack games of San Zi Jing: {A} perspective of Dual Process
Theory},
journal = {Comput. Educ.},
volume = {69},
pages = {369--376},
year = {2013},
url = {https://doi.org/10.1016/j.compedu.2013.07.027},
doi = {10.1016/J.COMPEDU.2013.07.027},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ce/HongHCLLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/ChienCOCLSC13,
author = {Shao{-}Yi Chien and
Teng{-}Yuan Cheng and
Shun{-}Hsing Ou and
Chieh{-}Chuan Chiu and
Chia{-}han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen},
title = {Power Consumption Analysis for Distributed Video Sensors in Machine-to-Machine
Networks},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {3},
number = {1},
pages = {55--64},
year = {2013},
url = {https://doi.org/10.1109/JETCAS.2013.2242771},
doi = {10.1109/JETCAS.2013.2242771},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esticas/ChienCOCLSC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hac/TanCL13,
author = {Chia{-}Chen Tan and
Chih{-}Ming Chen and
Hahn{-}Ming Lee},
title = {Using a Paper-based Digital Pen for Supporting English Courses in
Regular Classrooms to Improve Reading Fluency},
journal = {Int. J. Humanit. Arts Comput.},
volume = {7},
number = {Supplement},
pages = {234--246},
year = {2013},
url = {https://doi.org/10.3366/ijhac.2013.0073},
doi = {10.3366/IJHAC.2013.0073},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hac/TanCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icl/LaiLC13,
author = {I{-}Wei Lai and
Chia{-}han Lee and
Kwang{-}Cheng Chen},
title = {A Virtual {MIMO} Path-Time Code for Cognitive Ad Hoc Networks},
journal = {{IEEE} Commun. Lett.},
volume = {17},
number = {1},
pages = {4--7},
year = {2013},
url = {https://doi.org/10.1109/LCOMM.2012.112012.121868},
doi = {10.1109/LCOMM.2012.112012.121868},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/icl/LaiLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/YangLC13,
author = {Richard Hsin{-}Hsyong Yang and
Chia{-}Kun Lee and
Shiunn{-}Jang Chern},
title = {Continuous Phase Modulation {(CPM)} Revisited: Using Time-Limited
Phase Shaping Pulses},
journal = {{IEICE} Trans. Commun.},
volume = {96-B},
number = {11},
pages = {2828--2839},
year = {2013},
url = {https://doi.org/10.1587/transcom.E96.B.2828},
doi = {10.1587/TRANSCOM.E96.B.2828},
timestamp = {Sat, 11 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/YangLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/LeeKCHWHC13,
author = {Yen{-}Ying Lee and
Li{-}Na Kuo and
Yi{-}Chun Chiang and
Jing{-}Yi Hou and
Tzu{-}Ying Wu and
Min{-}Huei Hsu and
Hsiang{-}Yin Chen},
title = {Pharmacist-conducted medication reconciliation at hospital admission
using information technology in Taiwan},
journal = {Int. J. Medical Informatics},
volume = {82},
number = {6},
pages = {522--527},
year = {2013},
url = {https://doi.org/10.1016/j.ijmedinf.2013.01.006},
doi = {10.1016/J.IJMEDINF.2013.01.006},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/LeeKCHWHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijnsec/ChangL13,
author = {Chin{-}Chen Chang and
Chia{-}Yin Lee},
title = {A Smart Card-based Authentication Scheme Using User Identify Cryptography},
journal = {Int. J. Netw. Secur.},
volume = {15},
number = {2},
pages = {139--147},
year = {2013},
url = {http://ijns.jalaxy.com.tw/contents/ijns-v15-n2/ijns-2013-v15-n2-p139-147.pdf},
timestamp = {Mon, 04 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijnsec/ChangL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijnsec/LeeLH13,
author = {Cheng{-}Chi Lee and
Chia{-}Hsin Liu and
Min{-}Shiang Hwang},
title = {Guessing Attacks on Strong-Password Authentication Protocol},
journal = {Int. J. Netw. Secur.},
volume = {15},
number = {1},
pages = {64--67},
year = {2013},
url = {http://ijns.jalaxy.com.tw/contents/ijns-v15-n1/ijns-2013-v15-n1-p64-67.pdf},
timestamp = {Mon, 04 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijnsec/LeeLH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/LiuHLC13,
author = {Chien{-}Liang Liu and
Wen{-}Hoar Hsaio and
Chia{-}Hoang Lee and
Chun{-}Hsien Chen},
title = {Clustering tagged documents with labeled and unlabeled documents},
journal = {Inf. Process. Manag.},
volume = {49},
number = {3},
pages = {596--606},
year = {2013},
url = {https://doi.org/10.1016/j.ipm.2012.12.004},
doi = {10.1016/J.IPM.2012.12.004},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/LiuHLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/HuLHC13,
author = {Nian{-}Ze Hu and
Chia{-}Ying Lee and
Mark C. Hou and
Ying{-}Ling Chen},
title = {A Cloud System for Mobile Medical Services of Traditional Chinese
Medicine},
journal = {J. Medical Syst.},
volume = {37},
number = {6},
pages = {9978},
year = {2013},
url = {https://doi.org/10.1007/s10916-013-9978-8},
doi = {10.1007/S10916-013-9978-8},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/HuLHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/ShihLYC13,
author = {Po{-}Jen Shih and
Chia{-}Han Lee and
Ping{-}Cheng Yeh and
Kwang{-}Cheng Chen},
title = {Channel Codes for Reliability Enhancement in Molecular Communication},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {31},
number = {12-Supplement},
pages = {857--867},
year = {2013},
url = {https://doi.org/10.1109/JSAC.2013.SUP2.12130018},
doi = {10.1109/JSAC.2013.SUP2.12130018},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsac/ShihLYC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/WuLYLC13,
author = {Chih{-}Yao Wu and
Pang{-}Chang Lan and
Ping{-}Cheng Yeh and
Chia{-}Han Lee and
Chen{-}Mou Cheng},
title = {Practical Physical Layer Security Schemes for {MIMO-OFDM} Systems
Using Precoding Matrix Indices},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {31},
number = {9},
pages = {1687--1700},
year = {2013},
url = {https://doi.org/10.1109/JSAC.2013.130904},
doi = {10.1109/JSAC.2013.130904},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/WuLYLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChangSLWKCYCLLCSKKT13,
author = {Meng{-}Fan Chang and
Shyh{-}Shyuan Sheu and
Ku{-}Feng Lin and
Che{-}Wei Wu and
Chia{-}Chen Kuo and
Pi{-}Feng Chiu and
Yih{-}Shan Yang and
Yu{-}Sheng Chen and
Heng{-}Yuan Lee and
Chen{-}Hsin Lien and
Frederick T. Chen and
Keng{-}Li Su and
Tzu{-}Kun Ku and
Ming{-}Jer Kao and
Ming{-}Jinn Tsai},
title = {A High-Speed 7.2-ns Read-Write Random Access 4-Mb Embedded Resistive
{RAM} (ReRAM) Macro Using Process-Variation-Tolerant Current-Mode
Read Schemes},
journal = {{IEEE} J. Solid State Circuits},
volume = {48},
number = {3},
pages = {878--891},
year = {2013},
url = {https://doi.org/10.1109/JSSC.2012.2230515},
doi = {10.1109/JSSC.2012.2230515},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/ChangSLWKCYCLLCSKKT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/HsiehHLCTLS13,
author = {Yao{-}Sheng Hsieh and
Yi{-}Ching Ho and
Shyh{-}Yuan Lee and
Ching{-}Cheng Chuang and
Jui{-}Che Tsai and
Kun{-}Feng Lin and
Chia{-}Wei Sun},
title = {Dental Optical Coherence Tomography},
journal = {Sensors},
volume = {13},
number = {7},
pages = {8928--8949},
year = {2013},
url = {https://doi.org/10.3390/s130708928},
doi = {10.3390/S130708928},
timestamp = {Wed, 04 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/HsiehHLCTLS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/WangSHTCLH13,
author = {Chua{-}Chin Wang and
Tzu{-}Chiao Sung and
Chia{-}Hao Hsu and
Yue{-}Da Tsai and
Yun{-}Chi Chen and
Ming{-}Chih Lee and
I{-}Yu Huang},
title = {A Protein Concentration Measurement System Using a Flexural Plate-Wave
Frequency-Shift Readout Technique},
journal = {Sensors},
volume = {13},
number = {1},
pages = {86--105},
year = {2013},
url = {https://doi.org/10.3390/s130100086},
doi = {10.3390/S130100086},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/WangSHTCLH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/LiLCKCCYCHSL13,
author = {Ming{-}Lung Li and
Lung{-}Cheng Lee and
Yuh{-}Ren Cheng and
Ching{-}Hua Kuo and
Yuan{-}Fang Chou and
Yuh{-}Shyang Chen and
Chih{-}Min Yao and
Peir{-}Rong Chen and
Chuan{-}Jen Hsu and
Yu{-}Lin Song and
Chia{-}Fone Lee},
title = {A Novel Aerosol-Mediated Drug Delivery System for Inner Ear Therapy:
Intratympanic Aerosol Methylprednisolone Can Attenuate Acoustic Trauma},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {60},
number = {9},
pages = {2450--2460},
year = {2013},
url = {https://doi.org/10.1109/TBME.2013.2258154},
doi = {10.1109/TBME.2013.2258154},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/LiLCKCCYCHSL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tem/LeeWL13,
author = {Cheng{-}Yu Lee and
Hsueh{-}Liang Wu and
Chia{-}Yi Liu},
title = {Contextual Determinants of Ambidextrous Learning: Evidence From Industrial
Firms in Four Industrialized Countries},
journal = {{IEEE} Trans. Engineering Management},
volume = {60},
number = {3},
pages = {529--540},
year = {2013},
url = {https://doi.org/10.1109/TEM.2012.2228204},
doi = {10.1109/TEM.2012.2228204},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tem/LeeWL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tpds/ChengLH13,
author = {Chia{-}Wen Cheng and
Chia{-}Wei Lee and
Sun{-}Yuan Hsieh},
title = {Conditional Edge-Fault Hamiltonicity of Cartesian Product Graphs},
journal = {{IEEE} Trans. Parallel Distributed Syst.},
volume = {24},
number = {10},
pages = {1951--1960},
year = {2013},
url = {https://doi.org/10.1109/TPDS.2012.304},
doi = {10.1109/TPDS.2012.304},
timestamp = {Fri, 02 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tpds/ChengLH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/LiuHLC13,
author = {Chien{-}Liang Liu and
Wen{-}Hoar Hsaio and
Chia{-}Hoang Lee and
Hsiao{-}Cheng Chi},
title = {An HMM-Based Algorithm for Content Ranking and Coherence-Feature Extraction},
journal = {{IEEE} Trans. Syst. Man Cybern. Syst.},
volume = {43},
number = {2},
pages = {440--450},
year = {2013},
url = {https://doi.org/10.1109/TSMCA.2012.2207104},
doi = {10.1109/TSMCA.2012.2207104},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/LiuHLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/LinCL13,
author = {Yi{-}Min Lin and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {Improved High Code-Rate Soft {BCH} Decoder Architectures With One
Extra Error Compensation},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {21},
number = {11},
pages = {2160--2164},
year = {2013},
url = {https://doi.org/10.1109/TVLSI.2012.2227847},
doi = {10.1109/TVLSI.2012.2227847},
timestamp = {Wed, 11 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/LinCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/winet/LeeSC13,
author = {Chia{-}Han Lee and
Cheng{-}Yu Shih and
Yu{-}Sheng Chen},
title = {Stochastic geometry based models for modeling cellular networks in
urban areas},
journal = {Wirel. Networks},
volume = {19},
number = {6},
pages = {1063--1072},
year = {2013},
url = {https://doi.org/10.1007/s11276-012-0518-0},
doi = {10.1007/S11276-012-0518-0},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/winet/LeeSC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wpc/LinCLWCCLP13,
author = {Chin{-}Feng Lin and
Shun{-}Hsyung Chang and
Chia{-}Chang Lee and
Wen{-}Chin Wu and
Wei{-}Hua Chen and
Kao{-}Hung Chang and
Jenny Chih{-}Yu Lee and
Ivan A. Parinov},
title = {Underwater Acoustic Multimedia Communication Based on {MIMO-OFDM}},
journal = {Wirel. Pers. Commun.},
volume = {71},
number = {2},
pages = {1231--1245},
year = {2013},
url = {https://doi.org/10.1007/s11277-012-0871-4},
doi = {10.1007/S11277-012-0871-4},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wpc/LinCLWCCLP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/LeeWLLLWCCLC13,
author = {Ying{-}Li Lee and
Tzuning Wen and
Sheng Chieh Lu and
Chia Wei Lin and
Ching{-}lin Lai and
Meng{-}Ping Wu and
Shuo{-}Ju Chiang and
Mei{-}Ju Chen and
Chien{-}Hsien Lee and
Polun Chang},
title = {How many materials needed to facilitate the middle age and elderly
to learn using smartphones?},
booktitle = {{AMIA} 2013, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 16-20, 2013},
publisher = {{AMIA}},
year = {2013},
url = {https://knowledge.amia.org/amia-55142-a2013e-1.580047/t-06-1.582200/f-006-1.582201/a-288-1.583133/a-289-1.583127},
timestamp = {Wed, 17 Apr 2024 11:47:55 +0200},
biburl = {https://dblp.org/rec/conf/amia/LeeWLLLWCCLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asru/LiLCCL13,
author = {Yun{-}Chiao Li and
Hung{-}yi Lee and
Cheng{-}Tao Chung and
Chun{-}an Chan and
Lin{-}Shan Lee},
title = {Towards unsupervised semantic retrieval of spoken content with query
expansion based on automatically discovered acoustic patterns},
booktitle = {2013 {IEEE} Workshop on Automatic Speech Recognition and Understanding,
Olomouc, Czech Republic, December 8-12, 2013},
pages = {198--203},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ASRU.2013.6707729},
doi = {10.1109/ASRU.2013.6707729},
timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asru/LiLCCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/LiuCCTLY13,
author = {Yao{-}Chia Liu and
Wei{-}Zen Chen and
Mao{-}Hsuan Chou and
Tsung{-}Hsien Tsai and
Yen{-}Wei Lee and
Min{-}Shueh Yuan},
title = {A 0.1-3GHz cell-based fractional-N all digital phase-locked loop using
{\(\Delta\)}{\(\Sigma\)} noise-shaped phase detector},
booktitle = {Proceedings of the {IEEE} 2013 Custom Integrated Circuits Conference,
{CICC} 2013, San Jose, CA, USA, September 22-25, 2013},
pages = {1--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CICC.2013.6658528},
doi = {10.1109/CICC.2013.6658528},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/LiuCCTLY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisis/LeeLFTW13,
author = {Trong{-}Yen Lee and
Min{-}Jea Liu and
Chia{-}Chen Fan and
Chia{-}Chun Tsai and
Haixia Wu},
editor = {Leonard Barolli and
Fatos Xhafa and
Hsing{-}Chung Chen and
Antonio Fernandez G{\'{o}}mez{-}Skarmeta and
Farooq Hussain},
title = {Low Complexity Digit-Serial Multiplier over GF(2m) Using Karatsuba
Technology},
booktitle = {Seventh International Conference on Complex, Intelligent, and Software
Intensive Systems, {CISIS} 2013, Taichung, Taiwan, July 3-5, 2013},
pages = {461--466},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/CISIS.2013.84},
doi = {10.1109/CISIS.2013.84},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cisis/LeeLFTW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/LiuLHCLL13,
author = {Shih{-}Ying Sean Liu and
Chieh{-}Jui Lee and
Chuan{-}Chia Huang and
Hung{-}Ming Chen and
Chang{-}Tzu Lin and
Chia{-}Hsin Lee},
editor = {Enrico Macii},
title = {Effective power network prototyping via statistical-based clustering
and sequential linear programming},
booktitle = {Design, Automation and Test in Europe, {DATE} 13, Grenoble, France,
March 18-22, 2013},
pages = {1701--1706},
publisher = {{EDA} Consortium San Jose, CA, {USA} / {ACM} {DL}},
year = {2013},
url = {https://doi.org/10.7873/DATE.2013.343},
doi = {10.7873/DATE.2013.343},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/date/LiuLHCLL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eenergy/JengKHLTFLC13,
author = {Ru{-}Sen Jeng and
Chien{-}Yu Kuo and
Yao{-}Hua Ho and
Ming{-}Feng Lee and
Lin{-}Wen Tseng and
Chia{-}Lin Fu and
Pei{-}Fang Liang and
Ling{-}Jyh Chen},
editor = {David E. Culler and
Catherine Rosenberg and
Srinivasan Keshav and
Jim Kurose},
title = {Missing data handling for meter data management system},
booktitle = {The Fourth International Conference on Future Energy Systems, e-Energy
'13, Berkeley, CA, USA, May 22-24, 2013},
pages = {275--276},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2487166.2487204},
doi = {10.1145/2487166.2487204},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eenergy/JengKHLTFLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ChiuMYL13,
author = {Hung{-}Jui Chiu and
Ling{-}San Meng and
Ping{-}Cheng Yeh and
Chia{-}Han Lee},
title = {Near-optimal low complexity receiver design for diffusion-based molecular
communication},
booktitle = {2013 {IEEE} Global Communications Conference, {GLOBECOM} 2013, Atlanta,
GA, USA, December 9-13, 2013},
pages = {3372--3377},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/GLOCOM.2013.6831593},
doi = {10.1109/GLOCOM.2013.6831593},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/ChiuMYL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/HuangLLLY13,
author = {Jiun{-}Ting Huang and
Hsin{-}Yu Lai and
Yen{-}Chi Lee and
Chia{-}Han Lee and
Ping{-}Cheng Yeh},
title = {Distance estimation in concentration-based molecular communications},
booktitle = {2013 {IEEE} Global Communications Conference, {GLOBECOM} 2013, Atlanta,
GA, USA, December 9-13, 2013},
pages = {2587--2591},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/GLOCOM.2013.6831464},
doi = {10.1109/GLOCOM.2013.6831464},
timestamp = {Fri, 28 Apr 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/HuangLLLY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/LiuL13a,
author = {Chen{-}Feng Liu and
Chia{-}Han Lee},
title = {Information and power transfer under {MISO} channel with finite-rate
feedback},
booktitle = {2013 {IEEE} Global Communications Conference, {GLOBECOM} 2013, Atlanta,
GA, USA, December 9-13, 2013},
pages = {2497--2501},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/GLOCOM.2013.6831449},
doi = {10.1109/GLOCOM.2013.6831449},
timestamp = {Fri, 28 Apr 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/LiuL13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/ChenWL13,
author = {Chien{-}Hsu Chen and
Shao{-}Yu Wang and
Yi{-}Chia Nina Lee},
editor = {Constantine Stephanidis and
Margherita Antona},
title = {Developing Story Performing System for Children},
booktitle = {Universal Access in Human-Computer Interaction. Applications and Services
for Quality of Life - 7th International Conference, {UAHCI} 2013,
Held as Part of {HCI} International 2013, Las Vegas, NV, USA, July
21-26, 2013, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {8011},
pages = {143--152},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39194-1\_17},
doi = {10.1007/978-3-642-39194-1\_17},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/ChenWL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/LeeSC13,
author = {Yi{-}Chia Nina Lee and
Li{-}Ting Shan and
Chien{-}Hsu Chen},
editor = {Randall Shumaker},
title = {System Development of Immersive Technology Theatre in Museum},
booktitle = {Virtual, Augmented and Mixed Reality. Systems and Applications - 5th
International Conference, {VAMR} 2013, Held as Part of {HCI} International
2013, Las Vegas, NV, USA, July 21-26, 2013, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {8022},
pages = {400--408},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39420-1\_42},
doi = {10.1007/978-3-642-39420-1\_42},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/LeeSC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LeeLCL13,
author = {Hung{-}yi Lee and
Yun{-}Chiao Li and
Cheng{-}Tao Chung and
Lin{-}Shan Lee},
title = {Enhancing query expansion for semantic retrieval of spoken content
with automatically discovered acoustic patterns},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2013, Vancouver, BC, Canada, May 26-31, 2013},
pages = {8297--8301},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICASSP.2013.6639283},
doi = {10.1109/ICASSP.2013.6639283},
timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/LeeLCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnsc/HsuCHL13,
author = {Kou{-}Cheng Hsu and
Hsin{-}Han Chiang and
Chin{-}I Huang and
Tsu{-}Tian Lee},
title = {Optimized adaptive sliding-mode position control system for linear
induction motor drive},
booktitle = {Proceedings of 10th {IEEE} International Conference on Networking,
Sensing and Control, {ICNSC} 2013, Evry, France, April 10-12, 2013},
pages = {355--360},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICNSC.2013.6548763},
doi = {10.1109/ICNSC.2013.6548763},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icnsc/HsuCHL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieaaie/JengL13,
author = {Albert B. Jeng and
Chia Ling Lee},
editor = {Moonis Ali and
Tibor Bosse and
Koen V. Hindriks and
Mark Hoogendoorn and
Catholijn M. Jonker and
Jan Treur},
title = {A Study on Online Game Cheating and the Effective Defense},
booktitle = {Recent Trends in Applied Artificial Intelligence, 26th International
Conference on Industrial, Engineering and Other Applications of Applied
Intelligent Systems, {IEA/AIE} 2013, Amsterdam, The Netherlands, June
17-21, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7906},
pages = {518--527},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38577-3\_53},
doi = {10.1007/978-3-642-38577-3\_53},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/ieaaie/JengL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ChiangSCL13,
author = {Chen{-}Yu Chiang and
Sabato Marco Siniscalchi and
Sin{-}Horng Chen and
Chin{-}Hui Lee},
editor = {Fr{\'{e}}d{\'{e}}ric Bimbot and
Christophe Cerisara and
C{\'{e}}cile Fougeron and
Guillaume Gravier and
Lori Lamel and
Fran{\c{c}}ois Pellegrino and
Pascal Perrier},
title = {Knowledge integration for improving performance in {LVCSR}},
booktitle = {14th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2013, Lyon, France, August 25-29, 2013},
pages = {1786--1790},
publisher = {{ISCA}},
year = {2013},
url = {https://doi.org/10.21437/Interspeech.2013-442},
doi = {10.21437/INTERSPEECH.2013-442},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/ChiangSCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChangYLLLCCHJTHHKCWWLCS13,
author = {Chi{-}Shin Chang and
Hao{-}I Yang and
Wei{-}Nan Liao and
Yi{-}Wei Lin and
Nan{-}Chun Lien and
Chien{-}Hen Chen and
Ching{-}Te Chuang and
Wei Hwang and
Shyh{-}Jye Jou and
Ming{-}Hsien Tu and
Huan{-}Shun Huang and
Yong{-}Jyun Hu and
Paul{-}Sen Kan and
Cheng{-}Yo Cheng and
Wei{-}Chang Wang and
Jian{-}Hao Wang and
Kuen{-}Di Lee and
Chia{-}Cheng Chen and
Wei{-}Chiang Shih},
title = {A 40nm 1.0Mb pipeline 6T {SRAM} with variation-tolerant Step-Up Word-Line
and Adaptive Data-Aware Write-Assist},
booktitle = {2013 {IEEE} International Symposium on Circuits and Systems (ISCAS2013),
Beijing, China, May 19-23, 2013},
pages = {1468--1471},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISCAS.2013.6572134},
doi = {10.1109/ISCAS.2013.6572134},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ChangYLLLCCHJTHHKCWWLCS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/WangHCLC13,
author = {Yuh{-}Jiun Wang and
Szu{-}Lu Hsu and
Teng{-}Yuan Cheng and
Chia{-}Han Lee and
Shao{-}Yi Chien},
title = {Low-complexity feedback-channel-free distributed video coding with
enhanced classifier},
booktitle = {2013 {IEEE} International Symposium on Circuits and Systems (ISCAS2013),
Beijing, China, May 19-23, 2013},
pages = {257--260},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISCAS.2013.6571831},
doi = {10.1109/ISCAS.2013.6571831},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/WangHCLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isce/LeeYHWHCLC13,
author = {Yi{-}Chia Lee and
Chia{-}Yu Yao and
Cheng{-}Yu Hsieh and
Jau{-}Yi Wu and
Yi{-}Hsuan Hsieh and
Chien{-}Hsiung Chen and
Rung{-}Huei Liang and
Ya{-}Shu Chen},
title = {Egg Pair - {A} hearing game for the visually impaired people using
{RFID}},
booktitle = {{IEEE} International Symposium on Consumer Electronics, {ISCE} 2013,
Hsinchu City, Taiwan, June 3-6, 2013},
pages = {3--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISCE.2013.6570237},
doi = {10.1109/ISCE.2013.6570237},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isce/LeeYHWHCLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispd/LuoZCCLSSKS13,
author = {Pei{-}Wen Luo and
Chun Zhang and
Yung{-}Tai Chang and
Liang{-}Chia Cheng and
Hung{-}Hsie Lee and
Bih{-}Lan Sheu and
Yu{-}Shih Su and
Ding{-}Ming Kwai and
Yiyu Shi},
editor = {Cheng{-}Kok Koh and
Cliff C. N. Sze},
title = {Benchmarking for research in power delivery networks of three-dimensional
integrated circuits},
booktitle = {International Symposium on Physical Design, ISPD'13, Stateline, NV,
USA, March 24-27, 2013},
pages = {17--24},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2451916.2451922},
doi = {10.1145/2451916.2451922},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispd/LuoZCCLSSKS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/JiangCHLYL13,
author = {Jhih{-}Yu Jiang and
Ping{-}Chuan Chiang and
Hao{-}Wei Hung and
Chen{-}Lun Lin and
Ty Yoon and
Jri Lee},
title = {100Gb/s ethernet chipsets in 65nm {CMOS} technology},
booktitle = {2013 {IEEE} International Solid-State Circuits Conference - Digest
of Technical Papers, {ISSCC} 2013, San Francisco, CA, USA, February
17-21, 2013},
pages = {120--121},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISSCC.2013.6487663},
doi = {10.1109/ISSCC.2013.6487663},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/JiangCHLYL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LeeCCL13,
author = {Jen{-}Wei Lee and
Szu{-}Chi Chung and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {Processor with side-channel attack resistance},
booktitle = {2013 {IEEE} International Solid-State Circuits Conference - Digest
of Technical Papers, {ISSCC} 2013, San Francisco, CA, USA, February
17-21, 2013},
pages = {50--51},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISSCC.2013.6487632},
doi = {10.1109/ISSCC.2013.6487632},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/LeeCCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/GoelAWCHMLCKVMSCLCK13,
author = {Sandeep Kumar Goel and
Saman Adham and
Min{-}Jer Wang and
Ji{-}Jan Chen and
Tze{-}Chiang Huang and
Ashok Mehta and
Frank Lee and
Vivek Chickermane and
Brion L. Keller and
Thomas Valind and
Subhasish Mukherjee and
Navdeep Sood and
Jeongho Cho and
Hayden Hyungdong Lee and
Jungi Choi and
Sangdoo Kim},
title = {Test and debug strategy for {TSMC} CoWoS{\texttrademark} stacking
process based heterogeneous 3D {IC:} {A} silicon case study},
booktitle = {2013 {IEEE} International Test Conference, {ITC} 2013, Anaheim, CA,
USA, September 6-13, 2013},
pages = {1--10},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/TEST.2013.6651893},
doi = {10.1109/TEST.2013.6651893},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itc/GoelAWCHMLCKVMSCLCK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memea/WangLLLFLLCW13,
author = {Wei{-}Wen Wang and
Kai{-}Wen Lee and
Sheng{-}Yen Lin and
Chia{-}Hsun Lin and
Li{-}Chen Fu and
Jin{-}Shin Lai and
Jer{-}Junn Luh and
Wen{-}Shiang Chen and
Tyng{-}Guey Wang},
title = {A joint localizer for finger length measurements},
booktitle = {{IEEE} International Symposium on Medical Measurements and Applications,
MeMeA 2013, Gatineau, QC, Canada, May 4-5, 2013, Proceedings},
pages = {111--115},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/MeMeA.2013.6549717},
doi = {10.1109/MEMEA.2013.6549717},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/memea/WangLLLFLLCW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mva/ChiangTL13,
author = {Cheng{-}Chieh Chiang and
Cheng{-}Chuan Tsai and
Greg C. Lee},
title = {Vision-based Raising Hand Detection in Classroom},
booktitle = {Proceedings of the 13. {IAPR} International Conference on Machine
Vision Applications, {MVA} 2013, Kyoto, Japan, May 20-23, 2013},
pages = {61--64},
year = {2013},
url = {http://www.mva-org.jp/Proceedings/2013USB/papers/04-07.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mva/ChiangTL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/ChenSCHHZLLLW13,
author = {Chin{-}Ta Chen and
Po{-}Kuan Shen and
Chia{-}Chi Chang and
Hsu{-}Liang Hsiao and
Tien{-}Yu Huan and
Teng{-}Zhang Zhu and
Hsiao{-}Chin Lan and
Yun{-}Chih Lee and
Yo{-}Shen Lin and
Mount{-}Learn Wu},
title = {Polymer-based vertically optical splitter with 20-Gbps transmission
rate realized on silicon substrate},
booktitle = {2013 Optical Fiber Communication Conference and Exposition and the
National Fiber Optic Engineers Conference (OFC/NFOEC), Anaheim, CA,
USA, March 17-21, 2013},
pages = {1--3},
publisher = {{IEEE}},
year = {2013},
url = {https://ieeexplore.ieee.org/document/6532992},
timestamp = {Thu, 26 Sep 2024 15:12:51 +0200},
biburl = {https://dblp.org/rec/conf/ofc/ChenSCHHZLLLW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/LuCWCLHLC13,
author = {I{-}Cheng Lu and
Hsing{-}Yu Chen and
Chia{-}Chien Wei and
Yu{-}Chieh Chi and
Yi{-}Cheng Lee and
Dar{-}Zu Hsu and
Gong{-}Ru Lin and
Jyehong Chen},
title = {20-Gbps {WDM-PON} transmissions employing weak-resonant-cavity {FPLD}
with {OFDM} and {SC-FDE} modulation formats},
booktitle = {2013 Optical Fiber Communication Conference and Exposition and the
National Fiber Optic Engineers Conference (OFC/NFOEC), Anaheim, CA,
USA, March 17-21, 2013},
pages = {1--3},
publisher = {{IEEE}},
year = {2013},
url = {https://ieeexplore.ieee.org/document/6532562},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/LuCWCLHLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rvsp/ChenLLTL13,
author = {Yi{-}Ting Chen and
Bin{-}Yih Liao and
Chin{-}Feng Lee and
Wu{-}Der Tsay and
Mei{-}Chiao Lai},
title = {An Adjustable Frequency Bat Algorithm Based on Flight Direction to
Improve Solution Accuracy for Optimization Problems},
booktitle = {Second International Conference on Robot, Vision and Signal Processing,
{RVSP} 2013, Kitakyushu, Japan, December 10-12, 2013},
pages = {172--177},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/RVSP.2013.47},
doi = {10.1109/RVSP.2013.47},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rvsp/ChenLLTL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ChenL13,
author = {Ruey{-}Cheng Chen and
Chia{-}Jung Lee},
editor = {Gareth J. F. Jones and
Paraic Sheridan and
Diane Kelly and
Maarten de Rijke and
Tetsuya Sakai},
title = {An information-theoretic account of static index pruning},
booktitle = {The 36th International {ACM} {SIGIR} conference on research and development
in Information Retrieval, {SIGIR} '13, Dublin, Ireland - July 28 -
August 01, 2013},
pages = {163--172},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2484028.2484061},
doi = {10.1145/2484028.2484061},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/ChenL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/snpd/WeiCL13,
author = {Chia{-}Ching Wei and
Thao{-}Tsen Chen and
Shie{-}Jue Lee},
title = {k-NN Based Neuro-fuzzy System for Time Series Prediction},
booktitle = {14th {ACIS} International Conference on Software Engineering, Artificial
Intelligence, Networking and Parallel/Distributed Computing, {SNPD}
2013, Honolulu, Hawaii, USA, 1-3 July, 2013},
pages = {569--574},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/SNPD.2013.68},
doi = {10.1109/SNPD.2013.68},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/snpd/WeiCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/ChenLLTC13,
author = {Chien{-}Liang Chen and
Chao{-}Lin Liu and
Chia{-}Ying Lee and
Yu{-}Lin Tzeng and
Chia{-}Ju Chou},
title = {Linking Statistics of Betting Behavior to Difficulties of Test Items:
An Exploration},
booktitle = {Conference on Technologies and Applications of Artificial Intelligence,
{TAAI} 2013, Taipei, Taiwan, December 6-8, 2013},
pages = {109--114},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/TAAI.2013.33},
doi = {10.1109/TAAI.2013.33},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/taai/ChenLLTC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/WeiLHSC13,
author = {Shu{-}Han Wei and
Yu{-}Min Lee and
Chia{-}Tung Ho and
Chih{-}Ting Sun and
Liang{-}Chia Cheng},
title = {Power delivery network design for wiring and {TSV} resource minimization
in TSV-based 3-D ICs},
booktitle = {2013 International Symposium on {VLSI} Design, Automation, and Test,
{VLSI-DAT} 2013, Hsinchu, Taiwan, April 22-24, 2013},
pages = {1--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/VLDI-DAT.2013.6533816},
doi = {10.1109/VLDI-DAT.2013.6533816},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/WeiLHSC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/ChenCUL13,
author = {Yen{-}Ming Chen and
Chia{-}Wei Chen and
Yeong{-}Luh Ueng and
Huang{-}Chang Lee},
title = {Look-Up Table Based Differential Amplitude/Phase Modulation Schemes
for Rayleigh Block Fading Channels},
booktitle = {Proceedings of the 78th {IEEE} Vehicular Technology Conference, {VTC}
Fall 2013, Las Vegas, NV, USA, September 2-5, 2013},
pages = {1--5},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/VTCFall.2013.6692271},
doi = {10.1109/VTCFALL.2013.6692271},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vtc/ChenCUL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ShihL13,
author = {Cheng{-}Yu Shih and
Chia{-}Han Lee},
title = {Coverage analysis of femtocell networks with hybrid access policy},
booktitle = {2013 {IEEE} Wireless Communications and Networking Conference (WCNC),
Shanghai, Shanghai, China, April 7-10, 2013},
pages = {2091--2095},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/WCNC.2013.6554885},
doi = {10.1109/WCNC.2013.6554885},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/ShihL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcgenomics/WangLCLYCL12,
author = {Nai{-}Jyuan Wang and
Chi{-}Ching Lee and
Chao{-}Sheng Cheng and
Wei{-}Cheng Lo and
Ya{-}Fen Yang and
Ming{-}Nan Chen and
Ping{-}Chiang Lyu},
title = {Construction and analysis of a plant non-specific lipid transfer protein
database (nsLTPDB)},
journal = {{BMC} Genom.},
volume = {13},
number = {{S-1}},
pages = {S9},
year = {2012},
url = {https://doi.org/10.1186/1471-2164-13-S1-S9},
doi = {10.1186/1471-2164-13-S1-S9},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcgenomics/WangLCLYCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/SheCLWCLCC12,
author = {Hsiao{-}Ching She and
Meng{-}Tzu Cheng and
Ta{-}Wei Li and
Chia{-}Yu Wang and
Hsin{-}Tien Chiu and
Pei{-}Zon Lee and
Wen{-}Chi Chou and
Ming{-}Hua Chuang},
title = {Web-based undergraduate chemistry problem-solving: The interplay of
task performance, domain knowledge and web-searching strategies},
journal = {Comput. Educ.},
volume = {59},
number = {2},
pages = {750--761},
year = {2012},
url = {https://doi.org/10.1016/j.compedu.2012.02.005},
doi = {10.1016/J.COMPEDU.2012.02.005},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ce/SheCLWCLCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cee/OoiSL12,
author = {Chia Yee Ooi and
Jia Pao Sua and
Siaw Chen Lee},
title = {Power-aware system-on-chip test scheduling using enhanced rectangle
packing algorithm},
journal = {Comput. Electr. Eng.},
volume = {38},
number = {6},
pages = {1444--1455},
year = {2012},
url = {https://doi.org/10.1016/j.compeleceng.2012.04.010},
doi = {10.1016/J.COMPELECENG.2012.04.010},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cee/OoiSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cma/ShihLCC12,
author = {Hsu{-}Shih Shih and
E. Stanley Lee and
Shun{-}Hsiang Chuang and
Chiau{-}Ching Chen},
title = {A forecasting decision on the sales volume of printers in Taiwan:
An exploitation of the Analytic Network Process},
journal = {Comput. Math. Appl.},
volume = {64},
number = {6},
pages = {1545--1556},
year = {2012},
url = {https://doi.org/10.1016/j.camwa.2011.12.082},
doi = {10.1016/J.CAMWA.2011.12.082},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cma/ShihLCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/heuristics/LiangLC12,
author = {Yun{-}Chia Liang and
Zu{-}Hsu Lee and
Yu{-}Shen Chen},
title = {A novel ant colony optimization approach for on-line scheduling and
due date determination},
journal = {J. Heuristics},
volume = {18},
number = {4},
pages = {571--591},
year = {2012},
url = {https://doi.org/10.1007/s10732-012-9199-1},
doi = {10.1007/S10732-012-9199-1},
timestamp = {Thu, 18 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/heuristics/LiangLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijebm/LeeCC12,
author = {Chih{-}Cheng Lee and
Chi Chiang and
Chen{-}Tung Chen},
title = {An Evaluation Model of E-service Quality by Applying Hierarchical
Fuzzy {TOPSIS} Method},
journal = {Int. J. Electron. Bus. Manag.},
volume = {10},
number = {1},
pages = {38--49},
year = {2012},
url = {http://ijebm.ie.nthu.edu.tw/IJEBM\_Web/IJEBM\_static/Paper-V10\_N1/A05.pdf},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijebm/LeeCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsds/ChenCTCW12,
author = {Yi{-}Fen Chen and
Bi{-}Chu Chen and
Chia{-}Wen Tsai and
Wen{-}Yu Chen and
Lee{-}Wei Wei},
title = {Estimating the Global Demand of Photovoltaic System},
journal = {Int. J. Strateg. Decis. Sci.},
volume = {3},
number = {1},
pages = {120--128},
year = {2012},
url = {https://doi.org/10.4018/jsds.2012010105},
doi = {10.4018/JSDS.2012010105},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsds/ChenCTCW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/LeeLCW12,
author = {Jonathan Lee and
Shin{-}Jie Lee and
Hsi{-}Min Chen and
Chia{-}Ling Wu},
title = {Composing web services enacted by autonomous agents through agent-centric
contract net protocol},
journal = {Inf. Softw. Technol.},
volume = {54},
number = {9},
pages = {951--967},
year = {2012},
url = {https://doi.org/10.1016/j.infsof.2012.03.001},
doi = {10.1016/J.INFSOF.2012.03.001},
timestamp = {Thu, 24 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/infsof/LeeLCW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jaihc/LeeSLL12,
author = {Chien{-}Cheng Lee and
Cheng{-}Yuan Shih and
Wen{-}Ping Lai and
Po{-}Chiang Lin},
title = {An improved boosting algorithm and its application to facial emotion
recognition},
journal = {J. Ambient Intell. Humaniz. Comput.},
volume = {3},
number = {1},
pages = {11--17},
year = {2012},
url = {https://doi.org/10.1007/s12652-011-0085-8},
doi = {10.1007/S12652-011-0085-8},
timestamp = {Mon, 10 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jaihc/LeeSLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/YuSDCWLTJALHCL12,
author = {Hwan{-}Jeu Yu and
Chia{-}Ping Shen and
Sarangerel Dorjgochoo and
Chi{-}Huang Chen and
Jin{-}Ming Wu and
Mei{-}Shu Lai and
Ching{-}Ting Tan and
Chinburen Jigjidsuren and
Erdenebaatar Altangerel and
Hung{-}Chang Lee and
Chih{-}Wen Hsueh and
Yu{-}Fang Chung and
Feipei Lai},
title = {A Physician Order Category-Based Clinical Guideline Comparison System},
journal = {J. Medical Syst.},
volume = {36},
number = {6},
pages = {3741--3753},
year = {2012},
url = {https://doi.org/10.1007/s10916-012-9847-x},
doi = {10.1007/S10916-012-9847-X},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/YuSDCWLTJALHCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenLCL12,
author = {Chih{-}Lung Chen and
Yu{-}Hsiang Lin and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 2.37-Gb/s 284.8 mW Rate-Compatible (491, 3, 6) {LDPC-CC} Decoder},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {4},
pages = {817--831},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2185193},
doi = {10.1109/JSSC.2012.2185193},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenLCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LiaoCWTCCHLJYLLCSHHWLTYLJYCP12,
author = {Shyuan Liao and
Yen{-}Shuo Chang and
Chia{-}Hsin Wu and
Hung{-}Chieh Tsai and
Hsin{-}Hua Chen and
Min Chen and
Ching{-}Wen Hsueh and
Jian{-}Bang Lin and
Den{-}Kai Juang and
Shun{-}An Yang and
Chin{-}Tai Liu and
Tsai{-}Pao Lee and
Jin{-}Ru Chen and
Chih{-}Heng Shih and
Barry Hong and
Heng{-}Ruey Hsu and
Chih{-}Yuan Wang and
Meng{-}Shiang Lin and
Wei{-}Hsiang Tseng and
Che{-}Hsiung Yang and
Lawrence Chen Lee and
Ting{-}Jyun Jheng and
Wen{-}Wei Yang and
Ming{-}Yang Chao and
Jyh{-}Shin Pan},
title = {A 70-Mb/s 100.5-dBm Sensitivity 65-nm {LP} {MIMO} Chipset for WiMAX
Portable Router},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {61--74},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2167811},
doi = {10.1109/JSSC.2011.2167811},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LiaoCWTCCHLJYLLCSHHWLTYLJYCP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YenHCCJL12,
author = {Shao{-}Wei Yen and
Shiang{-}Yu Hung and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Shyh{-}Jye Jou and
Chen{-}Yi Lee},
title = {A 5.79-Gb/s Energy-Efficient Multirate {LDPC} Codec Chip for {IEEE}
802.15.3c Applications},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {9},
pages = {2246--2257},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2194176},
doi = {10.1109/JSSC.2012.2194176},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YenHCCJL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/ChenCLC12,
author = {Chun{-}Hao Chen and
Rui{-}Dong Chiang and
Cho{-}Ming Lee and
Chih{-}Yang Chen},
title = {Improving the performance of association classifiers by rule prioritization},
journal = {Knowl. Based Syst.},
volume = {36},
pages = {59--67},
year = {2012},
url = {https://doi.org/10.1016/j.knosys.2012.06.004},
doi = {10.1016/J.KNOSYS.2012.06.004},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/ChenCLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/monet/ChenSCL12,
author = {Ling{-}Jyh Chen and
Yu{-}Song Syu and
Hung{-}Chia Chen and
Wang{-}Chien Lee},
title = {The Design and Evaluation of Task Assignment Algorithms for GWAP-based
Geospatial Tagging Systems},
journal = {Mob. Networks Appl.},
volume = {17},
number = {3},
pages = {395--414},
year = {2012},
url = {https://doi.org/10.1007/s11036-011-0314-6},
doi = {10.1007/S11036-011-0314-6},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/monet/ChenSCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/JengCCYLCLLC12,
author = {Ming{-}Jer Jeng and
Kuo{-}Ling Chiang and
Hsin{-}Yi Chang and
Chia{-}Yi Yen and
Cheng{-}Chen Lin and
Yuan{-}Hsiao Chang and
Mu{-}Jen Lai and
Yu{-}Lin Lee and
Liann{-}Be Chang},
title = {Heat sink performances of GaN/InGaN flip-chip light-emitting diodes
fabricated on silicon and AlN submounts},
journal = {Microelectron. Reliab.},
volume = {52},
number = {5},
pages = {884--888},
year = {2012},
url = {https://doi.org/10.1016/j.microrel.2011.04.013},
doi = {10.1016/J.MICROREL.2011.04.013},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/JengCCYLCLLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/ChiangWL12,
author = {Cheng{-}Chieh Chiang and
Jia{-}Wei Wu and
Greg C. Lee},
title = {Probabilistic semantic component descriptor},
journal = {Multim. Tools Appl.},
volume = {59},
number = {2},
pages = {629--643},
year = {2012},
url = {https://doi.org/10.1007/s11042-011-0726-0},
doi = {10.1007/S11042-011-0726-0},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/ChiangWL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/LeeH12,
author = {Ju{-}Hong Lee and
Chia{-}Cheng Huang},
title = {Robust cyclic adaptive beamforming using a compensation method},
journal = {Signal Process.},
volume = {92},
number = {4},
pages = {954--962},
year = {2012},
url = {https://doi.org/10.1016/j.sigpro.2011.10.008},
doi = {10.1016/J.SIGPRO.2011.10.008},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/LeeH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/LeeC12,
author = {Wen{-}Chia Lee and
Chin{-}Hsing Chen},
title = {A Fast Template Matching Method With Rotation Invariance by Combining
the Circular Projection Transform Process and Bounded Partial Correlation},
journal = {{IEEE} Signal Process. Lett.},
volume = {19},
number = {11},
pages = {737--740},
year = {2012},
url = {https://doi.org/10.1109/LSP.2012.2212010},
doi = {10.1109/LSP.2012.2212010},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spl/LeeC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/LeeCL12,
author = {Hung{-}yi Lee and
Chia{-}Ping Chen and
Lin{-}Shan Lee},
title = {Integrating Recognition and Retrieval With Relevance Feedback for
Spoken Term Detection},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {20},
number = {7},
pages = {2095--2110},
year = {2012},
url = {https://doi.org/10.1109/TASL.2012.2196514},
doi = {10.1109/TASL.2012.2196514},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/LeeCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/ChuangLCHLS12,
author = {Ching{-}Cheng Chuang and
Chia{-}Yen Lee and
Chung{-}Ming Chen and
Yao{-}Sheng Hsieh and
Tsan{-}Chi Liu and
Chia{-}Wei Sun},
title = {Diffuser-Aided Diffuse Optical Imaging for Breast Tumor: {A} Feasibility
Study Based on Time-Resolved Three-Dimensional Monte Carlo Modeling},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {59},
number = {5},
pages = {1454--1461},
year = {2012},
url = {https://doi.org/10.1109/TBME.2012.2187900},
doi = {10.1109/TBME.2012.2187900},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/ChuangLCHLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/WangCLTCHLLS12,
author = {Chunyang Wang and
Ming{-}Lung Chuang and
Shinn{-}Jye Liang and
Jui{-}Che Tsai and
Ching{-}Cheng Chuang and
Yao{-}Sheng Hsieh and
Chih{-}Wei Lu and
Po{-}Lei Lee and
Chia{-}Wei Sun},
title = {Diffuse Optical Multipatch Technique for Tissue Oxygenation Monitoring:
Clinical Study in Intensive Care Unit},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {59},
number = {1},
pages = {87--94},
year = {2012},
url = {https://doi.org/10.1109/TBME.2011.2147315},
doi = {10.1109/TBME.2011.2147315},
timestamp = {Wed, 04 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/WangCLTCHLLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LeeHCL12,
author = {Jen{-}Wei Lee and
Ju{-}Hung Hsiao and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {An Efficient {DPA} Countermeasure With Randomized Montgomery Operations
for {DF-ECC} Processor},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {59-II},
number = {5},
pages = {287--291},
year = {2012},
url = {https://doi.org/10.1109/TCSII.2012.2190857},
doi = {10.1109/TCSII.2012.2190857},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LeeHCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LiuCL12,
author = {Po{-}Chun Liu and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A True Random-Based Differential Power Analysis Countermeasure Circuit
for an {AES} Engine},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {59-II},
number = {2},
pages = {103--107},
year = {2012},
url = {https://doi.org/10.1109/TCSII.2011.2180094},
doi = {10.1109/TCSII.2011.2180094},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LiuCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/YuCYL12,
author = {Chien{-}Ying Yu and
Ching{-}Che Chung and
Chia{-}Jung Yu and
Chen{-}Yi Lee},
title = {A Low-Power {DCO} Using Interlaced Hysteresis Delay Cells},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {59-II},
number = {10},
pages = {673--677},
year = {2012},
url = {https://doi.org/10.1109/TCSII.2012.2213357},
doi = {10.1109/TCSII.2012.2213357},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/YuCYL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tce/HsiaoCLC12,
author = {Yi{-}Mao Hsiao and
Chia{-}Hsiang Chen and
Jeng{-}Farn Lee and
Yuan{-}Sun Chu},
title = {Designing and implementing a scalable video-streaming system using
an adaptive control scheme},
journal = {{IEEE} Trans. Consumer Electron.},
volume = {58},
number = {4},
pages = {1314--1322},
year = {2012},
url = {https://doi.org/10.1109/TCE.2012.6415001},
doi = {10.1109/TCE.2012.6415001},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tce/HsiaoCLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ChangL12,
author = {Chin{-}Chen Chang and
Chia{-}Yin Lee},
title = {A Secure Single Sign-On Mechanism for Distributed Computer Networks},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {59},
number = {1},
pages = {629--637},
year = {2012},
url = {https://doi.org/10.1109/TIE.2011.2130500},
doi = {10.1109/TIE.2011.2130500},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/ChangL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/FangLLLCL12,
author = {Yuming Fang and
Weisi Lin and
Bu{-}Sung Lee and
Chiew Tong Lau and
Zhenzhong Chen and
Chia{-}Wen Lin},
title = {Bottom-Up Saliency Detection Model Based on Human Visual Sensitivity
and Amplitude Spectrum},
journal = {{IEEE} Trans. Multim.},
volume = {14},
number = {1},
pages = {187--198},
year = {2012},
url = {https://doi.org/10.1109/TMM.2011.2169775},
doi = {10.1109/TMM.2011.2169775},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmm/FangLLLCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/YehCLMSKLL12,
author = {Ping{-}Cheng Yeh and
Kwang{-}Cheng Chen and
Yen{-}Chi Lee and
Ling{-}San Meng and
Po{-}Jen Shih and
Pin{-}Yu Ko and
Wei{-}An Lin and
Chia{-}han Lee},
title = {A new frontier of wireless communication theory: diffusion-based molecular
communications},
journal = {{IEEE} Wirel. Commun.},
volume = {19},
number = {5},
pages = {28--35},
year = {2012},
url = {https://doi.org/10.1109/MWC.2012.6339469},
doi = {10.1109/MWC.2012.6339469},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wc/YehCLMSKLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/airs/HuangLC12,
author = {Hen{-}Hsen Huang and
Chia{-}Chun Lee and
Hsin{-}Hsi Chen},
editor = {Yuexian Hou and
Jian{-}Yun Nie and
Le Sun and
Bo Wang and
Peng Zhang},
title = {Outpatient Department Recommendation Based on Medical Summaries},
booktitle = {Information Retrieval Technology, 8th Asia Information Retrieval Societies
Conference, {AIRS} 2012, Tianjin, China, December 17-19, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7675},
pages = {518--527},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-35341-3\_47},
doi = {10.1007/978-3-642-35341-3\_47},
timestamp = {Wed, 26 Aug 2020 16:28:48 +0200},
biburl = {https://dblp.org/rec/conf/airs/HuangLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apccas/HsiaoWLL12,
author = {Shen{-}Fu Hsiao and
Chia{-}Sheng Wen and
Cheng{-}Han Lee and
Andrew Lee},
title = {Low-cost designs of rectangular to polar coordinate converters for
digital communication},
booktitle = {{IEEE} Asia Pacific Conference on Circuits and Systems, {APCCAS} 2012,
Kaohsiung, Taiwan, December 2-5, 2012},
pages = {511--514},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/APCCAS.2012.6419084},
doi = {10.1109/APCCAS.2012.6419084},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/apccas/HsiaoWLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apccas/LiuTWLL12,
author = {Chia{-}Lin Liu and
Chang{-}Hung Tsai and
Hsiuan{-}Ting Wang and
Yao Li and
Chen{-}Yi Lee},
title = {A memory-efficient architecture for intra predictor and de-blocking
filter in video coding system},
booktitle = {{IEEE} Asia Pacific Conference on Circuits and Systems, {APCCAS} 2012,
Kaohsiung, Taiwan, December 2-5, 2012},
pages = {555--558},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/APCCAS.2012.6419095},
doi = {10.1109/APCCAS.2012.6419095},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/apccas/LiuTWLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apccas/WangLLTCJCLSLC12,
author = {Shao{-}Cheng Wang and
Geng{-}Cing Lin and
Yi{-}Wei Lin and
Ming{-}Chien Tsai and
Yi{-}Wei Chiu and
Shyh{-}Jye Jou and
Ching{-}Te Chuang and
Nan{-}Chun Lien and
Wei{-}Chiang Shih and
Kuen{-}Di Lee and
Jyun{-}Kai Chu},
title = {Design and implementation of dynamic Word-Line pulse write margin
monitor for {SRAM}},
booktitle = {{IEEE} Asia Pacific Conference on Circuits and Systems, {APCCAS} 2012,
Kaohsiung, Taiwan, December 2-5, 2012},
pages = {116--119},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/APCCAS.2012.6418985},
doi = {10.1109/APCCAS.2012.6418985},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/apccas/WangLLTCJCLSLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/ChiuWCLSC12,
author = {Chieh{-}Chuan Chiu and
Hsin{-}Fang Wu and
Shao{-}Yi Chien and
Chia{-}Han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen},
title = {Hardware architecture design of hybrid distributed video coding with
frame level coding mode selection},
booktitle = {Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} 2012, Hollywood, CA, USA, December
3-6, 2012},
pages = {1--4},
publisher = {{IEEE}},
year = {2012},
url = {https://ieeexplore.ieee.org/document/6411963/},
timestamp = {Sun, 08 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/apsipa/ChiuWCLSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aspdac/ChienCCTLSC12,
author = {Shao{-}Yi Chien and
Teng{-}Yuan Cheng and
Chieh{-}Chuan Chiu and
Pei{-}Kuei Tsung and
Chia{-}han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen},
title = {Power optimization of wireless video sensor nodes in {M2M} networks},
booktitle = {Proceedings of the 17th Asia and South Pacific Design Automation Conference,
{ASP-DAC} 2012, Sydney, Australia, January 30 - February 2, 2012},
pages = {401--405},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ASPDAC.2012.6164981},
doi = {10.1109/ASPDAC.2012.6164981},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aspdac/ChienCCTLSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ches/LeeCCL12,
author = {Jen{-}Wei Lee and
Szu{-}Chi Chung and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
editor = {Emmanuel Prouff and
Patrick Schaumont},
title = {An Efficient Countermeasure against Correlation Power-Analysis Attacks
with Randomized Montgomery Operations for {DF-ECC} Processor},
booktitle = {Cryptographic Hardware and Embedded Systems - {CHES} 2012 - 14th International
Workshop, Leuven, Belgium, September 9-12, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7428},
pages = {548--564},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-33027-8\_32},
doi = {10.1007/978-3-642-33027-8\_32},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ches/LeeCCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/ChenLTH12,
author = {Ruey{-}Cheng Chen and
Chia{-}Jung Lee and
Chiung{-}Min Tsai and
Jieh Hsiang},
editor = {Xue{-}wen Chen and
Guy Lebanon and
Haixun Wang and
Mohammed J. Zaki},
title = {Information preservation in static index pruning},
booktitle = {21st {ACM} International Conference on Information and Knowledge Management,
CIKM'12, Maui, HI, USA, October 29 - November 02, 2012},
pages = {2487--2490},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2396761.2398673},
doi = {10.1145/2396761.2398673},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/ChenLTH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cso/ChouSHCCLCCCC12,
author = {Chun{-}Mei Chou and
Chien{-}Hua Shen and
Hsi{-}Chi Hsiao and
Hui{-}Tzu Chang and
Ying{-}Jung Chen and
Wan{-}Hsuan Lee and
Su{-}Chang Chen and
Chin{-}Pin Chen and
Jen{-}Chia Chang and
Shih{-}Hsien Chuang},
editor = {Yanling Hao and
Lean Yu},
title = {Analysis of students' employability self-efficacy and entrepreneurial
career intention: using labor market information as a mediator variable},
booktitle = {Fifth International Joint Conference on Computational Sciences and
Optimization, {CSO} 2012, Harbin, Heilongjiang, China, June 23-26,
2012},
pages = {32--35},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/CSO.2012.205},
doi = {10.1109/CSO.2012.205},
timestamp = {Wed, 07 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cso/ChouSHCCLCCCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/PatilJCLYPLCC12,
author = {Shruti Patil and
Min{-}Woo Jang and
Chia{-}Ling Chen and
Dongjin Lee and
Zhijang Ye and
Walter E. Partlo and
David J. Lilja and
Stephen A. Campbell and
Tianhong Cui},
editor = {Wolfgang Rosenstiel and
Lothar Thiele},
title = {Weighted area technique for electromechanically enabled logic computation
with cantilever-based {NEMS} switches},
booktitle = {2012 Design, Automation {\&} Test in Europe Conference {\&}
Exhibition, {DATE} 2012, Dresden, Germany, March 12-16, 2012},
pages = {727--732},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/DATE.2012.6176565},
doi = {10.1109/DATE.2012.6176565},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/PatilJCLYPLCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
author = {Socrates D. Vamvakos and
Bendik Kleveland and
Dipak K. Sikdar and
B. K. Ahuja and
Haidang Lin and
Jayaprakash Balachandran and
Wignes Balakrishnan and
Aldo Bottelli and
Jawji Chen and
Xiaole Chen and
Jae Choi and
Jeong Choi and
Rajesh Chopra and
Sanjay Dabral and
Kalyan Dasari and
Ronald B. David and
Shaishav Desai and
Claude R. Gauthier and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Ramosan Canagasaby and
Jeff Kumala and
E. P. Kwon and
Ben Lee and
Ming Liu and
Gurupada Mandal and
Sundari Mitra and
Byeong Cheol Na and
Siddharth Panwar and
Jay Patel and
Chethan Rao and
Vithal Rao and
Richard Rouse and
Ritesh Saraf and
Subramanian Seshadri and
Jae{-}K. Sim and
Clement Szeto and
Alvin Wang and
Jason Yeung},
title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
ns latency},
booktitle = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
2012, Bordeaux, France, September 17-21, 2012},
pages = {458--461},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ESSCIRC.2012.6341354},
doi = {10.1109/ESSCIRC.2012.6341354},
timestamp = {Thu, 26 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/DenisTLTL12,
author = {Juwendo Denis and
Chia{-}Shiang Tseng and
Cheng{-}Wei Lee and
Chia{-}Yu Tsai and
Che Lin},
title = {Deterministic bisection search algorithm for distributed sensor/relay
networks},
booktitle = {2012 {IEEE} Global Communications Conference, {GLOBECOM} 2012, Anaheim,
CA, USA, December 3-7, 2012},
pages = {4851--4855},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/GLOCOM.2012.6503887},
doi = {10.1109/GLOCOM.2012.6503887},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/DenisTLTL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/KoLYLC12,
author = {Pin{-}Yu Ko and
Yen{-}Chi Lee and
Ping{-}Cheng Yeh and
Chia{-}han Lee and
Kwang{-}Cheng Chen},
title = {A new paradigm for channel coding in diffusion-based molecular communications:
Molecular coding distance function},
booktitle = {2012 {IEEE} Global Communications Conference, {GLOBECOM} 2012, Anaheim,
CA, USA, December 3-7, 2012},
pages = {3748--3753},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/GLOCOM.2012.6503700},
doi = {10.1109/GLOCOM.2012.6503700},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/globecom/KoLYLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/LinLYL12,
author = {Wei{-}An Lin and
Yen{-}Chi Lee and
Ping{-}Cheng Yeh and
Chia{-}han Lee},
title = {Signal detection and {ISI} cancellation for quantity-based amplitude
modulation in diffusion-based molecular communications},
booktitle = {2012 {IEEE} Global Communications Conference, {GLOBECOM} 2012, Anaheim,
CA, USA, December 3-7, 2012},
pages = {4362--4367},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/GLOCOM.2012.6503804},
doi = {10.1109/GLOCOM.2012.6503804},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/LinLYL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ShihLY12,
author = {Po{-}Jen Shih and
Chia{-}han Lee and
Ping{-}Cheng Yeh},
title = {Channel codes for mitigating intersymbol interference in diffusion-based
molecular communications},
booktitle = {2012 {IEEE} Global Communications Conference, {GLOBECOM} 2012, Anaheim,
CA, USA, December 3-7, 2012},
pages = {4228--4232},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/GLOCOM.2012.6503781},
doi = {10.1109/GLOCOM.2012.6503781},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/ShihLY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/healthcom/ChenCLY12,
author = {Mei{-}Ju Chen and
Shuo{-}Ju Chiang and
Jiun{-}Shiou Lee and
Ernest W. R. Yu},
title = {The Citizen Telehealth Care Service model in Taipei: {A} case study},
booktitle = {{IEEE} 14th International Conference on e-Health Networking, Applications
and Services, Healthcom 2012, Beijing, China, October 10-13, 2012},
pages = {399--402},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/HealthCom.2012.6379447},
doi = {10.1109/HEALTHCOM.2012.6379447},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/healthcom/ChenCLY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/healthcom/ChiangLLYCC12,
author = {Chiung{-}Hung Chiang and
Tzung{-}Yan Lee and
Kang{-}Ping Lin and
Su{-}Tso Yang and
Juei{-}Chao Chen and
Hen{-}Hong Chang},
title = {A study of repeatability and reproducibility for tongue diagnosis
instrument in {TCM}},
booktitle = {{IEEE} 14th International Conference on e-Health Networking, Applications
and Services, Healthcom 2012, Beijing, China, October 10-13, 2012},
pages = {1--6},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/HealthCom.2012.6380054},
doi = {10.1109/HEALTHCOM.2012.6380054},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/healthcom/ChiangLLYCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcc/ChenHL12,
author = {Wen{-}Chieh Chen and
Shih{-}Chia Huang and
Trong{-}Yen Lee},
editor = {Geyong Min and
Jia Hu and
Lei (Chris) Liu and
Laurence Tianruo Yang and
Seetharami Seelam and
Laurent Lef{\`{e}}vre},
title = {An Efficient Reconfigurable Architecture Design and Implementation
of Image Contrast Enhancement Algorithm},
booktitle = {14th {IEEE} International Conference on High Performance Computing
and Communication {\&} 9th {IEEE} International Conference on
Embedded Software and Systems, {HPCC-ICESS} 2012, Liverpool, United
Kingdom, June 25-27, 2012},
pages = {1741--1747},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HPCC.2012.262},
doi = {10.1109/HPCC.2012.262},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpcc/ChenHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibica/HungCOWL12,
author = {Chia{-}Chun Hung and
Ching{-}Tai Chiang and
Chen{-}Sen Ouyang and
Rong{-}Ching Wu and
C. Lee},
title = {Performance of Multiuser {TAS/MRC} Systems with a High Selection Gain
in Severe Fading Channels},
booktitle = {2012 Third International Conference on Innovations in Bio-Inspired
Computing and Applications, Kaohsiung City, Taiwan, September 26-28,
2012},
pages = {258--261},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IBICA.2012.11},
doi = {10.1109/IBICA.2012.11},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/ibica/HungCOWL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icadl/FayuanHLC12,
author = {Kuo{-}Ming Tang (Fayuan) and
Chien{-}Kang Huang and
Chia{-}Ming Lee and
Kuang{-}hua Chen},
editor = {Hsin{-}Hsi Chen and
Gobinda Chowdhury},
title = {Iterative Feature Selection of Translation Texts for Translator Identification},
booktitle = {The Outreach of Digital Libraries: {A} Globalized Resource Network
- 14th International Conference on Asia-Pacific Digital Libraries,
{ICADL} 2012, Taipei, Taiwan, November 12-15, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7634},
pages = {365--367},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-34752-8\_56},
doi = {10.1007/978-3-642-34752-8\_56},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/icadl/FayuanHLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icadl/LeeHC12,
author = {Chia{-}Ming Lee and
Chien{-}Kang Huang and
Kuo{-}Ming Tang (Fayuan) and
Kuang{-}hua Chen},
editor = {Hsin{-}Hsi Chen and
Gobinda Chowdhury},
title = {Iterative Machine-Learning Chinese Term Extraction},
booktitle = {The Outreach of Digital Libraries: {A} Globalized Resource Network
- 14th International Conference on Asia-Pacific Digital Libraries,
{ICADL} 2012, Taipei, Taiwan, November 12-15, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7634},
pages = {309--312},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-34752-8\_37},
doi = {10.1007/978-3-642-34752-8\_37},
timestamp = {Fri, 02 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icadl/LeeHC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/LeeCLNFC12,
author = {Yu{-}Hsuan Lee and
Gwo{-}Dong Chen and
Liang{-}Yi Li and
Nurkhamid and
Cheng{-}Yu Fan and
Kuang{-}Hung Chiang},
editor = {Carlo Giovannella and
Demetrios G. Sampson and
Ignacio Aedo},
title = {The Effect of Utilizing the Learning Skill of Highlighting and Constructing
a Map in a Networked Hyperlink Condition on Learning Performance},
booktitle = {12th {IEEE} International Conference on Advanced Learning Technologies,
{ICALT} 2012, Rome, Italy, July 4-6, 2012},
pages = {546--548},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICALT.2012.105},
doi = {10.1109/ICALT.2012.105},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icalt/LeeCLNFC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/LeeHWHC12,
author = {Wan{-}Ju Lee and
Chi{-}Wen Huang and
Chia{-}Jung Wu and
Shing{-}Tsaan Huang and
Gwo{-}Dong Chen},
editor = {Carlo Giovannella and
Demetrios G. Sampson and
Ignacio Aedo},
title = {The Effects of Using Embodied Interactions to Improve Learning Performance},
booktitle = {12th {IEEE} International Conference on Advanced Learning Technologies,
{ICALT} 2012, Rome, Italy, July 4-6, 2012},
pages = {557--559},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICALT.2012.104},
doi = {10.1109/ICALT.2012.104},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/LeeHWHC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/LeeTCPCS12,
author = {Yi{-}Shian Lee and
Hou{-}Chiang Tseng and
Ju{-}Ling Chen and
Chun{-}Yi Peng and
Tao{-}Hsing Chang and
Yao{-}Ting Sung},
editor = {Carlo Giovannella and
Demetrios G. Sampson and
Ignacio Aedo},
title = {Constructing a Novel Chinese Readability Classification Model Using
Principal Component Analysis and Genetic Programming},
booktitle = {12th {IEEE} International Conference on Advanced Learning Technologies,
{ICALT} 2012, Rome, Italy, July 4-6, 2012},
pages = {164--166},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICALT.2012.134},
doi = {10.1109/ICALT.2012.134},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/LeeTCPCS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ChenHWL12,
author = {Chia{-}Ping Chen and
Yi{-}Chin Huang and
Chung{-}Hsien Wu and
Kuan{-}De Lee},
title = {Cross-lingual frame selection method for polyglot speech synthesis},
booktitle = {2012 {IEEE} International Conference on Acoustics, Speech and Signal
Processing, {ICASSP} 2012, Kyoto, Japan, March 25-30, 2012},
pages = {4521--4524},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICASSP.2012.6288923},
doi = {10.1109/ICASSP.2012.6288923},
timestamp = {Thu, 25 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/ChenHWL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LeeCSSL12,
author = {Yutzu Lee and
Chen{-}Kuo Chiang and
Yu{-}Wei Sun and
Te{-}Feng Su and
Shang{-}Hong Lai},
title = {Parallelized Random Walk algorithm for background substitution on
a multi-core embedded platform},
booktitle = {2012 {IEEE} International Conference on Acoustics, Speech and Signal
Processing, {ICASSP} 2012, Kyoto, Japan, March 25-30, 2012},
pages = {1621--1624},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICASSP.2012.6288205},
doi = {10.1109/ICASSP.2012.6288205},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/LeeCSSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LeeSC12,
author = {Chia{-}Hsiang Lee and
Yu{-}Chi Su and
Liang{-}Gee Chen},
title = {Accurate positioning system based on street view recognition},
booktitle = {2012 {IEEE} International Conference on Acoustics, Speech and Signal
Processing, {ICASSP} 2012, Kyoto, Japan, March 25-30, 2012},
pages = {2305--2308},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICASSP.2012.6288375},
doi = {10.1109/ICASSP.2012.6288375},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/LeeSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-berlin/LeeSC12,
author = {Chia{-}Hsiang Lee and
Yu{-}Chi Su and
Liang{-}Gee Chen},
title = {An intelligent depth-based obstacle detection for mobile applications},
booktitle = {{IEEE} Second International Conference on Consumer Electronics - Berlin,
ICCE-Berlin 2012, Berlin, Germany, September 3-5, 2012},
pages = {223--225},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICCE-Berlin.2012.6336467},
doi = {10.1109/ICCE-BERLIN.2012.6336467},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icce-berlin/LeeSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/HsuTCLHW12,
author = {Chia{-}Hao Hsu and
Yue{-}Da Tsai and
Yun{-}Chi Chen and
Ming{-}Chih Lee and
I{-}Yu Huang and
Chua{-}Chin Wang},
title = {A fast {FPW} allergy analyzer prototype for point of care {(POC)}},
booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012,
Las Vegas, NV, USA, January 13-16, 2012},
pages = {540--541},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICCE.2012.6161803},
doi = {10.1109/ICCE.2012.6161803},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iccel/HsuTCLHW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icch/LeeWLCCT12,
author = {Ming{-}Huei Lee and
Huei{-}Ching Wu and
Jen{-}Yung Lin and
Yung{-}fu Chen and
John Y. Chiang and
Tan{-}Hsu Tan},
title = {Healthcare for patients with interstitial cystitis/bladder pain syndrome
based on internet health education},
booktitle = {International Conference on Computerized Healthcare, {ICCH} 2012,
Hong Kong, China, December 17-18, 2012},
pages = {17--22},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICCH.2012.6724464},
doi = {10.1109/ICCH.2012.6724464},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icch/LeeWLCCT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icch/TanGBCHCCHLHH12,
author = {Tan{-}Hsu Tan and
Munkhjargal Gochoo and
Sukhbaatar Bilgee and
Ching{-}Su Chang and
Jin{-}Jia Hu and
Yung{-}fu Chen and
John Y. Chiang and
Yung{-}Fa Huang and
Ming{-}Hui Lee and
Yung{-}Nian Hsu and
Jin{-}Chyr Hsu},
title = {Development of an emergency medical service system based on wireless
networks and real-time traffic information},
booktitle = {International Conference on Computerized Healthcare, {ICCH} 2012,
Hong Kong, China, December 17-18, 2012},
pages = {35--42},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICCH.2012.6724467},
doi = {10.1109/ICCH.2012.6724467},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icch/TanGBCHCCHLHH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ChiuCLSC12,
author = {Chieh{-}Chuan Chiu and
Shao{-}Yi Chien and
Chia{-}han Lee and
V. Srinivasa Somayazulu and
Yen{-}Kuang Chen},
title = {Hybrid distributed video coding with frame level coding mode selection},
booktitle = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012,
Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012},
pages = {1561--1564},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICIP.2012.6467171},
doi = {10.1109/ICIP.2012.6467171},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/ChiuCLSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/ShihCL12,
author = {Huang{-}Chia Shih and
Che{-}Yen Chuang and
Hong{-}Wei Lee},
title = {A semantic-based video segmentation method},
booktitle = {International Conference on Machine Learning and Cybernetics, {ICMLC}
2012, Xian, Shaanxi, China, July 15-17, 2012, Proceedings},
pages = {1623--1626},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICMLC.2012.6359608},
doi = {10.1109/ICMLC.2012.6359608},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/icmlc/ShihCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icppw/LeeCSSKL12,
author = {Yutzu Lee and
Chen{-}Kuo Chiang and
Te{-}Feng Su and
Yu{-}Wei Sun and
Chi{-}Bang Kuan and
Shang{-}Hong Lai},
title = {Parallelized Background Substitution System on a Multi-core Embedded
Platform},
booktitle = {41st International Conference on Parallel Processing Workshops, {ICPPW}
2012, Pittsburgh, PA, USA, September 10-13, 2012},
pages = {530--537},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICPPW.2012.72},
doi = {10.1109/ICPPW.2012.72},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icppw/LeeCSSKL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChungLCL12,
author = {Szu{-}Chi Chung and
Jen{-}Wei Lee and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A high-performance elliptic curve cryptographic processor over GF(p)
with {SPA} resistance},
booktitle = {2012 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2012, Seoul, Korea (South), May 20-23, 2012},
pages = {1456--1459},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCAS.2012.6271521},
doi = {10.1109/ISCAS.2012.6271521},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ChungLCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LeeCCL12,
author = {Xin{-}Ru Lee and
Chih{-}Lung Chen and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {Stochastic decoding for {LDPC} convolutional codes},
booktitle = {2012 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2012, Seoul, Korea (South), May 20-23, 2012},
pages = {2621--2624},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCAS.2012.6271843},
doi = {10.1109/ISCAS.2012.6271843},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LeeCCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LinWLTCJLSLC12,
author = {Geng{-}Cing Lin and
Shao{-}Cheng Wang and
Yi{-}Wei Lin and
Ming{-}Chien Tsai and
Ching{-}Te Chuang and
Shyh{-}Jye Jou and
Nan{-}Chun Lien and
Wei{-}Chiang Shih and
Kuen{-}Di Lee and
Jyun{-}Kai Chu},
title = {An all-digital bit transistor characterization scheme for {CMOS} 6T
{SRAM} array},
booktitle = {2012 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2012, Seoul, Korea (South), May 20-23, 2012},
pages = {2485--2488},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCAS.2012.6271804},
doi = {10.1109/ISCAS.2012.6271804},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LinWLTCJLSLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/WangHTCLH12,
author = {Chua{-}Chin Wang and
Chia{-}Hao Hsu and
Yue{-}Da Tsai and
Yun{-}Chi Chen and
Ming{-}Chih Lee and
I{-}Yu Huang},
title = {A fast FPW-based protein concentration measurement system},
booktitle = {2012 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2012, Seoul, Korea (South), May 20-23, 2012},
pages = {2389--2392},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCAS.2012.6271778},
doi = {10.1109/ISCAS.2012.6271778},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/WangHTCLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/WuHLC12,
author = {Tsung{-}Che Wu and
Ji{-}Hua Hsu and
Chang{-}Ming Lee and
Jui{-}Chiu Chiang},
title = {Efficient improvement of side information in GOB-based {DVC} system},
booktitle = {2012 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2012, Seoul, Korea (South), May 20-23, 2012},
pages = {1720--1723},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCAS.2012.6271593},
doi = {10.1109/ISCAS.2012.6271593},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/WuHLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/YangLHLCCCHJLLLSWLH12,
author = {Hao{-}I Yang and
Yi{-}Wei Lin and
Mao{-}Chih Hsia and
Geng{-}Cing Lin and
Chi{-}Shin Chang and
Yin{-}Nien Chen and
Ching{-}Te Chuang and
Wei Hwang and
Shyh{-}Jye Jou and
Nan{-}Chun Lien and
Hung{-}Yu Li and
Kuen{-}Di Lee and
Wei{-}Chiang Shih and
Ya{-}Ping Wu and
Wen{-}Ta Lee and
Chih{-}Chiang Hsu},
title = {High-performance 0.6V {VMIN} 55nm 1.0Mb 6T {SRAM} with adaptive {BL}
bleeder},
booktitle = {2012 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2012, Seoul, Korea (South), May 20-23, 2012},
pages = {1831--1834},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCAS.2012.6271624},
doi = {10.1109/ISCAS.2012.6271624},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/YangLHLCCCHJLLLSWLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscslp/ChiangSWCL12,
author = {Chen{-}Yu Chiang and
Sabato Marco Siniscalchi and
Yih{-}Ru Wang and
Sin{-}Horng Chen and
Chin{-}Hui Lee},
title = {A study on cross-language knowledge integration in Mandarin {LVCSR}},
booktitle = {8th International Symposium on Chinese Spoken Language Processing,
{ISCSLP} 2012, Kowloon Tong, China, December 5-8, 2012},
pages = {315--319},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCSLP.2012.6423528},
doi = {10.1109/ISCSLP.2012.6423528},
timestamp = {Wed, 18 Sep 2024 12:50:55 +0200},
biburl = {https://dblp.org/rec/conf/iscslp/ChiangSWCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/ShihLHL12,
author = {Huang{-}Chia Shih and
Hong{-}Wei Lee and
Chung{-}Lin Huang and
Yu{-}Che Liu},
title = {Collaborative real-time scheduling for multiple objects tracking in
{PTZ} camera network},
booktitle = {International Symposium on Intelligent Signal Processing and Communications
Systems, {ISPACS} 2012, Tamsui, New Taipei City, Taiwan, November
4-7, 2012},
pages = {166--171},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISPACS.2012.6473474},
doi = {10.1109/ISPACS.2012.6473474},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/ShihLHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/TsengLCLCHW12,
author = {Yung{-}Chang Tseng and
Tsung{-}Hsing Lin and
Chiao{-}Hsuan Chuang and
Tung{-}Lin Lee and
Liang{-}Bi Chen and
Chih{-}Lin Hung and
Chao{-}Wen Wu},
title = {Low cost embedded chairman/delegate units design for digital conference
system},
booktitle = {International Symposium on Intelligent Signal Processing and Communications
Systems, {ISPACS} 2012, Tamsui, New Taipei City, Taiwan, November
4-7, 2012},
pages = {740--744},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISPACS.2012.6473589},
doi = {10.1109/ISPACS.2012.6473589},
timestamp = {Sat, 16 Sep 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/TsengLCLCHW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/WangWLLCL12,
author = {Min{-}Liang Wang and
Jing{-}Ren Wu and
Kai{-}Che Liu and
Pei{-}Yuan Lee and
Yung{-}Yang Chiang and
Huei{-}Yung Lin},
title = {Innovative 3D augmented reality techniques for spinal surgery applications},
booktitle = {International Symposium on Intelligent Signal Processing and Communications
Systems, {ISPACS} 2012, Tamsui, New Taipei City, Taiwan, November
4-7, 2012},
pages = {16--20},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISPACS.2012.6473445},
doi = {10.1109/ISPACS.2012.6473445},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/WangWLLCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/LeeLHCLL12,
author = {Chieh{-}Jui Lee and
Shih{-}Ying Liu and
Chuan{-}Chia Huang and
Hung{-}Ming Chen and
Chang{-}Tzu Lin and
Chia{-}Hsin Lee},
editor = {Keith A. Bowman and
Kamesh V. Gadepally and
Pallab Chatterjee and
Mark M. Budnik and
Lalitha Immaneni},
title = {Hierarchical power network synthesis for multiple power domain designs},
booktitle = {Thirteenth International Symposium on Quality Electronic Design, {ISQED}
2012, Santa Clara, CA, USA, March 19-21, 2012},
pages = {477--482},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISQED.2012.6187536},
doi = {10.1109/ISQED.2012.6187536},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isqed/LeeLHCLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChungCHLWKCLLLHKCLCHCCSSLJHSCHHZSDC12,
author = {Yuan{-}Hung Chung and
Min Chen and
Wei{-}Kai Hong and
Jie{-}Wei Lai and
Sheng{-}Jau Wong and
Chien{-}Wei Kuan and
Hong{-}Lin Chu and
Chihun Lee and
Chih{-}Fan Liao and
Hsuan{-}Yu Liu and
Hong{-}Kai Hsu and
Li{-}Chun Ko and
Kuo{-}Hao Chen and
Chao{-}Hsin Lu and
Tsung{-}Ming Chen and
YuLi Hsueh and
Chunwei Chang and
Yi{-}Hsien Cho and
Chih{-}Hsien Shen and
Yuan Sun and
Eng{-}Chuan Low and
Xudong Jiang and
Deyong Hu and
Weimin Shu and
Jhy{-}Rong Chen and
Jui{-}Lin Hsu and
Chia{-}Jui Hsu and
Jing{-}Hong Conan Zhan and
Osama Shana'a and
Guang{-}Kaai Dehng and
George Chien},
title = {A 4-in-1 (WiFi/BT/FM/GPS) connectivity SoC with enhanced co-existence
performance in 65nm {CMOS}},
booktitle = {2012 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2012, San Francisco, CA, USA, February 19-23, 2012},
pages = {172--174},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISSCC.2012.6176964},
doi = {10.1109/ISSCC.2012.6176964},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChungCHLWKCLLLHKCLCHCCSSLJHSCHHZSDC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mtv/LeeHT12,
author = {Lung{-}Jen Lee and
Chia{-}Cheng He and
Wang{-}Dauh Tseng},
title = {Deterministic {ATPG} for Low Capture Power Testing},
booktitle = {13th International Workshop on Microprocessor Test and Verification,
{MTV} 2012, Austin, TX, USA, December 10-13, 2012},
pages = {24--29},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/MTV.2012.14},
doi = {10.1109/MTV.2012.14},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mtv/LeeHT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/ChangLHCYPSL12,
author = {Kuo{-}Wei Chang and
Chia{-}Tung Lee and
Punde Tushar Harishchandra and
Hung{-}Po Chen and
Ting{-}Ru Yueh and
Srinivasu Valagerahally Puttaswamy and
Shilpa Sivashankar and
Cheng{-}Hsien Liu},
title = {3D biomimetic chip integrated with microvascular system for studying
the liver specific functions},
booktitle = {7th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {NEMS} 2012, Kyoto, Japan, March 5-8, 2012},
pages = {218--221},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/NEMS.2012.6196760},
doi = {10.1109/NEMS.2012.6196760},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/nems/ChangLHCYPSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/HungCHTYLL12,
author = {Lien{-}Yu Hung and
Fong{-}Yu Cheng and
Chih{-}Chia Huang and
Yi{-}Che Tsai and
Chen{-}Sheng Yeh and
Huan{-}Yao Lei and
Gwo{-}Bin Lee},
title = {Microfluidic system for rapid detection of influenza infection by
utilizing magnetic MnFe2O4 nanoparticle-based immunoassay},
booktitle = {7th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {NEMS} 2012, Kyoto, Japan, March 5-8, 2012},
pages = {200--203},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/NEMS.2012.6196756},
doi = {10.1109/NEMS.2012.6196756},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nems/HungCHTYLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/LeeHCWT12,
author = {Tung{-}Yuan Lee and
Tsung{-}Cheng Ho and
Chia{-}Jung Chang and
Pen{-}Cheng Wang and
Fan{-}Gang Tseng},
title = {Proton exchange membranes based on aryl epoxy resin for fuel cells
operated at elevated temperatures},
booktitle = {7th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {NEMS} 2012, Kyoto, Japan, March 5-8, 2012},
pages = {453--456},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/NEMS.2012.6196816},
doi = {10.1109/NEMS.2012.6196816},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nems/LeeHCWT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ni/ChangLCC12,
author = {Tsue{-}Rung Chang and
Pei{-}Yi Lee and
Chia{-}Cheng Cheng and
Polun Chang},
editor = {Kaija Saranto and
Charlotte A. Weaver and
Polun Chang},
title = {Developing and Evaluating a Workflow-based Cancer Case Management
Information System},
booktitle = {Nursing Informatics 2014 - East Meets West eSMART+ - Proceedings of
the 12th International Congress on Nursing Informatics, Taipei, Taiwan,
June 21-25, 2014},
series = {Studies in Health Technology and Informatics},
volume = {201},
publisher = {{IOS} Press},
year = {2012},
url = {http://knowledge.amia.org/amia-55142-cni2012a-1.641359/t-005-1.642724/f-001-1.642725/a-146-1.643322/a-147-1.643319},
timestamp = {Wed, 29 Mar 2017 16:45:22 +0200},
biburl = {https://dblp.org/rec/conf/ni/ChangLCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scisisis/LinCLCTHW12,
author = {Tsung{-}Hsing Lin and
Chiao{-}Hsuan Chuang and
Tung{-}Lin Lee and
Liang{-}Bi Chen and
Yung{-}Chang Tseng and
Chih{-}Lin Hung and
Chao{-}Wen Wu},
title = {Development of a GUI-based mobile control console for digital conference
systems},
booktitle = {The 6th International Conference on Soft Computing and Intelligent
Systems (SCIS), and The 13th International Symposium on Advanced Intelligence
Systems (ISIS), Kobe, Japan, November 20-24, 2012},
pages = {902--905},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/SCIS-ISIS.2012.6505040},
doi = {10.1109/SCIS-ISIS.2012.6505040},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/scisisis/LinCLCTHW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/ChanCCCL12,
author = {Chia{-}Long Chan and
Hsin{-}Han Chiang and
Yen{-}Lin Chen and
Geng{-}Yen Chen and
Tsu{-}Tian Lee},
title = {Development of hand-cleaning service-oriented autonomous navigation
robot},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man,
and Cybernetics, {SMC} 2012, Seoul, Korea (South), October 14-17,
2012},
pages = {3227--3232},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICSMC.2012.6378288},
doi = {10.1109/ICSMC.2012.6378288},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc/ChanCCCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socc/LinYHLCCHLLSWLH12,
author = {Yung{-}Wei Lin and
Hao{-}I Yang and
Mao{-}Chih Hsia and
Yi{-}Wei Lin and
Chien{-}Hen Chen and
Ching{-}Te Chuang and
Wei Hwang and
Nan{-}Chun Lien and
Kuen{-}Di Lee and
Wei{-}Chiang Shih and
Ya{-}Ping Wu and
Wen{-}Ta Lee and
Chih{-}Chiang Hsu},
editor = {Ramalingam Sridhar and
Norbert Schuhmann and
Kaijian Shi},
title = {A 55nm 0.5V 128Kb cross-point 8T {SRAM} with data-aware dynamic supply
Write-assist},
booktitle = {{IEEE} 25th International {SOC} Conference, {SOCC} 2012, Niagara Falls,
NY, USA, September 12-14, 2012},
pages = {218--223},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/SOCC.2012.6398351},
doi = {10.1109/SOCC.2012.6398351},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/socc/LinYHLCCHLLSWLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/ChouCLSTWWY12,
author = {Cheng{-}Wei Chou and
Ping{-}Chiang Chou and
Chang{-}Shing Lee and
David Lupien Saint{-}Pierre and
Olivier Teytaud and
Mei{-}Hui Wang and
Li{-}Wen Wu and
Shi{-}Jim Yen},
title = {Strategic Choices: Small Budgets and Simple Regret},
booktitle = {Conference on Technologies and Applications of Artificial Intelligence,
{TAAI} 2012, Tainan, Taiwan, November 16-18, 2012},
pages = {182--187},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/TAAI.2012.35},
doi = {10.1109/TAAI.2012.35},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/taai/ChouCLSTWWY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/visapp/LeeHCCC12,
author = {Chia{-}Yen Lee and
Chiun{-}Sheng Huang and
Yeun{-}Chung Chang and
Yi{-}Hong Chou and
Chung{-}Ming Chen},
editor = {Gabriela Csurka and
Jos{\'{e}} Braz},
title = {Gibbs-weighted K-means Segmentation Approach with Intensity Inhomogeneity
Correction},
booktitle = {{VISAPP} 2012 - Proceedings of the International Conference on Computer
Vision Theory and Applications, Volume 1, Rome, Italy, 24-26 February,
2012},
pages = {381--384},
publisher = {SciTePress},
year = {2012},
timestamp = {Fri, 25 May 2012 14:48:14 +0200},
biburl = {https://dblp.org/rec/conf/visapp/LeeHCCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/FuHLCL12,
author = {Hsing{-}Ping Fu and
Ju{-}Hung Hsiao and
Po{-}Chun Liu and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A low cost DPA-resistant 8-bit {AES} core based on ring oscillators},
booktitle = {Proceedings of Technical Program of 2012 {VLSI} Design, Automation
and Test, {VLSI-DAT} 2012, Hsinchu, Taiwan, April 23-25, 2012},
pages = {1--4},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/VLSI-DAT.2012.6212665},
doi = {10.1109/VLSI-DAT.2012.6212665},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/FuHLCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/HoL12,
author = {Chia{-}Chi Ho and
Tai{-}Cheng Lee},
title = {A 10-bit 200-MS/s reconfigurable pipelined {A/D} converter},
booktitle = {Proceedings of Technical Program of 2012 {VLSI} Design, Automation
and Test, {VLSI-DAT} 2012, Hsinchu, Taiwan, April 23-25, 2012},
pages = {1--4},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/VLSI-DAT.2012.6212593},
doi = {10.1109/VLSI-DAT.2012.6212593},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/HoL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi-dat/LinTYLWCJHLLS12,
author = {Yi{-}Wei Lin and
Ming{-}Chien Tsai and
Hao{-}I Yang and
Geng{-}Cing Lin and
Shao{-}Cheng Wang and
Ching{-}Te Chuang and
Shyh{-}Jye Jou and
Wei Hwang and
Nan{-}Chun Lien and
Kuen{-}Di Lee and
Wei{-}Chiang Shih},
title = {An all-digital Read Stability and Write Margin characterization scheme
for {CMOS} 6T {SRAM} array},
booktitle = {Proceedings of Technical Program of 2012 {VLSI} Design, Automation
and Test, {VLSI-DAT} 2012, Hsinchu, Taiwan, April 23-25, 2012},
pages = {1--4},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/VLSI-DAT.2012.6212589},
doi = {10.1109/VLSI-DAT.2012.6212589},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsi-dat/LinTYLWCJHLLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/LeeYHCKCLC12,
author = {Robin Lee and
Jung{-}Ping Yang and
Chia{-}En Huang and
Chih{-}Chieh Chiu and
Wei{-}Shuo Kao and
Hong{-}Chen Cheng and
Hong{-}Jen Liao and
Jonathan Chang},
title = {A 28nm high-k metal-gate {SRAM} with Asynchronous Cross-Couple Read
Assist (AC\({}^{\mbox{2}}\)RA) circuitry achieving 3x reduction on
speed variation for single ended arrays},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2012, Honolulu, HI, USA, June
13-15, 2012},
pages = {64--65},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/VLSIC.2012.6243791},
doi = {10.1109/VLSIC.2012.6243791},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/LeeYHCKCLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/HuangL12,
author = {Chia{-}Cheng Huang and
Ju{-}Hong Lee},
title = {Novel Robust Adaptive Beamforming},
booktitle = {Proceedings of the 75th {IEEE} Vehicular Technology Conference, {VTC}
Spring 2012, Yokohama, Japan, May 6-9, 2012},
pages = {1--5},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/VETECS.2012.6240110},
doi = {10.1109/VETECS.2012.6240110},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/vtc/HuangL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ChenL12,
author = {Hsin{-}Yeh Chen and
Chia{-}han Lee},
title = {Analysis of the number of hops in wired-wireless heterogeneous networks},
booktitle = {2012 {IEEE} Wireless Communications and Networking Conference, {WCNC}
2012, Paris, France, April 1-4, 2012},
pages = {1806--1810},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/WCNC.2012.6214078},
doi = {10.1109/WCNC.2012.6214078},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/ChenL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/KuoCHHLY12,
author = {Tsu{-}Hao Kuo and
Po{-}Hsuan Chen and
Wei{-}Chih Hung and
Chih{-}Yu Huang and
Chia{-}han Lee and
Ping{-}Cheng Yeh},
title = {Dynamic source-channel rate-distortion control under time-varying
complexity constraint for wireless video transmission},
booktitle = {2012 {IEEE} Wireless Communications and Networking Conference, {WCNC}
2012, Paris, France, April 1-4, 2012},
pages = {2566--2570},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/WCNC.2012.6214231},
doi = {10.1109/WCNC.2012.6214231},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/KuoCHHLY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wiamis/LeeSC12,
author = {Chia{-}Hsiang Lee and
Yu{-}Chi Su and
Liang{-}Gee Chen},
title = {An intelligent depth-based obstacle detection system for visually-impaired
aid applications},
booktitle = {13th International Workshop on Image Analysis for Multimedia Interactive
Services, {WIAMIS} 2012, Dublin, Ireland, May 23-25, 2012},
pages = {1--4},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/WIAMIS.2012.6226753},
doi = {10.1109/WIAMIS.2012.6226753},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/wiamis/LeeSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/ChuangL11,
author = {Chen{-}Chia Chuang and
Zne{-}Jung Lee},
title = {Hybrid robust support vector machines for regression with outliers},
journal = {Appl. Soft Comput.},
volume = {11},
number = {1},
pages = {64--72},
year = {2011},
url = {https://doi.org/10.1016/j.asoc.2009.10.017},
doi = {10.1016/J.ASOC.2009.10.017},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/asc/ChuangL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/ChenTLK11,
author = {Nian{-}Shing Chen and
Daniel Chia{-}En Teng and
Cheng{-}Han Lee and
Kinshuk},
title = {Augmenting paper-based reading activity with direct access to digital
materials and scaffolded questioning},
journal = {Comput. Educ.},
volume = {57},
number = {2},
pages = {1705--1715},
year = {2011},
url = {https://doi.org/10.1016/j.compedu.2011.03.013},
doi = {10.1016/J.COMPEDU.2011.03.013},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ce/ChenTLK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cii/ChenCCL11,
author = {Kai{-}Ying Chen and
Long{-}Sheng Chen and
Mu{-}Chen Chen and
Chia{-}Lung Lee},
title = {Using {SVM} based method for equipment fault detection in a thermal
power plant},
journal = {Comput. Ind.},
volume = {62},
number = {1},
pages = {42--50},
year = {2011},
url = {https://doi.org/10.1016/j.compind.2010.05.013},
doi = {10.1016/J.COMPIND.2010.05.013},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cii/ChenCCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/HarnLLC11,
author = {Lein Harn and
Chia{-}Yin Lee and
Changlu Lin and
Chin{-}Chen Chang},
title = {Fully Deniable Message Authentication Protocols Preserving Confidentiality},
journal = {Comput. J.},
volume = {54},
number = {10},
pages = {1688--1699},
year = {2011},
url = {https://doi.org/10.1093/comjnl/bxr081},
doi = {10.1093/COMJNL/BXR081},
timestamp = {Tue, 23 Jan 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cj/HarnLLC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LeeCT11,
author = {Chao{-}Hui Lee and
Jessie Chia{-}Yu Chen and
Vincent S. Tseng},
title = {A novel data mining mechanism considering bio-signal and environmental
data with applications on asthma monitoring},
journal = {Comput. Methods Programs Biomed.},
volume = {101},
number = {1},
pages = {44--61},
year = {2011},
url = {https://doi.org/10.1016/j.cmpb.2010.04.016},
doi = {10.1016/J.CMPB.2010.04.016},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/LeeCT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/LeeCCW11,
author = {Wen{-}Chiung Lee and
Shiuan{-}Kang Chen and
Cheng{-}Wei Chen and
Chin{-}Chia Wu},
title = {A two-machine flowshop problem with two agents},
journal = {Comput. Oper. Res.},
volume = {38},
number = {1},
pages = {98--104},
year = {2011},
url = {https://doi.org/10.1016/j.cor.2010.04.002},
doi = {10.1016/J.COR.2010.04.002},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/LeeCCW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dss/TsaiSFLLC11,
author = {Wen{-}Hsien Tsai and
Michael J. Shaw and
Yi{-}Wen Fan and
Jau{-}Yang Liu and
Kuen{-}Chang Lee and
Hui{-}Chiao Chen},
title = {An empirical investigation of the impacts of internal/external facilitators
on the project success of {ERP:} {A} structural equation model},
journal = {Decis. Support Syst.},
volume = {50},
number = {2},
pages = {480--490},
year = {2011},
url = {https://doi.org/10.1016/j.dss.2010.11.005},
doi = {10.1016/J.DSS.2010.11.005},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dss/TsaiSFLLC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dt/SheuCCCLLCCCT11,
author = {Shyh{-}Shyuan Sheu and
Kuo{-}Hsing Cheng and
Meng{-}Fan Chang and
Pei{-}Chia Chiang and
Wen{-}Pin Lin and
Heng{-}Yuan Lee and
Pang{-}Shiu Chen and
Yu{-}Sheng Chen and
Frederick T. Chen and
Ming{-}Jinn Tsai},
title = {Fast-Write Resistive {RAM} {(RRAM)} for Embedded Applications},
journal = {{IEEE} Des. Test Comput.},
volume = {28},
number = {1},
pages = {64--71},
year = {2011},
url = {https://doi.org/10.1109/MDT.2010.96},
doi = {10.1109/MDT.2010.96},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dt/SheuCCCLLCCCT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LeeHCC11,
author = {Wen{-}Shiung Lee and
Alex YiHou Huang and
Yong{-}Yang Chang and
Chiao{-}Ming Cheng},
title = {Analysis of decision making factors for equity investment by {DEMATEL}
and Analytic Network Process},
journal = {Expert Syst. Appl.},
volume = {38},
number = {7},
pages = {8375--8383},
year = {2011},
url = {https://doi.org/10.1016/j.eswa.2011.01.027},
doi = {10.1016/J.ESWA.2011.01.027},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/LeeHCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LeeK11a,
author = {Cheng{-}Ming Lee and
Chia{-}Nan Ko},
title = {Short-term load forecasting using lifting scheme and {ARIMA} models},
journal = {Expert Syst. Appl.},
volume = {38},
number = {5},
pages = {5902--5911},
year = {2011},
url = {https://doi.org/10.1016/j.eswa.2010.11.033},
doi = {10.1016/J.ESWA.2010.11.033},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/LeeK11a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LeeLCC11,
author = {Chia{-}Hoang Lee and
Chien{-}Liang Liu and
Yi{-}An Chen and
Ying{-}Sheng Chen},
title = {Painting in the air with Wii Remote},
journal = {Expert Syst. Appl.},
volume = {38},
number = {12},
pages = {14668--14678},
year = {2011},
url = {https://doi.org/10.1016/j.eswa.2011.05.016},
doi = {10.1016/J.ESWA.2011.05.016},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/LeeLCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LiuLYC11,
author = {Chien{-}Liang Liu and
Chia{-}Hoang Lee and
Ssu{-}Han Yu and
Chih{-}Wei Chen},
title = {Computer assisted writing system},
journal = {Expert Syst. Appl.},
volume = {38},
number = {1},
pages = {804--811},
year = {2011},
url = {https://doi.org/10.1016/j.eswa.2010.07.038},
doi = {10.1016/J.ESWA.2010.07.038},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/LiuLYC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/LeeWHC11,
author = {Chia{-}Yin Lee and
Zhi{-}Hui Wang and
Lein Harn and
Chin{-}Chen Chang},
title = {Secure Key Transfer Protocol Based on Secret Sharing for Group Communications},
journal = {{IEICE} Trans. Inf. Syst.},
volume = {94-D},
number = {11},
pages = {2069--2076},
year = {2011},
url = {https://doi.org/10.1587/transinf.E94.D.2069},
doi = {10.1587/TRANSINF.E94.D.2069},
timestamp = {Mon, 26 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieicet/LeeWHC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijaacs/LeeFL11,
author = {Chiou{-}Yng Lee and
Chia{-}Chen Fan and
Erl{-}Huei Lu},
title = {Combined circuit architecture for computing normal basis and Montgomery
multiplications over GF(2\({}^{\mbox{m}}\))},
journal = {Int. J. Auton. Adapt. Commun. Syst.},
volume = {4},
number = {3},
pages = {291--306},
year = {2011},
url = {https://doi.org/10.1504/IJAACS.2011.040988},
doi = {10.1504/IJAACS.2011.040988},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijaacs/LeeFL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsst/ChenHCTW11,
author = {Yi{-}Fen Chen and
Chang{-}Lung Hsieh and
Wen{-}Yu Chen and
Chia{-}Wen Tsai and
Lee{-}Wei Wei},
title = {Analyzing the Strategy of Sustainable Competitive Advantage in Taiwan's
Photovoltaic Industry},
journal = {Int. J. Decis. Support Syst. Technol.},
volume = {3},
number = {3},
pages = {42--57},
year = {2011},
url = {https://doi.org/10.4018/jdsst.2011070103},
doi = {10.4018/JDSST.2011070103},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdsst/ChenHCTW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijebm/LeeTC11,
author = {Chih{-}Cheng Lee and
Gwo{-}Hshiung Tzeng and
Chi Chiang},
title = {Determining Service Quality Measurement Key Indicators in a Travel
Website Using a Fuzzy Analytic Hierarchy Process},
journal = {Int. J. Electron. Bus. Manag.},
volume = {9},
number = {4},
pages = {322--333},
year = {2011},
url = {http://ijebm.ie.nthu.edu.tw/IJEBM\_Web/IJEBM\_static/Paper-V9\_N4/A04.pdf},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijebm/LeeTC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcp/ShenLCC11,
author = {Chien{-}wen Shen and
Heng{-}Chi Lee and
Ching{-}Chih Chou and
Chiao{-}Chun Cheng},
title = {Data Mining the Data Processing Technologies for Inventory Management},
journal = {J. Comput.},
volume = {6},
number = {4},
pages = {784--791},
year = {2011},
url = {http://www.jcomputers.us/index.php?m=content\&c=index\&a=show\&catid=140\&id=2415},
doi = {10.4304/JCP.6.4.784-791},
timestamp = {Thu, 25 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcp/ShenLCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcp/WuHL11,
author = {Bo{-}Sheng Wu and
Chen{-}Chiung Hsieh and
Chia{-}Chen Lee},
title = {A Distance Computer Vision Assisted Yoga Learning System},
journal = {J. Comput.},
volume = {6},
number = {11},
pages = {2382--2388},
year = {2011},
url = {https://doi.org/10.4304/jcp.6.11.2382-2388},
doi = {10.4304/JCP.6.11.2382-2388},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcp/WuHL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/ChienYWL11,
author = {Hung{-}Yu Chien and
Chia{-}Chuan Yang and
Tzong{-}Chen Wu and
Chin{-}Feng Lee},
title = {Two RFID-based Solutions to Enhance Inpatient Medication Safety},
journal = {J. Medical Syst.},
volume = {35},
number = {3},
pages = {369--375},
year = {2011},
url = {https://doi.org/10.1007/s10916-009-9373-7},
doi = {10.1007/S10916-009-9373-7},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/ChienYWL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/DuLLLWCC11,
author = {Yi{-}Chun Du and
You{-}Yun Lee and
Yun{-}Yuan Lu and
Chia{-}Hung Lin and
Ming{-}Jei Wu and
Chung{-}Lin Chen and
Tainsong Chen},
title = {Development of a Telecare System Based on ZigBee Mesh Network for
Monitoring Blood Pressure of Patients with Hemodialysis in Health
Care Centers},
journal = {J. Medical Syst.},
volume = {35},
number = {5},
pages = {877--883},
year = {2011},
url = {https://doi.org/10.1007/s10916-010-9513-0},
doi = {10.1007/S10916-010-9513-0},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/DuLLLWCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/HsuLWLHCTCLCCWHTH11,
author = {Sheng{-}Da Hsu and
Feng{-}Mao Lin and
Wei{-}Yun Wu and
Chao Liang and
Wei{-}Chih Huang and
Wen{-}Ling Chan and
Wen{-}Ting Tsai and
Goun{-}Zhou Chen and
Chia{-}Jung Lee and
Chih{-}Min Chiu and
Chia{-}Hung Chien and
Ming{-}Chia Wu and
Chi{-}Ying F. Huang and
Ann{-}Ping Tsou and
Hsien{-}Da Huang},
title = {miRTarBase: a database curates experimentally validated microRNA-target
interactions},
journal = {Nucleic Acids Res.},
volume = {39},
number = {Database-Issue},
pages = {163--169},
year = {2011},
url = {https://doi.org/10.1093/nar/gkq1107},
doi = {10.1093/NAR/GKQ1107},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/HsuLWLHCTCLCCWHTH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChenLCHLYC11,
author = {Yen{-}Lin Chen and
Wen{-}Yew Liang and
Chuan{-}Yen Chiang and
Tung{-}Ju Hsieh and
Da{-}Cheng Lee and
Shyan{-}Ming Yuan and
Yang{-}Lang Chang},
title = {Vision-Based Finger Detection, Tracking, and Event Identification
Techniques for Multi-Touch Sensing and Display Systems},
journal = {Sensors},
volume = {11},
number = {7},
pages = {6868--6892},
year = {2011},
url = {https://doi.org/10.3390/s110706868},
doi = {10.3390/S110706868},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ChenLCHLYC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/LeeYCYL11,
author = {Po{-}Lei Lee and
Chia{-}Lung Yeh and
John Yung{-}Sung Cheng and
Chia{-}Yen Yang and
Gong{-}Yau Lan},
title = {An SSVEP-Based {BCI} Using High Duty-Cycle Visual Flicker},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {58},
number = {12},
pages = {3350--3359},
year = {2011},
url = {https://doi.org/10.1109/TBME.2011.2162586},
doi = {10.1109/TBME.2011.2162586},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/LeeYCYL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LinYHCL11,
author = {Yi{-}Min Lin and
Chi{-}Heng Yang and
Chih{-}Hsiang Hsu and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A MPCN-Based Parallel Architecture in {BCH} Decoders for nand Flash
Memory Devices},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {58-II},
number = {10},
pages = {682--686},
year = {2011},
url = {https://doi.org/10.1109/TCSII.2011.2161704},
doi = {10.1109/TCSII.2011.2161704},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LinYHCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tits/LeeLCWTH11,
author = {Ping{-}Han Lee and
Yen{-}Liang Lin and
Shen{-}Chi Chen and
Chia{-}Hsiang Wu and
Cheng{-}Chih Tsai and
Yi{-}Ping Hung},
title = {Viewpoint-Independent Object Detection Based on Two-Dimensional Contours
and Three-Dimensional Sizes},
journal = {{IEEE} Trans. Intell. Transp. Syst.},
volume = {12},
number = {4},
pages = {1599--1608},
year = {2011},
url = {https://doi.org/10.1109/TITS.2011.2166260},
doi = {10.1109/TITS.2011.2166260},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tits/LeeLCWTH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acg/ChouCDLSTTWWWY11,
author = {Cheng{-}Wei Chou and
Ping{-}Chiang Chou and
Hassen Doghmen and
Chang{-}Shing Lee and
Tsan{-}Cheng Su and
Fabien Teytaud and
Olivier Teytaud and
Hui{-}Min Wang and
Mei{-}Hui Wang and
Li{-}Wen Wu and
Shi{-}Jim Yen},
editor = {H. Jaap van den Herik and
Aske Plaat},
title = {Towards a Solution of 7x7 Go with Meta-MCTS},
booktitle = {Advances in Computer Games - 13th International Conference, {ACG}
2011, Tilburg, The Netherlands, November 20-22, 2011, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {7168},
pages = {84--95},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-31866-5\_8},
doi = {10.1007/978-3-642-31866-5\_8},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/acg/ChouCDLSTTWWWY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avss/OhHPCCLMALDSWJRSVPRYTSFCD11,
author = {Sangmin Oh and
Anthony Hoogs and
A. G. Amitha Perera and
Naresh P. Cuntoor and
Chia{-}Chih Chen and
Jong Taek Lee and
Saurajit Mukherjee and
J. K. Aggarwal and
Hyungtae Lee and
Larry S. Davis and
Eran Swears and
Xiaoyang Wang and
Qiang Ji and
Kishore K. Reddy and
Mubarak Shah and
Carl Vondrick and
Hamed Pirsiavash and
Deva Ramanan and
Jenny Yuen and
Antonio Torralba and
Bi Song and
Anesco Fong and
Amit K. Roy{-}Chowdhury and
Mita Desai},
title = {{AVSS} 2011 demo session: {A} large-scale benchmark dataset for event
recognition in surveillance video},
booktitle = {8th {IEEE} International Conference on Advanced Video and Signal-Based
Surveillance, {AVSS} 2011, Klagenfurt, Austria, August 30 - September
2, 2011},
pages = {527--528},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/AVSS.2011.6027400},
doi = {10.1109/AVSS.2011.6027400},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/avss/OhHPCCLMALDSWJRSVPRYTSFCD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/LeeWCH11,
author = {Yaw{-}Chern Lee and
Hui{-}Min Wang and
Hui{-}Ya Chiang and
Sheng{-}Chieh Huang},
title = {An Observation on Circulatory System of Vegetative State Patient with
Music Therapy},
booktitle = {11th {IEEE} International Conference on Bioinformatics and Bioengineering,
{BIBE} 2011, Taichung, Taiwan, October 24-26, 2011},
pages = {129--132},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/BIBE.2011.28},
doi = {10.1109/BIBE.2011.28},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibe/LeeWCH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/YuTLCTCTCLH11,
author = {Meng{-}Chieh Yu and
Cheng{-}Chih Tsai and
Shih{-}Ta Liu and
Hao{-}Tien Chiang and
Ying{-}Chieh Tseng and
Wei{-}Ting Chen and
Wan{-}Wei Teo and
Mike Y. Chen and
Ming{-}Sui Lee and
Yi{-}Ping Hung},
editor = {Vicente Traver and
Ana L. N. Fred and
Joaquim Filipe and
Hugo Gamboa},
title = {I-m-Walk - Interactive Multimedia Walking-aware System},
booktitle = {{HEALTHINF} 2011 - Proceedings of the International Conference on
Health Informatics, Rome, Italy, 26-29 January, 2011},
pages = {17--26},
publisher = {SciTePress},
year = {2011},
timestamp = {Tue, 18 Oct 2022 21:16:17 +0200},
biburl = {https://dblp.org/rec/conf/biostec/YuTLCTCTCLH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/YangSICYLCLHHTWTYLWCCCCTCCCLLYSTLJDM11,
author = {S. H. Yang and
J. Y. Sheu and
M. K. Ieong and
M. H. Chiang and
T. Yamamoto and
J. J. Liaw and
S. S. Chang and
Y. M. Lin and
T. L. Hsu and
J. R. Hwang and
J. K. Ting and
C. H. Wu and
K. C. Ting and
F. C. Yang and
C. M. Liu and
I. L. Wu and
Y. M. Chen and
S. J. Chent and
K. S. Chen and
J. Y. Cheng and
M. H. Tsai and
W. Chang and
R. Chen and
C. C. Chen and
T. L. Lee and
C. K. Lin and
S. C. Yang and
Y. M. Sheu and
J. T. Tzeng and
L. C. Lu and
S. M. Jang and
Carlos H. Diaz and
Yuh{-}Jier Mii},
editor = {Rakesh Patel and
Tom Andre and
Aurangzeb Khan},
title = {28nm metal-gate high-K {CMOS} SoC technology for high-performance
mobile applications},
booktitle = {2011 {IEEE} Custom Integrated Circuits Conference, {CICC} 2011, San
Jose, CA, USA, Sept. 19-21, 2011},
pages = {1--5},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/CICC.2011.6055355},
doi = {10.1109/CICC.2011.6055355},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cicc/YangSICYLCLHHTWTYLWCCCCTCCCLLYSTLJDM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LeeCA11,
author = {Jong Taek Lee and
Chia{-}Chih Chen and
Jake K. Aggarwal},
title = {Recognizing human-vehicle interactions from aerial video without training},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2011, Colorado Springs, CO, USA, 20-25 June, 2011},
pages = {53--60},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/CVPRW.2011.5981794},
doi = {10.1109/CVPRW.2011.5981794},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/LeeCA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/OhHPCCLMALDSWJRSVPRYTSFRD11,
author = {Sangmin Oh and
Anthony Hoogs and
A. G. Amitha Perera and
Naresh P. Cuntoor and
Chia{-}Chih Chen and
Jong Taek Lee and
Saurajit Mukherjee and
J. K. Aggarwal and
Hyungtae Lee and
Larry S. Davis and
Eran Swears and
Xiaoyang Wang and
Qiang Ji and
Kishore K. Reddy and
Mubarak Shah and
Carl Vondrick and
Hamed Pirsiavash and
Deva Ramanan and
Jenny Yuen and
Antonio Torralba and
Bi Song and
Anesco Fong and
Amit K. Roy{-}Chowdhury and
Mita Desai},
title = {A large-scale benchmark dataset for event recognition in surveillance
video},
booktitle = {The 24th {IEEE} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2011, Colorado Springs, CO, USA, 20-25 June 2011},
pages = {3153--3160},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/CVPR.2011.5995586},
doi = {10.1109/CVPR.2011.5995586},
timestamp = {Thu, 25 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/OhHPCCLMALDSWJRSVPRYTSFRD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/ChenLH11,
author = {Chia{-}I Chen and
Bau{-}Cheng Lee and
Juinn{-}Dar Huang},
title = {Architectural exploration of 3D FPGAs towards a better balance between
area and delay},
booktitle = {Design, Automation and Test in Europe, {DATE} 2011, Grenoble, France,
March 14-18, 2011},
pages = {587--590},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/DATE.2011.5763290},
doi = {10.1109/DATE.2011.5763290},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/ChenLH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/LeeLSZWTHCH11,
author = {Yaw{-}Chern Lee and
Chun{-}Yang Lei and
Yi{-}Sen Shih and
Wen{-}Chih Zhang and
Hui{-}Min Wang and
Cheng{-}Lung Tseng and
Mark C. Hou and
Hui{-}Ya Chiang and
Sheng{-}Chieh Huang},
title = {{HRV} response of vegetative state patient with music therapy},
booktitle = {33rd Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2011, Boston, MA, USA, August
30 - Sept. 3, 2011},
pages = {1701--1704},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IEMBS.2011.6090488},
doi = {10.1109/IEMBS.2011.6090488},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/LeeLSZWTHCH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/HsuLCL11,
author = {Chih{-}Hsiang Hsu and
Yi{-}Min Lin and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 2.56 Gb/s soft {RS} (255, 239) decoder chip for optical communication
systems},
booktitle = {Proceedings of the 37th European Solid-State Circuits Conference,
{ESSCIRC} 2011, Helsinki, Finland, Sept. 12-16, 2011},
pages = {79--82},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ESSCIRC.2011.6044919},
doi = {10.1109/ESSCIRC.2011.6044919},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/HsuLCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/LiuHCL11,
author = {Po{-}Chun Liu and
Ju{-}Hung Hsiao and
Hsie{-}Chia Chang and
Chen{-}Yi Lee},
title = {A 2.97 Gb/s DPA-resistant {AES} engine with self-generated random
sequence},
booktitle = {Proceedings of the 37th European Solid-State Circuits Conference,
{ESSCIRC} 2011, Helsinki, Finland, Sept. 12-16, 2011},
pages = {71--74},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ESSCIRC.2011.6044917},
doi = {10.1109/ESSCIRC.2011.6044917},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/LiuHCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/KoFLL11,
author = {Chia{-}Nan Ko and
Yu{-}Yi Fu and
Guan{-}Yu Liu and
Cheng{-}Ming Lee},
title = {Identification of time-delay chaotic system with outliers: Fuzzy neural
networks using hybrid learning algorithm},
booktitle = {{FUZZ-IEEE} 2011, {IEEE} International Conference on Fuzzy Systems,
Taipei, Taiwan, 27-30 June, 2011, Proceedings},
pages = {2827--2832},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/FUZZY.2011.6007456},
doi = {10.1109/FUZZY.2011.6007456},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/KoFLL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/TanIJWKC11,
author = {Shing Chiang Tan and
Zuwairie Ibrahim and
Wen Jau Lee and
Junzo Watada and
Marzuki Khalid and
Lim Chun Chew},
title = {Learning with imbalanced datasets using fuzzy ARTMAP-based neural
network models},
booktitle = {{FUZZ-IEEE} 2011, {IEEE} International Conference on Fuzzy Systems,
Taipei, Taiwan, 27-30 June, 2011, Proceedings},
pages = {1084--1089},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/FUZZY.2011.6007330},
doi = {10.1109/FUZZY.2011.6007330},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/TanIJWKC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ChengLL11,
author = {Jen{-}Po Cheng and
Chia{-}han Lee and
Tzu{-}Ming Lin},
title = {Prioritized Random Access with dynamic access barring for {RAN} overload
in 3GPP {LTE-A} networks},
booktitle = {Workshops Proceedings of the Global Communications Conference, {GLOBECOM}
2011, 5-9 December 2011, Houston, Texas, {USA}},
pages = {368--372},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/GLOCOMW.2011.6162473},
doi = {10.1109/GLOCOMW.2011.6162473},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/ChengLL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/ChenCSL11,
author = {Wei{-}Chia Chen and
Yun{-}Maw Cheng and
Frode Eika Sandnes and
Chao{-}Lung Lee},
editor = {Julie A. Jacko},
title = {Finding Suitable Candidates: The Design of a Mobile Volunteering Matching
System},
booktitle = {Human-Computer Interaction. Towards Mobile and Intelligent Interaction
Environments - 14th International Conference, {HCI} International
2011, Orlando, FL, USA, July 9-14, 2011, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {6763},
pages = {21--29},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-21616-9\_3},
doi = {10.1007/978-3-642-21616-9\_3},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hci/ChenCSL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcc/ChenCLHLYC11,
author = {Yen{-}Lin Chen and
Chuan{-}Yen Chiang and
Wen{-}Yew Liang and
Tung{-}Ju Hsieh and
Da{-}Cheng Lee and
Shyan{-}Ming Yuan and
Yang{-}Lang Chang},
editor = {Parimala Thulasiraman and
Laurence Tianruo Yang and
Qiwen Pan and
Xingang Liu and
Yaw{-}Chung Chen and
Yo{-}Ping Huang and
Lin{-}Huang Chang and
Che{-}Lun Hung and
Che{-}Rung Lee and
Justin Y. Shi and
Ying Zhang},
title = {Developing Ubiquitous Multi-touch Sensing and Displaying Systems with
Vision-Based Finger Detection and Event Identification Techniques},
booktitle = {13th {IEEE} International Conference on High Performance Computing
{\&} Communication, {HPCC} 2011, Banff, Alberta, Canada, September
2-4, 2011},
pages = {898--903},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/HPCC.2011.129},
doi = {10.1109/HPCC.2011.129},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpcc/ChenCLHLYC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/LinLCC11,
author = {Tzong{-}Yen Lin and
Cheng{-}Yu Lee and
Chia{-}Jung Chen and
Rong{-}Guey Chang},
editor = {Yang Xiang and
Alfredo Cuzzocrea and
Michael Hobbs and
Wanlei Zhou},
title = {Compiler Support for Concurrency Synchronization},
booktitle = {Algorithms and Architectures for Parallel Processing - 11th International
Conference, ICA3PP, Melbourne, Australia, October 24-26, 2011, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {7016},
pages = {93--105},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-24650-0\_9},
doi = {10.1007/978-3-642-24650-0\_9},
timestamp = {Fri, 22 Apr 2022 17:07:03 +0200},
biburl = {https://dblp.org/rec/conf/ica3pp/LinLCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/TengCL11,
author = {Daniel Chia{-}En Teng and
Nian{-}Shing Chen and
Cheng{-}Han Lee},
title = {Enhancing English Reading Comprehension by Integrating Direct Access
to Digital Materials and Scaffolded Questionings in Paper Prints},
booktitle = {{ICALT} 2011, 11th {IEEE} International Conference on Advanced Learning
Technologies, Athens, Georgia, USA, 6-8 July 2011},
pages = {244--248},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICALT.2011.77},
doi = {10.1109/ICALT.2011.77},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/TengCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ChenCLCL11,
author = {Yun{-}Nung Chen and
Chia{-}Ping Chen and
Hung{-}yi Lee and
Chun{-}an Chan and
Lin{-}Shan Lee},
title = {Improved spoken term detection with graph-based re-ranking in feature
space},
booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
and Signal Processing, {ICASSP} 2011, May 22-27, 2011, Prague Congress
Center, Prague, Czech Republic},
pages = {5644--5647},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICASSP.2011.5947640},
doi = {10.1109/ICASSP.2011.5947640},
timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/ChenCLCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LeeTCHL11,
author = {Hung{-}yi Lee and
Tsung{-}wei Tu and
Chia{-}Ping Chen and
Chao{-}Yu Huang and
Lin{-}Shan Lee},
title = {Improved spoken term detection using support vector machines based
on lattice context consistency},
booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
and Signal Processing, {ICASSP} 2011, May 22-27, 2011, Prague Congress
Center, Prague, Czech Republic},
pages = {5648--5651},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICASSP.2011.5947641},
doi = {10.1109/ICASSP.2011.5947641},
timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/LeeTCHL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icccn/LeeSLYC11,
author = {Chia{-}Hang Lee and
Wen{-}Hsiang Shaw and
Hsin{-}I Liao and
Su{-}Ling Yeh and
Homer H. Chen},
editor = {Haohong Wang and
Jin Li and
George N. Rouskas and
Xiaobo Zhou},
title = {Local Dimming of Liquid Crystal Display Using Visual Attention Prediction
Model},
booktitle = {Proceedings of 20th International Conference on Computer Communications
and Networks, {ICCCN} 2011, Maui, Hawaii, USA, July 31 - August 4,
2011},
pages = {1--6},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICCCN.2011.6006058},
doi = {10.1109/ICCCN.2011.6006058},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/icccn/LeeSLYC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ChaoYCLW11,
author = {Yu{-}Wei Chao and
Yi{-}Ren Yeh and
Yu{-}Wen Chen and
Yuh{-}Jye Lee and
Yu{-}Chiang Frank Wang},
editor = {Beno{\^{\i}}t Macq and
Peter Schelkens},
title = {Locality-constrained group sparse representation for robust face recognition},
booktitle = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011,
Brussels, Belgium, September 11-14, 2011},
pages = {761--764},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICIP.2011.6116666},
doi = {10.1109/ICIP.2011.6116666},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/ChaoYCLW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/LeeCCWY11,
author = {Chien{-}Nan Lee and
Yiu{-}Tong Chu and
Ling Cheng and
Chia{-}Chen Wu and
Chan{-}Yueh Yang},
title = {Usage of smart mobile device at the telemedicine},
booktitle = {International Conference on Machine Learning and Cybernetics, {ICMLC}
2011, Guilin, China, July 10-13, 2011, Proceedings},
pages = {582--587},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICMLC.2011.6016800},
doi = {10.1109/ICMLC.2011.6016800},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icmlc/LeeCCWY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iih-msp/ChangLLC11,
author = {Chin{-}Chen Chang and
Hai{-}Duong Le and
Chia{-}Yin Lee and
Ching{-}Hsiang Chang},
editor = {Xiamu Niu and
Mingchu Li and
Y{\^{o}}iti Suzuki and
Jeng{-}Shyang Pan and
Lakhmi C. Jain},
title = {A Robust and Efficient Smart Card Oriented Remote User Authentication
Protocol},
booktitle = {Seventh International Conference on Intelligent Information Hiding
and Multimedia Signal Processing, {IIH-MSP} 2011, Dalian, China, October
14-16, 2011},
pages = {252--255},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/IIHMSP.2011.51},
doi = {10.1109/IIHMSP.2011.51},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iih-msp/ChangLLC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-09-30 01:22 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
