default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Quan Dou"
more than 1000 matches, exporting first 1000 hits only!
download as .bib file
@article{DBLP:journals/ijon/CaoMHCLZQJ25,
author = {Zhen Cao and
Chuanfeng Ma and
Biao Hou and
Xiaoyu Chen and
Leida Li and
Hao Zhu and
Dou Quan and
Licheng Jiao},
title = {A two-stage strategy for brain-inspired unsupervised learning in spiking
neural networks},
journal = {Neurocomputing},
volume = {611},
pages = {128655},
year = {2025},
url = {https://doi.org/10.1016/j.neucom.2024.128655},
doi = {10.1016/J.NEUCOM.2024.128655},
timestamp = {Tue, 22 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/CaoMHCLZQJ25.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/es/Munoz24,
author = {Santiago Rodrigo{-}Munoz},
title = {A double full-stack architecture for multi-core quantum computers},
school = {Polytechnic University of Catalonia, Spain},
year = {2024},
url = {http://hdl.handle.net/10803/690443},
timestamp = {Thu, 15 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/es/Munoz24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/axioms/CarvalhoSCMS24,
author = {Edson Donizete de Carvalho and
Waldir Silva Soares Jr. and
Douglas Fernando Copatti and
Carlos Alexandre Ribeiro Martins and
Eduardo Brandani da Silva},
title = {Algebraic and Geometric Methods for Construction of Topological Quantum
Codes from Lattices},
journal = {Axioms},
volume = {13},
number = {10},
pages = {676},
year = {2024},
url = {https://doi.org/10.3390/axioms13100676},
doi = {10.3390/AXIOMS13100676},
timestamp = {Wed, 06 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/axioms/CarvalhoSCMS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/axioms/Natanson24,
author = {Gregory Natanson},
title = {Double-Step Shape Invariance of Radial Jacobi-Reference Potential
and Breakdown of Conventional Rules of Supersymmetric Quantum Mechanics},
journal = {Axioms},
volume = {13},
number = {4},
pages = {273},
year = {2024},
url = {https://doi.org/10.3390/axioms13040273},
doi = {10.3390/AXIOMS13040273},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/axioms/Natanson24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cic/BhaumikCFMN24,
author = {Ritam Bhaumik and
Andr{\'{e}} Chailloux and
Paul Frixons and
Bart Mennink and
Mar{\'{\i}}a Naya{-}Plasencia},
title = {Block Cipher Doubling for a Post-Quantum World},
journal = {{IACR} Commun. Cryptol.},
volume = {1},
number = {3},
pages = {4},
year = {2024},
url = {https://doi.org/10.62056/av4fvua5v},
doi = {10.62056/AV4FVUA5V},
timestamp = {Wed, 06 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cic/BhaumikCFMN24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/JiaLZTDD24,
author = {Juncheng Jia and
Ji Liu and
Chendi Zhou and
Hao Tian and
Mianxiong Dong and
Dejing Dou},
title = {Efficient asynchronous federated learning with sparsification and
quantization},
journal = {Concurr. Comput. Pract. Exp.},
volume = {36},
number = {9},
year = {2024},
url = {https://doi.org/10.1002/cpe.8002},
doi = {10.1002/CPE.8002},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/concurrency/JiaLZTDD24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/KongSDXLGZCGHHLT24,
author = {Weiwen Kong and
Yongmei Sun and
Tianqi Dou and
Yuheng Xie and
Zhenhua Li and
Yaoxian Gao and
Qi Zhao and
Na Chen and
Wenpeng Gao and
Yuanchen Hao and
Peizhe Han and
Yang Liu and
Jianjun Tang},
title = {Enhanced Coexistence of Quantum Key Distribution and Classical Communication
over Hollow-Core and Multi-Core Fibers},
journal = {Entropy},
volume = {26},
number = {7},
pages = {601},
year = {2024},
url = {https://doi.org/10.3390/e26070601},
doi = {10.3390/E26070601},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/KongSDXLGZCGHHLT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/MeisterP24,
author = {Bernhard K. Meister and
Henry C. W. Price},
title = {A Quantum Double-or-Nothing Game: An Application of the Kelly Criterion
to Spins},
journal = {Entropy},
volume = {26},
number = {1},
pages = {66},
year = {2024},
url = {https://doi.org/10.3390/e26010066},
doi = {10.3390/E26010066},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/MeisterP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/NiuXGWSWDDWCZ24,
author = {Yan Niu and
Jie Xiang and
Kai Gao and
Jinglong Wu and
Jie Sun and
Bin Wang and
Runan Ding and
Mingliang Dou and
Xin Wen and
Xiaohong Cui and
Mengni Zhou},
title = {Multi-Frequency Entropy for Quantifying Complex Dynamics and Its Application
on {EEG} Data},
journal = {Entropy},
volume = {26},
number = {9},
pages = {728},
year = {2024},
url = {https://doi.org/10.3390/e26090728},
doi = {10.3390/E26090728},
timestamp = {Tue, 22 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/NiuXGWSWDDWCZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LinHLLWZ24,
author = {Hao Lin and
Yue He and
Fanzhang Li and
Quan Liu and
Bangjun Wang and
Fei Zhu},
title = {Taking complementary advantages: Improving exploration via double
self-imitation learning in procedurally-generated environments},
journal = {Expert Syst. Appl.},
volume = {238},
number = {Part {E}},
pages = {122145},
year = {2024},
url = {https://doi.org/10.1016/j.eswa.2023.122145},
doi = {10.1016/J.ESWA.2023.122145},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/LinHLLWZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/AlexeevABBBCCCCCCCCMDEE24,
author = {Yuri Alexeev and
Maximilian Amsler and
Marco Antonio Barroca and
Sanzio Bassini and
Torey Battelle and
Daan Camps and
David Casanova and
Young Jay Choi and
Frederic T. Chong and
Charles Chung and
Christopher Codella and
Antonio D. C{\'{o}}rcoles and
James Cruise and
Alberto Di Meglio and
Ivan Duran and
Thomas Eckl and
Sophia E. Economou and
Stephan J. Eidenbenz and
Bruce Elmegreen and
Clyde Fare and
Ismael Faro and
Cristina Sanz Fern{\'{a}}ndez and
Rodrigo Neumann Barros Ferreira and
Keisuke Fuji and
Bryce Fuller and
Laura Gagliardi and
Giulia Galli and
Jennifer R. Glick and
Isacco Gobbi and
Pranav Gokhale and
Salvador de la Puente Gonzalez and
Johannes Greiner and
Bill Gropp and
Michele Grossi and
Emanuel Gull and
Burns Healy and
Matthew R. Hermes and
Benchen Huang and
Travis S. Humble and
Nobuyasu Ito and
Artur F. Izmaylov and
Ali Javadi{-}Abhari and
Douglas M. Jennewein and
Shantenu Jha and
Liang Jiang and
Barbara Jones and
Wibe Albert de Jong and
Petar Jurcevic and
William M. Kirby and
Stefan Kister and
Masahiro Kitagawa and
Joel Klassen and
Katherine Klymko and
Kwangwon Koh and
Masaaki Kondo and
Doga Murat K{\"{u}}rk{\c{c}}{\"{u}}oglu and
Krzysztof Kurowski and
Teodoro Laino and
Ryan Landfield and
Matthew L. Leininger and
Vicente Leyton{-}Ortega and
Ang Li and
Meifeng Lin and
Junyu Liu and
Nicol{\'{a}}s Lorente and
Andr{\'{e}} Luckow and
Simon Martiel and
Francisco Mart{\'{\i}}n{-}Fern{\'{a}}ndez and
Margaret Martonosi and
Claire Marvinney and
Arcesio Casta{\~{n}}eda Medina and
Dirk Merten and
Antonio Mezzacapo and
Kristel Michielsen and
Abhishek Mitra and
Tushar Mittal and
Kyungsun Moon and
Joel Moore and
Sarah Mostame and
Mario Motta and
Young{-}Hye Na and
Yunseong Nam and
Prineha Narang and
Yu{-}ya Ohnishi and
Daniele Ottaviani and
Matthew Otten and
Scott Pakin and
Vincent R. Pascuzzi and
Edwin Pednault and
Tomasz Piontek and
Jed Pitera and
Patrick Rall and
Gokul Subramanian Ravi and
Niall Robertson and
Matteo A. C. Rossi and
Piotr Rydlichowski and
Hoon Ryu and
Georgy Samsonidze and
Mitsuhisa Sato and
Nishant Saurabh and
Vidushi Sharma and
Kunal Sharma and
Soyoung Shin and
George Slessman and
Mathias Steiner and
Iskandar Sitdikov and
In{-}Saeng Suh and
Eric D. Switzer and
Wei Tang and
Joel Thompson and
Synge Todo and
Minh C. Tran and
Dimitar Trenev and
Christian Trott and
Huan{-}Hsin Tseng and
Norm M. Tubman and
Esin Tureci and
David Garc{\'{\i}}a Vali{\~{n}}as and
Sofia Vallecorsa and
Christopher Wever and
Konrad Wojciechowski and
Xiaodi Wu and
Shinjae Yoo and
Nobuyuki Yoshioka and
Victor Wen{-}zhe Yu and
Seiji Yunoki and
Sergiy Zhuk and
Dmitry Zubarev},
title = {Quantum-centric supercomputing for materials science: {A} perspective
on challenges and future directions},
journal = {Future Gener. Comput. Syst.},
volume = {160},
pages = {666--710},
year = {2024},
url = {https://doi.org/10.1016/j.future.2024.04.060},
doi = {10.1016/J.FUTURE.2024.04.060},
timestamp = {Thu, 07 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fgcs/AlexeevABBBCCCCCCCCMDEE24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceta/HiroseK24,
author = {Shoichi Hirose and
Hidenori Kuwakado},
title = {Quantum Collision Resistance of Double-Block-Length Hashing},
journal = {{IEICE} Trans. Fundam. Electron. Commun. Comput. Sci.},
volume = {107},
number = {9},
pages = {1478--1487},
year = {2024},
url = {https://doi.org/10.1587/transfun.2023dmp0007},
doi = {10.1587/TRANSFUN.2023DMP0007},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieiceta/HiroseK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/ZhangBSGC24,
author = {Lin Zhang and
Juncheng Bai and
Bingzhen Sun and
Yuqi Guo and
Xiangtang Chen},
title = {Kernel multi-granularity double-quantitative rough set based on ensemble
empirical mode decomposition: Application to stock price trends prediction},
journal = {Int. J. Approx. Reason.},
volume = {172},
pages = {109217},
year = {2024},
url = {https://doi.org/10.1016/j.ijar.2024.109217},
doi = {10.1016/J.IJAR.2024.109217},
timestamp = {Mon, 01 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijar/ZhangBSGC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/JiangZ24,
author = {Jiefang Jiang and
Xianyong Zhang},
title = {Feature selection based on self-information combining double-quantitative
class weights and three-order approximation accuracies in neighborhood
rough sets},
journal = {Inf. Sci.},
volume = {657},
pages = {119945},
year = {2024},
url = {https://doi.org/10.1016/j.ins.2023.119945},
doi = {10.1016/J.INS.2023.119945},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/JiangZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/LiuHDCF24,
author = {Jiahui Liu and
Mingang Hua and
Feiqi Deng and
Hua Chen and
Juntao Fei},
title = {Quantized fault detection filtering for discrete-time periodic MJSs
with repeated scalar nonlinearities via double periodic HMMs},
journal = {J. Frankl. Inst.},
volume = {361},
number = {4},
pages = {106619},
year = {2024},
url = {https://doi.org/10.1016/j.jfranklin.2024.01.020},
doi = {10.1016/J.JFRANKLIN.2024.01.020},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfi/LiuHDCF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/ChenCCPSWZ24,
author = {Yang Chen and
Binyu Cai and
Changhuan Chen and
Weiliang Peng and
Quan Sun and
Xiaofei Wang and
Hong Zhang},
title = {A 2-2 {MASH} {\(\Delta\)}{\(\Sigma\)} {ADC} with fast-charge {CLS}
input buffer and dual double sampling achieving 103.3-dB {SNDR} and
{\(\pm\)}2.5-ppm/FSR {INL}},
journal = {Microelectron. J.},
volume = {144},
pages = {106092},
year = {2024},
url = {https://doi.org/10.1016/j.mejo.2024.106092},
doi = {10.1016/J.MEJO.2024.106092},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/ChenCCPSWZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlc/DouPTJW24,
author = {Quansheng Dou and
Hao Pan and
Huanling Tang and
Ping Jiang and
Huixian Wang},
title = {Program synthesis algorithm based on context consistency heuristic},
journal = {Int. J. Mach. Learn. Cybern.},
volume = {15},
number = {2},
pages = {559--571},
year = {2024},
url = {https://doi.org/10.1007/s13042-023-01925-3},
doi = {10.1007/S13042-023-01925-3},
timestamp = {Wed, 24 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mlc/DouPTJW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/YaoSWD24,
author = {Quanming Yao and
Zhenqian Shen and
Yaqing Wang and
Dejing Dou},
title = {Property-Aware Relation Networks for Few-Shot Molecular Property Prediction},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {46},
number = {8},
pages = {5413--5429},
year = {2024},
url = {https://doi.org/10.1109/TPAMI.2024.3368090},
doi = {10.1109/TPAMI.2024.3368090},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/YaoSWD24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ChenZDXT24,
author = {Na Chen and
Qi Zhao and
Tianqi Dou and
Yuheng Xie and
Jianjun Tang},
title = {End-to-end entanglement establishment with lower latency in quantum
networks},
journal = {Quantum Inf. Process.},
volume = {23},
number = {2},
pages = {33},
year = {2024},
url = {https://doi.org/10.1007/s11128-023-04241-5},
doi = {10.1007/S11128-023-04241-5},
timestamp = {Sat, 16 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/ChenZDXT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/OumennanaDM24,
author = {M. Oumennana and
Z. Dahbi and
M. Mansour},
title = {Coherence versus quantum-memory-assisted entropic uncertainty relation
of double quantum dots with Rashba spin-orbit interaction},
journal = {Quantum Inf. Process.},
volume = {23},
number = {4},
pages = {114},
year = {2024},
url = {https://doi.org/10.1007/s11128-024-04325-w},
doi = {10.1007/S11128-024-04325-W},
timestamp = {Thu, 02 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/OumennanaDM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qmi/LondonBXVLKCM24,
author = {Charles London and
Douglas Brown and
Wenduan Xu and
Sezen Vatansever and
Christopher J. Langmead and
Dimitri Kartsaklis and
Stephen Clark and
Konstantinos Meichanetzidis},
title = {Peptide binding classification on quantum computers},
journal = {Quantum Mach. Intell.},
volume = {6},
number = {1},
pages = {35},
year = {2024},
url = {https://doi.org/10.1007/s42484-024-00154-3},
doi = {10.1007/S42484-024-00154-3},
timestamp = {Mon, 17 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qmi/LondonBXVLKCM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamam/GarrishCNB24,
author = {Justin Garrish and
Christine Chan and
Douglas Nychka and
Cecilia G. Diniz Behn},
title = {A Gaussian Process Model for Insulin Secretion Reconstruction with
Uncertainty Quantification: Applications in Cystic Fibrosis},
journal = {{SIAM} J. Appl. Math.},
volume = {84},
number = {3},
pages = {S65--S81},
year = {2024},
url = {https://doi.org/10.1137/22m1506225},
doi = {10.1137/22M1506225},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamam/GarrishCNB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/WangWQYSL24,
author = {Wenke Wang and
Jianlong Wang and
Dou Quan and
Meijuan Yang and
Junding Sun and
Bibo Lu},
title = {PolSAR Image Classification Via a Multigranularity Hybrid CNN-ViT
Model With External Tokens and Cross-Attention},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {17},
pages = {8003--8019},
year = {2024},
url = {https://doi.org/10.1109/JSTARS.2024.3384420},
doi = {10.1109/JSTARS.2024.3384420},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/WangWQYSL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/LiuD24,
author = {Lei Liu and
Xinglei Dou},
title = {QuCloud+: {A} Holistic Qubit Mapping Scheme for Single/Multi-programming
on 2D/3D {NISQ} Quantum Computers},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {21},
number = {1},
pages = {9:1--9:27},
year = {2024},
url = {https://doi.org/10.1145/3631525},
doi = {10.1145/3631525},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taco/LiuD24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tai/BolukiDDQ24,
author = {Shahin Boluki and
Siamak Zamani Dadaneh and
Edward R. Dougherty and
Xiaoning Qian},
title = {Bayesian Proper Orthogonal Decomposition for Learnable Reduced-Order
Models With Uncertainty Quantification},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {5},
number = {3},
pages = {1162--1173},
year = {2024},
url = {https://doi.org/10.1109/TAI.2023.3268609},
doi = {10.1109/TAI.2023.3268609},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tai/BolukiDDQ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tai/LiDPCZZ24,
author = {Wentao Li and
Chaojun Deng and
Witold Pedrycz and
Oscar Castillo and
Chao Zhang and
Tao Zhan},
title = {Double-Quantitative Feature Selection Approach for Multigranularity
Ordered Decision Systems},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {5},
number = {5},
pages = {2385--2396},
year = {2024},
url = {https://doi.org/10.1109/TAI.2023.3319301},
doi = {10.1109/TAI.2023.3319301},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tai/LiDPCZZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/XuWPZCCH24,
author = {Ningcun Xu and
Chen Wang and
Liang Peng and
Xiao{-}Hu Zhou and
Jingyao Chen and
Zhi Cheng and
Zeng{-}Guang Hou},
title = {A Double-Hurdle Quantification Model for Freezing of Gait of Parkinson's
Patients},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {71},
number = {10},
pages = {2936--2947},
year = {2024},
url = {https://doi.org/10.1109/TBME.2024.3402677},
doi = {10.1109/TBME.2024.3402677},
timestamp = {Tue, 22 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/XuWPZCCH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tce/LongCDZC24,
author = {Zhong Long and
Yuling Chen and
Hui Dou and
Yangwen Zhang and
Yao Chen},
title = {FedSQ: Sparse-Quantized Federated Learning for Communication Efficiency},
journal = {{IEEE} Trans. Consumer Electron.},
volume = {70},
number = {1},
pages = {4050--4061},
year = {2024},
url = {https://doi.org/10.1109/TCE.2024.3352432},
doi = {10.1109/TCE.2024.3352432},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tce/LongCDZC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/WangWZLMLS24,
author = {Hao Wang and
Jinwei Wang and
Jiawei Zhang and
Xiangyang Luo and
Bin Ma and
Bin Li and
Jinsheng Sun},
title = {General Forensics for Aligned Double {JPEG} Compression Based on the
Quantization Interference},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {34},
number = {6},
pages = {5191--5206},
year = {2024},
url = {https://doi.org/10.1109/TCSVT.2023.3341032},
doi = {10.1109/TCSVT.2023.3341032},
timestamp = {Sun, 08 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcsv/WangWZLMLS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/QuanWWLRKCJ24,
author = {Dou Quan and
Zhe Wang and
Shuang Wang and
Yunan Li and
Bo Ren and
Mengte Kang and
Jocelyn Chanussot and
Licheng Jiao},
title = {F3Net: Adaptive Frequency Feature Filtering Network for Multimodal
Remote Sensing Image Registration},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {62},
pages = {1--13},
year = {2024},
url = {https://doi.org/10.1109/TGRS.2024.3459416},
doi = {10.1109/TGRS.2024.3459416},
timestamp = {Tue, 22 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/QuanWWLRKCJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/WangLYLQJHJ24,
author = {Shuang Wang and
Qiaoling Lin and
Xiutiao Ye and
Yu Liao and
Dou Quan and
ZhongQian Jin and
Biao Hou and
Licheng Jiao},
title = {Multi-View Feature Fusion and Visual Prompt for Remote Sensing Image
Captioning},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {62},
pages = {1--17},
year = {2024},
url = {https://doi.org/10.1109/TGRS.2024.3426359},
doi = {10.1109/TGRS.2024.3426359},
timestamp = {Tue, 22 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/WangLYLQJHJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/YeYGYQL24,
author = {Yuanxin Ye and
Chao Yang and
Guoqing Gong and
Peizhen Yang and
Dou Quan and
Jiayuan Li},
title = {Robust Optical and {SAR} Image Matching Using Attention-Enhanced Structural
Features},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {62},
pages = {1--12},
year = {2024},
url = {https://doi.org/10.1109/TGRS.2024.3366247},
doi = {10.1109/TGRS.2024.3366247},
timestamp = {Sat, 16 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/YeYGYQL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/ZhouQWLCCLJ24,
author = {Rufan Zhou and
Dou Quan and
Shuang Wang and
Chonghua Lv and
Xianwei Cao and
Jocelyn Chanussot and
Yi Li and
Licheng Jiao},
title = {A Unified Deep Learning Network for Remote Sensing Image Registration
and Change Detection},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {62},
pages = {1--16},
year = {2024},
url = {https://doi.org/10.1109/TGRS.2023.3344751},
doi = {10.1109/TGRS.2023.3344751},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/ZhouQWLCCLJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/LuLAZNNL24,
author = {Shengchang Lu and
Bo Li and
Emmanuel Arriola and
Zichen Zhang and
Carl Nicholas and
Khai D. T. Ngo and
Guo{-}Quan Lu},
title = {Double-Sided Cooling Half-Bridge Power Module of 650V/150A Gallium
Nitride High-Electron-Mobility Transistor},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {71},
number = {12},
pages = {15578--15586},
year = {2024},
url = {https://doi.org/10.1109/TIE.2024.3383021},
doi = {10.1109/TIE.2024.3383021},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/LuLAZNNL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/GaziSSPHAHTSBSIV24,
author = {Asim Hossain Gazi and
Jesus Antonio Sanchez{-}Perez and
Georgia L. Saks and
Erick Andres Perez{-}Alday and
Ammer Haffar and
Hashir Ahmed and
Duaa Herraka and
Nitya Tarlapally and
Nicholas L. Smith and
J. Douglas Bremner and
Amit J. Shah and
Omer T. Inan and
Viola Vaccarino},
title = {Quantifying Posttraumatic Stress Disorder Symptoms During Traumatic
Memories Using Interpretable Markers of Respiratory Variability},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {28},
number = {8},
pages = {4912--4924},
year = {2024},
url = {https://doi.org/10.1109/JBHI.2024.3397589},
doi = {10.1109/JBHI.2024.3397589},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/GaziSSPHAHTSBSIV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/AmiriDM24,
author = {Melika Amiri and
Massoud Dousti and
Majid Mohammadi},
title = {Design and implementation of carry-save adder using quantum-dot cellular
automata},
journal = {J. Supercomput.},
volume = {80},
number = {2},
pages = {1554--1567},
year = {2024},
url = {https://doi.org/10.1007/s11227-023-05532-5},
doi = {10.1007/S11227-023-05532-5},
timestamp = {Fri, 02 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tjs/AmiriDM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/GuoFN24,
author = {Shouchang Guo and
Jeffrey A. Fessler and
Douglas C. Noll},
title = {Manifold Regularizer for High-Resolution fMRI Joint Reconstruction
and Dynamic Quantification},
journal = {{IEEE} Trans. Medical Imaging},
volume = {43},
number = {8},
pages = {2937--2948},
year = {2024},
url = {https://doi.org/10.1109/TMI.2024.3381197},
doi = {10.1109/TMI.2024.3381197},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/GuoFN24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/HuyanZQCJ24,
author = {Ning Huyan and
Xiangrong Zhang and
Dou Quan and
Jocelyn Chanussot and
Licheng Jiao},
title = {AUD-Net: {A} Unified Deep Detector for Multiple Hyperspectral Image
Anomaly Detection via Relation and Few-Shot Learning},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {35},
number = {5},
pages = {6835--6849},
year = {2024},
url = {https://doi.org/10.1109/TNNLS.2022.3213023},
doi = {10.1109/TNNLS.2022.3213023},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnn/HuyanZQCJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/QuanWHLLCHJ24,
author = {Dou Quan and
Shuang Wang and
Ning Huyan and
Yi Li and
Ruiqi Lei and
Jocelyn Chanussot and
Biao Hou and
Licheng Jiao},
title = {A Concurrent Multiscale Detector for End-to-End Image Matching},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {35},
number = {3},
pages = {3560--3574},
year = {2024},
url = {https://doi.org/10.1109/TNNLS.2022.3194079},
doi = {10.1109/TNNLS.2022.3194079},
timestamp = {Sat, 16 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tnn/QuanWHLLCHJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/WangZZFQWGJ24,
author = {Shuang Wang and
Qi Zang and
Dong Zhao and
Chaowei Fang and
Dou Quan and
Yutong Wan and
Yanhe Guo and
Licheng Jiao},
title = {Select, Purify, and Exchange: {A} Multisource Unsupervised Domain
Adaptation Method for Building Extraction},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {35},
number = {11},
pages = {16091--16105},
year = {2024},
url = {https://doi.org/10.1109/TNNLS.2023.3291876},
doi = {10.1109/TNNLS.2023.3291876},
timestamp = {Fri, 08 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tnn/WangZZFQWGJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tosc/LeeH24,
author = {Dongjae Lee and
Seokhie Hong},
title = {Improved Quantum Rebound Attacks on Double Block Length Hashing with
Round-Reduced {AES-256} and {ARIA-256}},
journal = {{IACR} Trans. Symmetric Cryptol.},
volume = {2024},
number = {3},
pages = {238--265},
year = {2024},
url = {https://doi.org/10.46586/tosc.v2024.i3.238-265},
doi = {10.46586/TOSC.V2024.I3.238-265},
timestamp = {Sat, 21 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tosc/LeeH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsg/ZhangYA24,
author = {Feiye Zhang and
Qingyu Yang and
Dou An},
title = {Hamlet: Hierarchical Multi-Objective Reinforcement Learning Method
for Charging Power Control of Electric Vehicles With Dynamic Quantity},
journal = {{IEEE} Trans. Smart Grid},
volume = {15},
number = {1},
pages = {783--794},
year = {2024},
url = {https://doi.org/10.1109/TSG.2023.3288277},
doi = {10.1109/TSG.2023.3288277},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tsg/ZhangYA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asiaccs/StebilaW24,
author = {Douglas Stebila and
Spencer Wilson},
editor = {Jianying Zhou and
Tony Q. S. Quek and
Debin Gao and
Alvaro A. C{\'{a}}rdenas},
title = {Quantum-Safe Account Recovery for WebAuthn},
booktitle = {Proceedings of the 19th {ACM} Asia Conference on Computer and Communications
Security, {ASIA} {CCS} 2024, Singapore, July 1-5, 2024},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3634737.3661138},
doi = {10.1145/3634737.3661138},
timestamp = {Fri, 16 Aug 2024 09:08:03 +0200},
biburl = {https://dblp.org/rec/conf/asiaccs/StebilaW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscwd/GuanHLZJC24,
author = {Quanlong Guan and
Jinneng He and
Zhao{-}Rong Lai and
Yuyu Zhou and
Quming Jiang and
Ziliang Chen},
editor = {Weiming Shen and
Jean{-}Paul A. Barth{\`{e}}s and
Junzhou Luo and
Tie Qiu and
Xiaobo Zhou and
Jinghui Zhang and
Haibin Zhu and
Kunkun Peng and
Tianyi Xu and
Ning Chen},
title = {Short-term Portfolio Optimization using Doubly Regularized Exponential
Growth Rate},
booktitle = {27th International Conference on Computer Supported Cooperative Work
in Design, {CSCWD} 2024, Tianjin, China, May 8-10, 2024},
pages = {2357--2362},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/CSCWD61410.2024.10580003},
doi = {10.1109/CSCWD61410.2024.10580003},
timestamp = {Mon, 29 Jul 2024 16:18:15 +0200},
biburl = {https://dblp.org/rec/conf/cscwd/GuanHLZJC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gamesec/LiL24,
author = {Zhen Li and
Qi Liao},
editor = {Arunesh Sinha and
Jie Fu and
Quanyan Zhu and
Tao Zhang},
title = {How Much Should {I} Double Spend My Bitcoin? Game Theory of Quantum
Mining},
booktitle = {Decision and Game Theory for Security - 15th International Conference,
GameSec 2024, New York City, NY, USA, October 16-18, 2024, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {14908},
pages = {87--106},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-74835-6\_5},
doi = {10.1007/978-3-031-74835-6\_5},
timestamp = {Thu, 17 Oct 2024 07:48:01 +0200},
biburl = {https://dblp.org/rec/conf/gamesec/LiL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ZhaoWMPH024,
author = {Yijun Zhao and
Tianyu Wang and
Douglas Mensah and
Ellise Parnoff and
Siyi He and
Gary Weiss},
editor = {Tung X. Bui},
title = {A Quantitative Machine Learning Approach to Evaluating Letters of
Recommendation},
booktitle = {57th Hawaii International Conference on System Sciences, {HICSS} 2024,
Hilton Hawaiian Village Waikiki Beach Resort, Hawaii, USA, January
3-6, 2024},
pages = {1276--1284},
publisher = {ScholarSpace},
year = {2024},
url = {https://hdl.handle.net/10125/106534},
timestamp = {Thu, 04 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ZhaoWMPH024.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/HuijbenDMSV24,
author = {Iris A. M. Huijben and
Matthijs Douze and
Matthew J. Muckley and
Ruud van Sloun and
Jakob Verbeek},
title = {Residual Quantization with Implicit Neural Codebooks},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=NBAc36V00H},
timestamp = {Mon, 02 Sep 2024 16:45:29 +0200},
biburl = {https://dblp.org/rec/conf/icml/HuijbenDMSV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/BianSLWQG24,
author = {Tianquan Bian and
Zhuangzhuang Sun and
Shi Liang and
Shuang Wang and
Dou Quan and
Yanhe Guo},
title = {A Dual-Branch Random Mask Alignment Framework for Semi-Supervised
PolSAR Terrain Classification},
booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
Symposium, Athens, Greece, July 7-12, 2024},
pages = {11252--11255},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IGARSS53475.2024.10642719},
doi = {10.1109/IGARSS53475.2024.10642719},
timestamp = {Thu, 26 Sep 2024 12:36:11 +0200},
biburl = {https://dblp.org/rec/conf/igarss/BianSLWQG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ChiaoISSST24,
author = {Raymond Chiao and
Nathan Inan and
Michael Scheibner and
Jay Sharping and
Douglas Singleton and
Michael Tobar},
title = {Quantum Technologies in Space to Determine the Gravitational Aharonov-Bohm
Effect},
booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
Symposium, Athens, Greece, July 7-12, 2024},
pages = {469--472},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IGARSS53475.2024.10642325},
doi = {10.1109/IGARSS53475.2024.10642325},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ChiaoISSST24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LiangZWHQW24,
author = {Fei Liang and
Qi Zang and
Zhengyao Wang and
Yang Hu and
Dou Quan and
Shuang Wang},
title = {Enhancing Change Detection Robustness: {A} Whitening Transformation
Approach},
booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
Symposium, Athens, Greece, July 7-12, 2024},
pages = {10342--10345},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IGARSS53475.2024.10642657},
doi = {10.1109/IGARSS53475.2024.10642657},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/LiangZWHQW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LvWQWDJGJ24,
author = {Chonghua Lv and
Wei Wang and
Dou Quan and
Shuang Wang and
Le Dong and
Xiangming Jiang and
Yu Gu and
Licheng Jiao},
title = {Fourier Domain Adaptive Multi-Modal Remote Sensing Image Template
Matching Based on Siamese Network},
booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
Symposium, Athens, Greece, July 7-12, 2024},
pages = {7325--7329},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IGARSS53475.2024.10642905},
doi = {10.1109/IGARSS53475.2024.10642905},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/LvWQWDJGJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChenQQ24,
author = {Jiayi Chen and
Rong Quan and
Jie Qin},
title = {Cross-Domain Few-Shot Semantic Segmentation via Doubly Matching Transformation},
booktitle = {Proceedings of the Thirty-Third International Joint Conference on
Artificial Intelligence, {IJCAI} 2024, Jeju, South Korea, August 3-9,
2024},
pages = {641--649},
publisher = {ijcai.org},
year = {2024},
url = {https://www.ijcai.org/proceedings/2024/71},
timestamp = {Fri, 18 Oct 2024 10:53:17 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/ChenQQ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/HanTZWGLLDHM24,
author = {Luyi Han and
Tao Tan and
Tianyu Zhang and
Xin Wang and
Yuan Gao and
Chunyao Lu and
Xinglong Liang and
Haoran Dou and
Yunzhi Huang and
Ritse Mann},
editor = {Marius George Linguraru and
Qi Dou and
Aasa Feragen and
Stamatia Giannarou and
Ben Glocker and
Karim Lekadir and
Julia A. Schnabel},
title = {Non-adversarial Learning: Vector-Quantized Common Latent Space for
Multi-sequence {MRI}},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2024 - 27th International Conference, Marrakesh, Morocco, October
6-10, 2024, Proceedings, Part {XI}},
series = {Lecture Notes in Computer Science},
volume = {15011},
pages = {481--491},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-72120-5\_45},
doi = {10.1007/978-3-031-72120-5\_45},
timestamp = {Tue, 22 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/HanTZWGLLDHM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/ZangWZHQLSZ24,
author = {Qi Zang and
Shuang Wang and
Dong Zhao and
Yang Hu and
Dou Quan and
Jinlong Li and
Nicu Sebe and
Zhun Zhong},
editor = {Jianfei Cai and
Mohan S. Kankanhalli and
Balakrishnan Prabhakaran and
Susanne Boll and
Ramanathan Subramanian and
Liang Zheng and
Vivek K. Singh and
Pablo C{\'{e}}sar and
Lexing Xie and
Dong Xu},
title = {Generalized Source-Free Domain-adaptive Segmentation via Reliable
Knowledge Propagation},
booktitle = {Proceedings of the 32nd {ACM} International Conference on Multimedia,
{MM} 2024, Melbourne, VIC, Australia, 28 October 2024 - 1 November
2024},
pages = {5967--5976},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3664647.3680567},
doi = {10.1145/3664647.3680567},
timestamp = {Wed, 06 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/ZangWZHQLSZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/PanBMWDSPYYLHYZX24,
author = {Yan Pan and
Yiming Bian and
Li Ma and
Heng Wang and
Jiayi Dou and
Yun Shao and
Yaodi Pi and
Ting Ye and
Jie Yang and
Yang Li and
Wei Huang and
Song Yu and
Yichen Zhang and
Bingjie Xu},
title = {High-rate quantum access network using coherent states},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2024,
San Diego, CA, USA, March 24-28, 2024},
pages = {1--3},
publisher = {{IEEE}},
year = {2024},
url = {https://ieeexplore.ieee.org/document/10526751},
timestamp = {Sat, 20 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/PanBMWDSPYYLHYZX24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/HwangK24,
author = {Juheon Hwang and
Jiwoo Kang},
title = {Aerial View 3D Human Pose Estimation Using Double Vector Quantized-Variational
AutoEncoders},
booktitle = {{IEEE/CVF} Winter Conference on Applications of Computer Vision Workshops,
{WACVW} 2024 - Workshops, Waikoloa, HI, USA, January 1-6, 2024},
pages = {341--350},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/WACVW60836.2024.00042},
doi = {10.1109/WACVW60836.2024.00042},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wacv/HwangK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-14732,
author = {Iris A. M. Huijben and
Matthijs Douze and
Matthew J. Muckley and
Ruud van Sloun and
Jakob Verbeek},
title = {Residual Quantization with Implicit Neural Codebooks},
journal = {CoRR},
volume = {abs/2401.14732},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.14732},
doi = {10.48550/ARXIV.2401.14732},
eprinttype = {arXiv},
eprint = {2401.14732},
timestamp = {Tue, 06 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-14732.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-12957,
author = {Xuefeng Han and
Wen Chen and
Jun Li and
Ming Ding and
Qingqing Wu and
Kang Wei and
Xiumei Deng and
Zhen Mei},
title = {Energy-Efficient Wireless Federated Learning via Doubly Adaptive Quantization},
journal = {CoRR},
volume = {abs/2402.12957},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.12957},
doi = {10.48550/ARXIV.2402.12957},
eprinttype = {arXiv},
eprint = {2402.12957},
timestamp = {Wed, 16 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-12957.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-11751,
author = {Chuang Yu and
Yunpeng Liu and
Jinmiao Zhao and
Dou Quan and
Zelin Shi},
title = {Relational Representation Learning Network for Cross-Spectral Image
Patch Matching},
journal = {CoRR},
volume = {abs/2403.11751},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.11751},
doi = {10.48550/ARXIV.2403.11751},
eprinttype = {arXiv},
eprint = {2403.11751},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-11751.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-15265,
author = {Jiayi Chen and
Rong Quan and
Jie Qin},
title = {Cross-Domain Few-Shot Semantic Segmentation via Doubly Matching Transformation},
journal = {CoRR},
volume = {abs/2405.15265},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.15265},
doi = {10.48550/ARXIV.2405.15265},
eprinttype = {arXiv},
eprint = {2405.15265},
timestamp = {Wed, 19 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-15265.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-18959,
author = {Rui Yang and
Shuang Wang and
Yingping Han and
Yuanheng Li and
Dong Zhao and
Dou Quan and
Yanhe Guo and
Licheng Jiao},
title = {Transcending Fusion: {A} Multi-Scale Alignment Method for Remote Sensing
Image-Text Retrieval},
journal = {CoRR},
volume = {abs/2405.18959},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.18959},
doi = {10.48550/ARXIV.2405.18959},
eprinttype = {arXiv},
eprint = {2405.18959},
timestamp = {Fri, 21 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-18959.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-17282,
author = {Quan Mai and
Susan Gauch and
Douglas Adams},
title = {SetBERT: Enhancing Retrieval Performance for Boolean Logic and Set
Operation Queries},
journal = {CoRR},
volume = {abs/2406.17282},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.17282},
doi = {10.48550/ARXIV.2406.17282},
eprinttype = {arXiv},
eprint = {2406.17282},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-17282.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-18696,
author = {Quan Mai and
Susan Gauch and
Douglas Adams and
Miaoqing Huang},
title = {Sequence Graph Network for Online Debate Analysis},
journal = {CoRR},
volume = {abs/2406.18696},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.18696},
doi = {10.48550/ARXIV.2406.18696},
eprinttype = {arXiv},
eprint = {2406.18696},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-18696.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-01926,
author = {Chaoxing Huang and
Ziqiang Yu and
Zijian Gao and
Qiuyi Shen and
Queenie Chan and
Vincent Wai{-}Sun Wong and
Winnie Chiu{-}Wing Chu and
Weitian Chen},
title = {Chemical Shift Encoding based Double Bonds Quantification in Triglycerides
using Deep Image Prior},
journal = {CoRR},
volume = {abs/2407.01926},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.01926},
doi = {10.48550/ARXIV.2407.01926},
eprinttype = {arXiv},
eprint = {2407.01926},
timestamp = {Sat, 24 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-01926.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-02911,
author = {Luyi Han and
Tao Tan and
Tianyu Zhang and
Xin Wang and
Yuan Gao and
Chunyao Lu and
Xinglong Liang and
Haoran Dou and
Yunzhi Huang and
Ritse Mann},
title = {Non-Adversarial Learning: Vector-Quantized Common Latent Space for
Multi-Sequence {MRI}},
journal = {CoRR},
volume = {abs/2407.02911},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.02911},
doi = {10.48550/ARXIV.2407.02911},
eprinttype = {arXiv},
eprint = {2407.02911},
timestamp = {Sat, 24 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-02911.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-03033,
author = {Elvys Linhares Pontes and
Carlos{-}Emiliano Gonz{\'{a}}lez{-}Gallardo and
Mohamed Benjannet and
Caryn Qu and
Antoine Doucet},
title = {L3iTC at the FinLLM Challenge Task: Quantization for Financial Text
Classification {\&} Summarization},
journal = {CoRR},
volume = {abs/2408.03033},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.03033},
doi = {10.48550/ARXIV.2408.03033},
eprinttype = {arXiv},
eprint = {2408.03033},
timestamp = {Thu, 12 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-03033.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2409-06839,
author = {Ariel Doubchak and
Tal Philosof and
Uri Erez and
Amit Berman},
title = {Design of Threshold-Constrained Indirect Quantizers},
journal = {CoRR},
volume = {abs/2409.06839},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2409.06839},
doi = {10.48550/ARXIV.2409.06839},
eprinttype = {arXiv},
eprint = {2409.06839},
timestamp = {Sat, 12 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2409-06839.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/StebilaW24,
author = {Douglas Stebila and
Spencer Wilson},
title = {Quantum-Safe Account Recovery for WebAuthn},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {678},
year = {2024},
url = {https://eprint.iacr.org/2024/678},
timestamp = {Wed, 29 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/StebilaW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AbdElAttyECE23,
author = {Bassem Abd{-}El{-}Atty and
Mohammed Ahmed El{-}Affendi and
Samia Allaoua Chelloug and
Ahmed A. Abd El{-}Latif},
title = {Double Medical Image Cryptosystem Based on Quantum Walk},
journal = {{IEEE} Access},
volume = {11},
pages = {69164--69176},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3289932},
doi = {10.1109/ACCESS.2023.3289932},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/AbdElAttyECE23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/DinhYNUY23,
author = {Hai Q. Dinh and
Bhanu Pratap Yadav and
Bac Trong Nguyen and
Ashish Kumar Upadhyay and
Woraphon Yamaka},
title = {Self-Dual Double Circulant, Self-Dual Double Negacirculant and {LCD}
Double Negacirculant Codes Over the Ring F\({}_{\mbox{q}}\)[u,v]/2
- u, v\({}^{\mbox{2}}\)-v, uv-vu{\textgreater}},
journal = {{IEEE} Access},
volume = {11},
pages = {92898--92912},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3309246},
doi = {10.1109/ACCESS.2023.3309246},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/DinhYNUY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/LinXLCK23,
author = {Guoping Lin and
Linlin Xie and
Jinjin Li and
Jinkun Chen and
Yi Kou},
title = {Local double quantitative fuzzy rough sets over two universes},
journal = {Appl. Soft Comput.},
volume = {145},
pages = {110556},
year = {2023},
url = {https://doi.org/10.1016/j.asoc.2023.110556},
doi = {10.1016/J.ASOC.2023.110556},
timestamp = {Mon, 18 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/asc/LinXLCK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/JiaZLQRLMZADCS23,
author = {Xiaoti Jia and
Pei Zhao and
Fuyi Li and
Zhaohui Qin and
Haoran Ren and
Junzhou Li and
Chunbo Miao and
Quanzhi Zhao and
Tatsuya Akutsu and
Gensheng Dou and
Zhen Chen and
Jiangning Song},
title = {ResNetKhib: a novel cell type-specific tool for predicting lysine
2-hydroxyisobutylation sites via transfer learning},
journal = {Briefings Bioinform.},
volume = {24},
number = {2},
year = {2023},
url = {https://doi.org/10.1093/bib/bbad063},
doi = {10.1093/BIB/BBAD063},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/JiaZLQRLMZADCS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/SunSCWTDZY23,
author = {Haoran Sun and
Zhaoqi Song and
Qiuming Chen and
Meiling Wang and
Furong Tang and
Lijun Dou and
Quan Zou and
Fenglong Yang},
title = {MMiKG: a knowledge graph-based platform for path mining of microbiota-mental
diseases interactions},
journal = {Briefings Bioinform.},
volume = {24},
number = {6},
year = {2023},
url = {https://doi.org/10.1093/bib/bbad340},
doi = {10.1093/BIB/BBAD340},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/SunSCWTDZY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccds/DinhYBPU23,
author = {Hai Q. Dinh and
Bhanu Pratap Yadav and
Tushar Bag and
Daniel Panario and
Ashish Kumar Upadhyay},
title = {Self-dual and {LCD} double circulant and double negacirculant codes
over a family of finite rings {\textdollar} {\textbackslash}mathbb
\{F\}{\_}\{q\}[v{\_}\{1\}, v{\_}\{2\},{\textbackslash}dots ,v{\_}\{t\}]{\textdollar}},
journal = {Cryptogr. Commun.},
volume = {15},
number = {3},
pages = {529--551},
year = {2023},
url = {https://doi.org/10.1007/s12095-022-00616-0},
doi = {10.1007/S12095-022-00616-0},
timestamp = {Tue, 18 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccds/DinhYBPU23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/HuaulmeHNPHCPLLDKLRMIHKMJ23,
author = {Arnaud Huaulm{\'{e}} and
Kanako Harada and
Quang{-}Minh Nguyen and
Bogyu Park and
Seungbum Hong and
Min{-}Kook Choi and
Michael Peven and
Yunshuang Li and
Yonghao Long and
Qi Dou and
Satyadwyoom Kumar and
Seenivasan Lalithkumar and
Hongliang Ren and
Hiroki Matsuzaki and
Yuto Ishikawa and
Yuriko Harai and
Satoshi Kondo and
Manoru Mitsuishi and
Pierre Jannin},
title = {PEg TRAnsfer Workflow recognition challenge report: Do multimodal
data improve recognition?},
journal = {Comput. Methods Programs Biomed.},
volume = {236},
pages = {107561},
year = {2023},
url = {https://doi.org/10.1016/j.cmpb.2023.107561},
doi = {10.1016/J.CMPB.2023.107561},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/HuaulmeHNPHCPLLDKLRMIHKMJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/LiuTZDL23,
author = {Xiaoyan Liu and
Huanling Tang and
Jie Zhao and
Quansheng Dou and
Mingyu Lu},
title = {TCAMixer: {A} lightweight Mixer based on a novel triple concepts attention
mechanism for {NLP}},
journal = {Eng. Appl. Artif. Intell.},
volume = {123},
number = {Part {C}},
pages = {106471},
year = {2023},
url = {https://doi.org/10.1016/j.engappai.2023.106471},
doi = {10.1016/J.ENGAPPAI.2023.106471},
timestamp = {Sat, 28 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eaai/LiuTZDL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecra/LuLD23,
author = {Tian Lu and
Xianghua Lu and
Yifan Dou},
title = {The Little Bid More, the Merrier? Quantifying the Effects of Filler-Item
Recommendations in Contingent Free Shipping},
journal = {Electron. Commer. Res. Appl.},
volume = {61},
pages = {101299},
year = {2023},
url = {https://doi.org/10.1016/j.elerap.2023.101299},
doi = {10.1016/J.ELERAP.2023.101299},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ecra/LuLD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/CarrilloPSD23,
author = {Raymundo Santana Carrillo and
J. M. Vel{\'{a}}zquez Peto and
Guo{-}Hua Sun and
Shi{-}Hai Dong},
title = {Quantum Information Entropy for a Hyperbolic Double Well Potential
in the Fractional Schr{\"{o}}dinger Equation},
journal = {Entropy},
volume = {25},
number = {7},
pages = {988},
year = {2023},
url = {https://doi.org/10.3390/e25070988},
doi = {10.3390/E25070988},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/entropy/CarrilloPSD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/finr/WangGYHZWLQ23,
author = {Yuanyuan Wang and
Yu Gu and
Yifei Yin and
Yingping Han and
He Zhang and
Shuang Wang and
Chenyu Li and
Dou Quan},
title = {Multimodal transformer augmented fusion for speech emotion recognition},
journal = {Frontiers Neurorobotics},
volume = {17},
year = {2023},
url = {https://doi.org/10.3389/fnbot.2023.1181598},
doi = {10.3389/FNBOT.2023.1181598},
timestamp = {Wed, 06 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/finr/WangGYHZWLQ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-cds/LamiAI23,
author = {Mohammed Lami and
Faris Al{-}naemi and
Walid R. Issa},
title = {Automated quantification system for vision through polymer-dispersed
liquid crystal double-glazed windows: Circuit implementation},
journal = {{IET} Circuits Devices Syst.},
volume = {17},
number = {1},
pages = {38--52},
year = {2023},
url = {https://doi.org/10.1049/cds2.12135},
doi = {10.1049/CDS2.12135},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-cds/LamiAI23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijfs/KongL0WS23,
author = {Linghuan Kong and
Mengzhuo Luo and
Jun Cheng and
Xin Wang and
Kaibo Shi},
title = {Interval Type-2 Fuzzy Dissipative Control for Multiagent Systems with
Markovian Switching Parameters Via Dynamic Event-Triggered and Double-Quantized
Schemes},
journal = {Int. J. Fuzzy Syst.},
volume = {25},
number = {5},
pages = {2020--2035},
year = {2023},
url = {https://doi.org/10.1007/s40815-023-01492-3},
doi = {10.1007/S40815-023-01492-3},
timestamp = {Sat, 20 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijfs/KongL0WS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/HoangXVTDH23,
author = {Tiep Minh Hoang and
Chao Xu and
Alireza Vahid and
Hoang Duong Tuan and
Trung Q. Duong and
Lajos Hanzo},
title = {Secrecy-Rate Optimization of Double RIS-Aided Space-Ground Networks},
journal = {{IEEE} Internet Things J.},
volume = {10},
number = {15},
pages = {13221--13234},
year = {2023},
url = {https://doi.org/10.1109/JIOT.2023.3262481},
doi = {10.1109/JIOT.2023.3262481},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/HoangXVTDH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/is/DoumardAEEMS23,
author = {Emmanuel Doumard and
Julien Aligon and
Elodie Escriva and
Jean{-}Baptiste Excoffier and
Paul Monsarrat and
Chantal Soul{\'{e}}{-}Dupuy},
title = {A quantitative approach for the comparison of additive local explanation
methods},
journal = {Inf. Syst.},
volume = {114},
pages = {102162},
year = {2023},
url = {https://doi.org/10.1016/j.is.2022.102162},
doi = {10.1016/J.IS.2022.102162},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/is/DoumardAEEMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/TangLWDL23,
author = {Huanling Tang and
Xiaoyan Liu and
Yulin Wang and
Quansheng Dou and
Mingyu Lu},
title = {Pay attention to the hidden semanteme},
journal = {Inf. Sci.},
volume = {640},
pages = {119076},
year = {2023},
url = {https://doi.org/10.1016/j.ins.2023.119076},
doi = {10.1016/J.INS.2023.119076},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/TangLWDL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamc/Sari23,
author = {Mustafa Sari},
title = {Additive double polycyclic codes over {\textdollar}{\textbackslash}mathbb
\{F\}{\_}\{p2\}{\textdollar} and their applications to quantum codes},
journal = {J. Appl. Math. Comput.},
volume = {69},
number = {5},
pages = {4045--4068},
year = {2023},
url = {https://doi.org/10.1007/s12190-023-01915-2},
doi = {10.1007/S12190-023-01915-2},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamc/Sari23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/Dong0023,
author = {Zhiyuan Dong and
Wei Cui and
Guofeng Zhang},
title = {On the dynamics of a quantum coherent feedback network of cavity-mediated
double quantum dot qubits},
journal = {J. Frankl. Inst.},
volume = {360},
number = {7},
pages = {4572--4596},
year = {2023},
url = {https://doi.org/10.1016/j.jfranklin.2023.03.001},
doi = {10.1016/J.JFRANKLIN.2023.03.001},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfi/Dong0023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/Dou0023,
author = {Tong Dou and
Guofeng Zhang and
Wei Cui},
title = {Efficient quantum feature extraction for CNN-based learning},
journal = {J. Frankl. Inst.},
volume = {360},
number = {11},
pages = {7438--7456},
year = {2023},
url = {https://doi.org/10.1016/j.jfranklin.2023.06.003},
doi = {10.1016/J.JFRANKLIN.2023.06.003},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfi/Dou0023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/LiZNYN23,
author = {Ruobing Li and
Quanmin Zhu and
Hamidreza Nemati and
Xicai Yue and
Pritesh Narayan},
title = {Trajectory tracking of a quadrotor using extend state observer based
U-model enhanced double sliding mode control},
journal = {J. Frankl. Inst.},
volume = {360},
number = {4},
pages = {3520--3544},
year = {2023},
url = {https://doi.org/10.1016/j.jfranklin.2022.11.036},
doi = {10.1016/J.JFRANKLIN.2022.11.036},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfi/LiZNYN23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgo/DingDS23,
author = {Rui Ding and
Chaoren Ding and
Quan Shen},
title = {The interpolating element-free Galerkin method for the p-Laplace double
obstacle mixed complementarity problem},
journal = {J. Glob. Optim.},
volume = {86},
number = {3},
pages = {781--820},
year = {2023},
url = {https://doi.org/10.1007/s10898-022-01260-x},
doi = {10.1007/S10898-022-01260-X},
timestamp = {Tue, 27 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jgo/DingDS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvis/PuZWS23,
author = {Jian Pu and
Wen{-}li Zhou and
Jian{-}hua Wang and
Wei Song},
title = {Visualization and quantitation of unsteadiness of film cooling near
stagnation line of a double-wall cooled vane leading edge},
journal = {J. Vis.},
volume = {26},
number = {1},
pages = {113--129},
year = {2023},
url = {https://doi.org/10.1007/s12650-022-00870-7},
doi = {10.1007/S12650-022-00870-7},
timestamp = {Thu, 09 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jvis/PuZWS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/PuH23,
author = {Luxi Pu and
Ru Han},
title = {Simulation study on quantum dot formation of double-qubit-Si-MOS device},
journal = {Microelectron. J.},
volume = {142},
pages = {106015},
year = {2023},
url = {https://doi.org/10.1016/j.mejo.2023.106015},
doi = {10.1016/J.MEJO.2023.106015},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/PuH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/UdarGG23,
author = {Prajvi Udar and
Anubha Goel and
R. S. Gupta},
title = {Quantum Effect Dependent Modelling of Short Channel Junctionless Double
Gate Stack(SC-JL-DG) {MOSFET} for High Frequency Analog Applications},
journal = {Microelectron. J.},
volume = {134},
pages = {105726},
year = {2023},
url = {https://doi.org/10.1016/j.mejo.2023.105726},
doi = {10.1016/J.MEJO.2023.105726},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/UdarGG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/UdarGG23a,
author = {Prajvi Udar and
Anubha Goel and
R. S. Gupta},
title = {Nanoscale Temperature Dependent Quantum-Effect Analytical Model of
Short- Channel, Junction-Less, Double-Gate Stack {(SC-JL-DG)} {MOSFET}
for Analog Applications at Higher Frequencies},
journal = {Microelectron. J.},
volume = {141},
pages = {105952},
year = {2023},
url = {https://doi.org/10.1016/j.mejo.2023.105952},
doi = {10.1016/J.MEJO.2023.105952},
timestamp = {Sun, 19 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/UdarGG23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HuZYMXZSYJDRZLZZYLWDHZCZZ23,
author = {Ping Hu and
Haizhu Zhou and
Tengfeng Yan and
Hongping Miu and
Feng Xiao and
Xinyi Zhu and
Lei Shu and
Shuang Yang and
Ruiyun Jin and
Wenlei Dou and
Baoyu Ren and
Lizhen Zhu and
Wanrong Liu and
Yihan Zhang and
Kaisheng Zeng and
Minhua Ye and
Shigang Lv and
Miaojing Wu and
Gang Deng and
Rong Hu and
Renya Zhan and
Qianxue Chen and
Dong Zhang and
Xingen Zhu},
title = {Deep learning-assisted identification and quantification of aneurysmal
subarachnoid hemorrhage in non-contrast {CT} scans: Development and
external validation of Hybrid 2D/3D UNet},
journal = {NeuroImage},
volume = {279},
pages = {120321},
year = {2023},
url = {https://doi.org/10.1016/j.neuroimage.2023.120321},
doi = {10.1016/J.NEUROIMAGE.2023.120321},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HuZYMXZSYJDRZLZZYLWDHZCZZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/oms/HorvathKMRS23,
author = {Samuel Horv{\'{a}}th and
Dmitry Kovalev and
Konstantin Mishchenko and
Peter Richt{\'{a}}rik and
Sebastian U. Stich},
title = {Stochastic distributed learning with gradient quantization and double-variance
reduction},
journal = {Optim. Methods Softw.},
volume = {38},
number = {1},
pages = {91--106},
year = {2023},
url = {https://doi.org/10.1080/10556788.2022.2117355},
doi = {10.1080/10556788.2022.2117355},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/oms/HorvathKMRS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/AmaziougDSA23,
author = {Mohamed Amazioug and
Mohammed Daoud and
Shailendra Kumar Singh and
Muhammad Asjad},
title = {Strong photon antibunching effect in a double-cavity optomechanical
system with intracavity squeezed light},
journal = {Quantum Inf. Process.},
volume = {22},
number = {8},
pages = {301},
year = {2023},
url = {https://doi.org/10.1007/s11128-023-04052-8},
doi = {10.1007/S11128-023-04052-8},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/AmaziougDSA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/CheZDCLY23,
author = {Bichen Che and
Yitong Zhang and
Zhao Dou and
Xiubo Chen and
Jian Li and
Yixian Yang},
title = {Multi-party quantum private information comparison based on nonlocal
orthogonal product states},
journal = {Quantum Inf. Process.},
volume = {22},
number = {6},
pages = {231},
year = {2023},
url = {https://doi.org/10.1007/s11128-023-03973-8},
doi = {10.1007/S11128-023-03973-8},
timestamp = {Thu, 08 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/CheZDCLY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/MariellaZ23,
author = {Nicola Mariella and
Sergiy Zhuk},
title = {A doubly stochastic matrices-based approach to optimal qubit routing},
journal = {Quantum Inf. Process.},
volume = {22},
number = {7},
pages = {264},
year = {2023},
url = {https://doi.org/10.1007/s11128-023-04023-z},
doi = {10.1007/S11128-023-04023-Z},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/MariellaZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SilvaBSC23,
author = {Eduardo Brandani da Silva and
Evandro Mazetto Brizola and
Waldir Silva Soares Jr. and
Douglas Fernando Copatti},
title = {New quantum surface codes from semi-regular tessellations},
journal = {Quantum Inf. Process.},
volume = {22},
number = {11},
pages = {398},
year = {2023},
url = {https://doi.org/10.1007/s11128-023-04147-2},
doi = {10.1007/S11128-023-04147-2},
timestamp = {Sun, 31 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/SilvaBSC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/YangHR23,
author = {Gang Yang and
Yan{-}Xia Huang and
Shi Rao},
title = {Tunable force-induced double window transparency in cavity optomechanical
system},
journal = {Quantum Inf. Process.},
volume = {22},
number = {1},
pages = {29},
year = {2023},
url = {https://doi.org/10.1007/s11128-022-03773-6},
doi = {10.1007/S11128-022-03773-6},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/YangHR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/quanbio/XiV23,
author = {Nan Miles Xi and
Angelos Vasilopoulos},
title = {Tuning hyperparameters of doublet-detection methods for single-cell
{RNA} sequencing data},
journal = {Quant. Biol.},
volume = {11},
number = {3},
pages = {297--305},
year = {2023},
url = {https://doi.org/10.15302/j-qb-022-0324},
doi = {10.15302/J-QB-022-0324},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/quanbio/XiV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/quantum/PlatoRW23,
author = {A. Douglas K. Plato and
Dennis R{\"{a}}tzel and
Chuanqi Wan},
title = {Enhanced Gravitational Entanglement via Modulated Optomechanics},
journal = {Quantum},
volume = {7},
pages = {1177},
year = {2023},
url = {https://doi.org/10.22331/q-2023-11-08-1177},
doi = {10.22331/Q-2023-11-08-1177},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/quantum/PlatoRW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TranVBD23,
author = {Ngan Tran and
Douglas C. Vandemark and
Fran{\c{c}}ois Bignalet{-}Cazalet and
G{\'{e}}rald Dibarboure},
title = {Quantifying Multifrequency Ocean Altimeter Wind Speed Error Due to
Sea Surface Temperature and Resulting Impacts on Satellite Sea Level
Measurements},
journal = {Remote. Sens.},
volume = {15},
number = {13},
pages = {3235},
year = {2023},
url = {https://doi.org/10.3390/rs15133235},
doi = {10.3390/RS15133235},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/TranVBD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamdm/LiuHLZ23,
author = {Siyan Liu and
Rong{-}Xia Hao and
Rong Luo and
Cun{-}Quan Zhang},
title = {5-Cycle Double Covers, 4-Flows, and Catlin Reduction},
journal = {{SIAM} J. Discret. Math.},
volume = {37},
number = {1},
pages = {253--267},
year = {2023},
url = {https://doi.org/10.1137/22m1472425},
doi = {10.1137/22M1472425},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/siamdm/LiuHLZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sj/WangLHDOMLQ23,
author = {Xiaowei Wang and
Haoran Li and
Manjiang Hu and
Quanli Dou and
Wenjie Ouyang and
Guifu Ma and
Yang Li and
Hongmao Qin},
title = {{HD} Map Construction and Update System for Autonomous Driving in
Open-Pit Mines},
journal = {{IEEE} Syst. J.},
volume = {17},
number = {4},
pages = {6202--6213},
year = {2023},
url = {https://doi.org/10.1109/JSYST.2023.3317288},
doi = {10.1109/JSYST.2023.3317288},
timestamp = {Fri, 19 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sj/WangLHDOMLQ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/JiaoHLLYZZHYLMLZCFTGQWLBLSF23,
author = {Licheng Jiao and
Zhongjian Huang and
Xiaoqiang Lu and
Xu Liu and
Yuting Yang and
Jiaxuan Zhao and
Jinyue Zhang and
Biao Hou and
Shuyuan Yang and
Fang Liu and
Wenping Ma and
Lingling Li and
Xiangrong Zhang and
Puhua Chen and
Zhixi Feng and
Xu Tang and
Yuwei Guo and
Dou Quan and
Shuang Wang and
Weibin Li and
Jing Bai and
Yangyang Li and
Ronghua Shang and
Jie Feng},
title = {Brain-Inspired Remote Sensing Foundation Models and Open Problems:
{A} Comprehensive Survey},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {16},
pages = {10084--10120},
year = {2023},
url = {https://doi.org/10.1109/JSTARS.2023.3316302},
doi = {10.1109/JSTARS.2023.3316302},
timestamp = {Wed, 20 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/staeors/JiaoHLLYZZHYLMLZCFTGQWLBLSF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/JiaoHLYMZYHYLMLCFTGZQWLBLSF23,
author = {Licheng Jiao and
Zhongjian Huang and
Xu Liu and
Yuting Yang and
Mengru Ma and
Jiaxuan Zhao and
Chao You and
Biao Hou and
Shuyuan Yang and
Fang Liu and
Wenping Ma and
Lingling Li and
Puhua Chen and
Zhixi Feng and
Xu Tang and
Yuwei Guo and
Xiangrong Zhang and
Dou Quan and
Shuang Wang and
Weibin Li and
Jing Bai and
Yangyang Li and
Ronghua Shang and
Jie Feng},
title = {Brain-Inspired Remote Sensing Interpretation: {A} Comprehensive Survey},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {16},
pages = {2992--3033},
year = {2023},
url = {https://doi.org/10.1109/JSTARS.2023.3247455},
doi = {10.1109/JSTARS.2023.3247455},
timestamp = {Fri, 08 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/staeors/JiaoHLYMZYHYLMLCFTGZQWLBLSF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/JiaoZLLYMLCFGTHZBQZ23,
author = {Licheng Jiao and
Xin Zhang and
Xu Liu and
Fang Liu and
Shuyuan Yang and
Wenping Ma and
Lingling Li and
Puhua Chen and
Zhixi Feng and
Yuwei Guo and
Xu Tang and
Biao Hou and
Xiangrong Zhang and
Jing Bai and
Dou Quan and
Junpeng Zhang},
title = {Transformer Meets Remote Sensing Video Detection and Tracking: {A}
Comprehensive Survey},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {16},
pages = {1--45},
year = {2023},
url = {https://doi.org/10.1109/JSTARS.2023.3289293},
doi = {10.1109/JSTARS.2023.3289293},
timestamp = {Tue, 30 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/JiaoZLLYMLCFGTHZBQZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/QuanWWLCGHJ23,
author = {Dou Quan and
Huiyuan Wei and
Shuang Wang and
Yi Li and
Jocelyn Chanussot and
Yanhe Guo and
Biao Hou and
Licheng Jiao},
title = {Efficient and Robust: {A} Cross-Modal Registration Deep Wavelet Learning
Method for Remote Sensing Images},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {16},
pages = {4739--4754},
year = {2023},
url = {https://doi.org/10.1109/JSTARS.2023.3276409},
doi = {10.1109/JSTARS.2023.3276409},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/QuanWWLCGHJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/TyralisPDD23,
author = {Hristos Tyralis and
Georgia Papacharalampous and
Nikolaos Doulamis and
Anastasios D. Doulamis},
title = {Merging Satellite and Gauge-Measured Precipitation Using LightGBM
With an Emphasis on Extreme Quantiles},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {16},
pages = {6969--6979},
year = {2023},
url = {https://doi.org/10.1109/JSTARS.2023.3297013},
doi = {10.1109/JSTARS.2023.3297013},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/TyralisPDD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasII/FangLX23,
author = {Xin Fang and
Yuan Chun Li and
Quan Xue},
title = {Dual-Band Single-Pole Double-Throw Filtering Switch Using Multimode
Cavity Resonators},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {70},
number = {9},
pages = {3383--3387},
year = {2023},
url = {https://doi.org/10.1109/TCSII.2023.3274372},
doi = {10.1109/TCSII.2023.3274372},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcasII/FangLX23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasII/TothMHII23,
author = {Peter Toth and
Alexander Meyer and
Sebastian Halama and
Hiroki Ishikuro and
Vadim Issakov},
title = {A Cryogenic 12 GHz Frequency Doubler With Temperature Compensation
for Trapped-Ion Quantum Computer},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {70},
number = {10},
pages = {3877--3881},
year = {2023},
url = {https://doi.org/10.1109/TCSII.2023.3290260},
doi = {10.1109/TCSII.2023.3290260},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcasII/TothMHII23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tce/NgoNN23,
author = {Ha Quang Thinh Ngo and
Hung Nguyen and
Thanh Phuong Nguyen},
title = {Fenceless Collision-Free Avoidance Driven by Visual Computation for
an Intelligent Cyber-Physical System Employing Both Single- and Double-S
Trajectory},
journal = {{IEEE} Trans. Consumer Electron.},
volume = {69},
number = {3},
pages = {622--639},
year = {2023},
url = {https://doi.org/10.1109/TCE.2023.3268296},
doi = {10.1109/TCE.2023.3268296},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tce/NgoNN23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/QuanWWGHJ23,
author = {Dou Quan and
Huiyuan Wei and
Shuang Wang and
Yu Gu and
Biao Hou and
Licheng Jiao},
title = {A Novel Coarse-to-Fine Deep Learning Registration Framework for Multimodal
Remote Sensing Images},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {61},
pages = {1--16},
year = {2023},
url = {https://doi.org/10.1109/TGRS.2023.3306042},
doi = {10.1109/TGRS.2023.3306042},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/QuanWWGHJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/JiangNZ23,
author = {Jifu Jiang and
Shuangxia Niu and
Xing Zhao},
title = {Quantitative Analysis of Hybrid-Excited Doubly Salient Machine With
Subslot Bottom PMs and Its Comparative Study},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {70},
number = {5},
pages = {4558--4569},
year = {2023},
url = {https://doi.org/10.1109/TIE.2022.3187571},
doi = {10.1109/TIE.2022.3187571},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/JiangNZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/ParkPDHGH23a,
author = {Andrew T. Park and
Nathaniel Peck and
Richard Dill and
Douglas D. Hodson and
Michael R. Grimaila and
Wayne C. Henry},
title = {Quantifying DDS-cerberus network control overhead},
journal = {J. Supercomput.},
volume = {79},
number = {4},
pages = {3616--3642},
year = {2023},
url = {https://doi.org/10.1007/s11227-022-04770-3},
doi = {10.1007/S11227-022-04770-3},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tjs/ParkPDHGH23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmlr/SrivastavaRRSAF23,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023},
url = {https://openreview.net/forum?id=uyTL5Bvosj},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmlr/SrivastavaRRSAF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnse/XiaoDXDKL23,
author = {Jiaren Xiao and
Quanyu Dai and
Xiaochen Xie and
Qi Dou and
Ka{-}Wai Kwok and
James Lam},
title = {Domain Adaptive Graph Infomax via Conditional Adversarial Networks},
journal = {{IEEE} Trans. Netw. Sci. Eng.},
volume = {10},
number = {1},
pages = {35--52},
year = {2023},
url = {https://doi.org/10.1109/TNSE.2022.3201529},
doi = {10.1109/TNSE.2022.3201529},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnse/XiaoDXDKL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsg/XieQWCHDH23,
author = {Xingfeng Xie and
Xiangjun Quan and
Zaijun Wu and
Xiaoyong Cao and
Wenqiang Hu and
Xiaobo Dou and
Qinran Hu},
title = {A Novel Peer-to-Peer Control Strategy for Multiterminal {DC} Distribution
Systems},
journal = {{IEEE} Trans. Smart Grid},
volume = {14},
number = {1},
pages = {785--797},
year = {2023},
url = {https://doi.org/10.1109/TSG.2022.3188666},
doi = {10.1109/TSG.2022.3188666},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tsg/XieQWCHDH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsg/ZhangDQHWL23,
author = {Congyue Zhang and
Xiaobo Dou and
Xiangjun Quan and
Qinran Hu and
Zaijun Wu and
Yongqing Lv},
title = {Distributed Secondary Control for Island Microgrids With Expected
Dynamic Performance Under Communication Delays},
journal = {{IEEE} Trans. Smart Grid},
volume = {14},
number = {3},
pages = {2010--2022},
year = {2023},
url = {https://doi.org/10.1109/TSG.2022.3212193},
doi = {10.1109/TSG.2022.3212193},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsg/ZhangDQHWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/WangQJZGY23,
author = {Jingjing Wang and
Tianqi Quan and
Lulu Jiao and
Weilong Zhang and
T. Aaron Gulliver and
Xinghai Yang},
title = {{DOA} Estimation of Underwater Acoustic Array Signal Based on Wavelet
Transform With Double Branch Convolutional Neural Network},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {72},
number = {5},
pages = {5962--5972},
year = {2023},
url = {https://doi.org/10.1109/TVT.2022.3203034},
doi = {10.1109/TVT.2022.3203034},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/WangQJZGY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/XiangXXC23,
author = {Youyang Xiang and
Ke Xu and
Binyang Xia and
Xiantao Cheng},
title = {Bayesian Joint Channel-and-Data Estimation for Quantized {OFDM} Over
Doubly Selective Channels},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {22},
number = {3},
pages = {1523--1536},
year = {2023},
url = {https://doi.org/10.1109/TWC.2022.3205284},
doi = {10.1109/TWC.2022.3205284},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/twc/XiangXXC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acssc/AtzeniTNS23,
author = {Italo Atzeni and
Antti T{\"{o}}lli and
Duy H. N. Nguyen and
A. Lee Swindlehurst},
title = {Doubly 1-Bit Quantized Massive {MIMO}},
booktitle = {57th Asilomar Conference on Signals, Systems, and Computers, {ACSSC}
2023, Pacific Grove, CA, USA, October 29 - Nov. 1, 2023},
pages = {465--469},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IEEECONF59524.2023.10476782},
doi = {10.1109/IEEECONF59524.2023.10476782},
timestamp = {Tue, 09 Apr 2024 10:37:41 +0200},
biburl = {https://dblp.org/rec/conf/acssc/AtzeniTNS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aistats/ClarteLKZ23,
author = {Lucas Clart{\'{e}} and
Bruno Loureiro and
Florent Krzakala and
Lenka Zdeborov{\'{a}}},
editor = {Francisco J. R. Ruiz and
Jennifer G. Dy and
Jan{-}Willem van de Meent},
title = {On double-descent in uncertainty quantification in overparametrized
models},
booktitle = {International Conference on Artificial Intelligence and Statistics,
25-27 April 2023, Palau de Congressos, Valencia, Spain},
series = {Proceedings of Machine Learning Research},
volume = {206},
pages = {7089--7125},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v206/clarte23a.html},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aistats/ClarteLKZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csai/WangDTZP23,
author = {Huixian Wang and
Quansheng Dou and
Huanling Tang and
Shun Zhang and
Hao Pan},
title = {A {SQL} Synthesis System with Operator Handler},
booktitle = {Proceedings of the 2023 7th International Conference on Computer Science
and Artificial Intelligence, {CSAI} 2023, Beijing, China, December
8-10, 2023},
pages = {132--136},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3638584.3638654},
doi = {10.1145/3638584.3638654},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/csai/WangDTZP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZhaoWZQYJ23,
author = {Dong Zhao and
Shuang Wang and
Qi Zang and
Dou Quan and
Xiutiao Ye and
Licheng Jiao},
title = {Towards Better Stability and Adaptability: Improve Online Self-Training
for Model Adaptation in Semantic Segmentation},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
pages = {11733--11743},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPR52729.2023.01129},
doi = {10.1109/CVPR52729.2023.01129},
timestamp = {Wed, 06 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ZhaoWZQYJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cyberc/DouLLSP23,
author = {Quansheng Dou and
Jing Liu and
Bingchun Li and
Chen Shuzhen and
Jiang Ping},
title = {Nested Named Entity Recognition Based on Multi-word Fusion and Boundary
Detection},
booktitle = {International Conference on Cyber-Enabled Distributed Computing and
Knowledge Discovery, CyberC 2023, Jiangsu, China, November 2-4, 2023},
pages = {92--95},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CyberC58899.2023.00025},
doi = {10.1109/CYBERC58899.2023.00025},
timestamp = {Fri, 08 Mar 2024 08:28:28 +0100},
biburl = {https://dblp.org/rec/conf/cyberc/DouLLSP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dasc/LongCDLTS23,
author = {Zhong Long and
Yuling Chen and
Hui Dou and
Yun Luo and
Chaoyue Tan and
Yancheng Sun},
title = {Communication-Efficient Federated Learning with Sparsity and Quantization},
booktitle = {{IEEE} Intl Conf on Dependable, Autonomic and Secure Computing, Intl
Conf on Pervasive Intelligence and Computing, Intl Conf on Cloud and
Big Data Computing, Intl Conf on Cyber Science and Technology Congress,
DASC/PiCom/CBDCom/CyberSciTech 2023, Abu Dhabi, United Arab Emirates,
November 14-17, 2023},
pages = {415--421},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/DASC/PiCom/CBDCom/Cy59711.2023.10361468},
doi = {10.1109/DASC/PICOM/CBDCOM/CY59711.2023.10361468},
timestamp = {Tue, 23 Jan 2024 20:30:56 +0100},
biburl = {https://dblp.org/rec/conf/dasc/LongCDLTS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dmbd/DouWTPZ23,
author = {Quansheng Dou and
Huixian Wang and
Huanling Tang and
Hao Pan and
Shun Zhang},
editor = {Ying Tan and
Yuhui Shi},
title = {Query Reverse Engineering of Pre-deleted Uncorrelated Operators},
booktitle = {Data Mining and Big Data - 8th International Conference, {DMBD} 2023,
Sanya, China, December 9-12, 2023, Proceedings, Part {II}},
series = {Communications in Computer and Information Science},
volume = {2018},
pages = {45--58},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-0844-4\_4},
doi = {10.1007/978-981-97-0844-4\_4},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dmbd/DouWTPZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dmbd/LiuDW23,
author = {Huimin Liu and
Quansheng Dou and
Huixian Wang},
editor = {Ying Tan and
Yuhui Shi},
title = {{AL-SQUARES:} {SQL} Synthesis System with the Addition of Reducer},
booktitle = {Data Mining and Big Data - 8th International Conference, {DMBD} 2023,
Sanya, China, December 9-12, 2023, Proceedings, Part {II}},
series = {Communications in Computer and Information Science},
volume = {2018},
pages = {33--44},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-0844-4\_3},
doi = {10.1007/978-981-97-0844-4\_3},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dmbd/LiuDW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/GusainL23,
author = {Vaibhav Gusain and
Douglas J. Leith},
editor = {Jaap Kamps and
Lorraine Goeuriot and
Fabio Crestani and
Maria Maistro and
Hideo Joho and
Brian Davis and
Cathal Gurrin and
Udo Kruschwitz and
Annalina Caputo},
title = {Towards Quantifying the Privacy of Redacted Text},
booktitle = {Advances in Information Retrieval - 45th European Conference on Information
Retrieval, {ECIR} 2023, Dublin, Ireland, April 2-6, 2023, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {13981},
pages = {423--429},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-28238-6\_32},
doi = {10.1007/978-3-031-28238-6\_32},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecir/GusainL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/GaziSNCNLBHIR23,
author = {Asim Hossain Gazi and
Jesus Antonio Sanchez{-}Perez and
Shlok Natarajan and
Michael Chan and
Mohammad Nikbakht and
David Jimmy Lin and
J. Douglas Bremner and
Jin{-}Oh Hahn and
Omer T. Inan and
Christopher J. Rozell},
title = {Leveraging Physiological Markers to Quantify the Transient Effects
of Traumatic Stress and Non-Invasive Neuromodulation},
booktitle = {45th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2023, Sydney, Australia,
July 24-27, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/EMBC40787.2023.10340053},
doi = {10.1109/EMBC40787.2023.10340053},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/GaziSNCNLBHIR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esorics/TiepeltES23,
author = {Marcel Tiepelt and
Edward Eaton and
Douglas Stebila},
editor = {Gene Tsudik and
Mauro Conti and
Kaitai Liang and
Georgios Smaragdakis},
title = {Making an Asymmetric {PAKE} Quantum-Annoying by Hiding Group Elements},
booktitle = {Computer Security - {ESORICS} 2023 - 28th European Symposium on Research
in Computer Security, The Hague, The Netherlands, September 25-29,
2023, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14344},
pages = {168--188},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-50594-2\_9},
doi = {10.1007/978-3-031-50594-2\_9},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esorics/TiepeltES23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eval4nlp/DoughmanSQNK23,
author = {Jad Doughman and
Shady Shehata and
Leen Al Qadi and
Youssef Nafea and
Fakhri Karray},
editor = {Daniel Deutsch and
Rotem Dror and
Steffen Eger and
Yang Gao and
Christoph Leiter and
Juri Opitz and
Andreas R{\"{u}}ckl{\'{e}}},
title = {Can a Prediction's Rank Offer a More Accurate Quantification of Bias?
{A} Case Study Measuring Sexism in Debiased Language Models},
booktitle = {Proceedings of the 4th Workshop on Evaluation and Comparison of {NLP}
Systems, Eval4NLP 2023, Bali, Indonesia, November 1, 2023},
pages = {108--116},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.eval4nlp-1.9},
doi = {10.18653/V1/2023.EVAL4NLP-1.9},
timestamp = {Thu, 20 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eval4nlp/DoughmanSQNK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/XuSZP23,
author = {Lifan Xu and
Shunqiao Sun and
Yimin D. Zhang and
Athina P. Petropulu},
title = {Joint Antenna Selection and Beamforming in Integrated Automotive Radar
Sensing-Communications with Quantized Double Phase Shifters},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing
{ICASSP} 2023, Rhodes Island, Greece, June 4-10, 2023},
pages = {1--5},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICASSP49357.2023.10097184},
doi = {10.1109/ICASSP49357.2023.10097184},
timestamp = {Sun, 05 Nov 2023 16:51:21 +0100},
biburl = {https://dblp.org/rec/conf/icassp/XuSZP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccais/ThiTKNBN23,
author = {Hien Nguyen Thi and
Mai Hoang Thi and
Hoa Bui Thi Khanh and
Danh Huy Nguyen and
Dang Quang Bui and
Tung Lam Nguyen},
title = {Flatness-based control structure for double-pendulum type bridge cranes},
booktitle = {12th International Conference on Control, Automation and Information
Sciences, {ICCAIS} 2023, Hanoi, Vietnam, November 27-29, 2023},
pages = {483--488},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCAIS59597.2023.10382393},
doi = {10.1109/ICCAIS59597.2023.10382393},
timestamp = {Fri, 09 Feb 2024 20:38:50 +0100},
biburl = {https://dblp.org/rec/conf/iccais/ThiTKNBN23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccais/VanQH23,
author = {Co Nhu Van and
Nguyen Phung Quang and
Nguyen Thanh Hai},
title = {The modelling of the doubly fed induction machine as a wind power
generator with consideration of the chaotic phenomenon},
booktitle = {12th International Conference on Control, Automation and Information
Sciences, {ICCAIS} 2023, Hanoi, Vietnam, November 27-29, 2023},
pages = {495--500},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCAIS59597.2023.10382392},
doi = {10.1109/ICCAIS59597.2023.10382392},
timestamp = {Fri, 09 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccais/VanQH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccms/ZhouZT23,
author = {Pengfei Zhou and
Quanhao Zhang and
Guolei Tang},
title = {A Double-Agent Neighbor-State Q-learning Algorithm for Dynamic Scheduling
Twin-ASCs in ACTs},
booktitle = {Proceedings of the 15th International Conference on Computer Modeling
and Simulation, {ICCMS} 2023, Dalian, China, June 16-18, 2023},
pages = {1--7},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3608251.3608274},
doi = {10.1145/3608251.3608274},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccms/ZhouZT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/ZhaoWZQYYJ23,
author = {Dong Zhao and
Shuang Wang and
Qi Zang and
Dou Quan and
Xiutiao Ye and
Rui Yang and
Licheng Jiao},
title = {Learning Pseudo-Relations for Cross-domain Semantic Segmentation},
booktitle = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023,
Paris, France, October 1-6, 2023},
pages = {19134--19146},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCV51070.2023.01758},
doi = {10.1109/ICCV51070.2023.01758},
timestamp = {Tue, 12 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/ZhaoWZQYYJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccvit/ChenDZLL23,
author = {Kai Chen and
Mowei Dou and
Hong Zhang and
Zaijun Li and
Tao Li},
title = {Artificial intelligence based algorithm for automatic diagnosis and
quantification of acute spontaneous intracranial hemorrhage},
booktitle = {Proceedings of the 2023 International Conference on Computer, Vision
and Intelligent Technology, {ICCVIT} 2023, Chenzhou, China, August
25-28, 2023},
pages = {16:1--16:8},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3627341.3630382},
doi = {10.1145/3627341.3630382},
timestamp = {Sun, 31 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccvit/ChenDZLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmre/ZhangD23,
author = {Shun Zhang and
Quansheng Dou},
editor = {Yongsheng Ma},
title = {DeepQRE: {A} {QRE} System Based on Deep Learning},
booktitle = {9th International Conference on Mechatronics and Robotics Engineering,
{ICMRE} 2023, Shenzhen, China, February 10-12, 2023},
pages = {240--244},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICMRE56789.2023.10106580},
doi = {10.1109/ICMRE56789.2023.10106580},
timestamp = {Sat, 13 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmre/ZhangD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/ZhangCY23,
author = {Wenyu Zhang and
Mengyao Cao and
Quan Yuan},
editor = {Liang Zhao and
Guanglu Sun and
Kenli Li and
Zheng Xiao and
Lipo Wang},
title = {Large Group Integrated Decision-Making Method Based on Double Hierarchy
Interval Hesitant Fuzzy Language},
booktitle = {19th International Conference on Natural Computation, Fuzzy Systems
and Knowledge Discovery {ICNC-FSKD} 2023, Harbin, China, July 29-31,
2023},
pages = {1--5},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICNC-FSKD59587.2023.10281015},
doi = {10.1109/ICNC-FSKD59587.2023.10281015},
timestamp = {Tue, 20 Aug 2024 07:54:45 +0200},
biburl = {https://dblp.org/rec/conf/icnc/ZhangCY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icspcc/ChaiTJG23,
author = {Xiuli Chai and
Yong Tan and
Wenbin Jiang and
Zhihua Gan},
title = {Detecting Aligned Double {JPEG} Compression with the Same Quantization
Matrix Based on Hamming Distance and Image Stability},
booktitle = {{IEEE} International Conference on Signal Processing, Communications
and Computing, {ICSPCC} 2023, Zhengzhou, China, November 14-17, 2023},
pages = {1--5},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICSPCC59353.2023.10400327},
doi = {10.1109/ICSPCC59353.2023.10400327},
timestamp = {Sat, 24 Feb 2024 20:42:50 +0100},
biburl = {https://dblp.org/rec/conf/icspcc/ChaiTJG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icta3/FengCP23,
author = {Shuo Feng and
Fuzhan Chen and
Quan Pan},
title = {A Power-Efficient {\textdollar}{\textbackslash}boldsymbol\{4\}-{\textbackslash}mathbf\{V\}{\_}\{{\textbackslash}mathbf\{ppd\}\}{\textdollar}
128-Gb/s {PAM-4} Optical Modulator Driver with Merged {BV} Doubler
Topology in 130-nm BiCMOS},
booktitle = {{IEEE} International Conference on Integrated Circuits, Technologies
and Applications, {ICTA} 2023, Hefei, China, October 27-29, 2023},
pages = {190--191},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICTA60488.2023.10364283},
doi = {10.1109/ICTA60488.2023.10364283},
timestamp = {Wed, 17 Jan 2024 17:11:29 +0100},
biburl = {https://dblp.org/rec/conf/icta3/FengCP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/CaoQLGWHJ23,
author = {Xianwei Cao and
Dou Quan and
Chonghua Lv and
Yanhe Guo and
Shuang Wang and
Biao Hou and
Licheng Jiao},
title = {Relational Image Patch Matching for Remote Sensing},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {6061--6064},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10282337},
doi = {10.1109/IGARSS52108.2023.10282337},
timestamp = {Tue, 07 Nov 2023 16:21:25 +0100},
biburl = {https://dblp.org/rec/conf/igarss/CaoQLGWHJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LiaoYXXQWH23,
author = {Yu Liao and
Rui Yang and
Tao Xie and
Hantong Xing and
Dou Quan and
Shuang Wang and
Biao Hou},
title = {A Fast and Accurate Method for Remote Sensing Image-Text Retrieval
Based On Large Model Knowledge Distillation},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {5077--5080},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10281578},
doi = {10.1109/IGARSS52108.2023.10281578},
timestamp = {Tue, 07 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/LiaoYXXQWH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/WangQLGWGJ23,
author = {Zhe Wang and
Dou Quan and
Chonghua Lv and
Yanhe Guo and
Shuang Wang and
Yu Gu and
Licheng Jiao},
title = {Domain Distribution Alignment for Boosting Multi-Modal Remote Sensing
Image Matching},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {6065--6068},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10282123},
doi = {10.1109/IGARSS52108.2023.10282123},
timestamp = {Tue, 07 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/WangQLGWGJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhouQLGWGJ23,
author = {Rufan Zhou and
Dou Quan and
Chonghua Lv and
Yanhe Guo and
Shuang Wang and
Yu Gu and
Licheng Jiao},
title = {Deep Continuous Matching Network for more Robust Multi-Modal Remote
Sensing Image Patch Matching},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {6057--6060},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10282010},
doi = {10.1109/IGARSS52108.2023.10282010},
timestamp = {Tue, 07 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/ZhouQLGWGJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/ZhangDTPW23,
author = {Shun Zhang and
Quansheng Dou and
Huanling Tang and
Hao Pan and
Huixian Wang},
title = {{SQL} Synthesis with Input-Output Example Based on Deep Learning},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2023, Gold
Coast, Australia, June 18-23, 2023},
pages = {1--8},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IJCNN54540.2023.10191168},
doi = {10.1109/IJCNN54540.2023.10191168},
timestamp = {Wed, 09 Aug 2023 16:25:09 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/ZhangDTPW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipmi/GongCGCMMAD23,
author = {Shizhan Gong and
Cheng Chen and
Yuqi Gong and
Nga Yan Chan and
Wenao Ma and
Calvin Hoi{-}Kwan Mak and
Jill M. Abrigo and
Qi Dou},
editor = {Alejandro F. Frangi and
Marleen de Bruijne and
Demian Wassermann and
Nassir Navab},
title = {Diffusion Model Based Semi-supervised Learning on Brain Hemorrhage
Images for Efficient Midline Shift Quantification},
booktitle = {Information Processing in Medical Imaging - 28th International Conference,
{IPMI} 2023, San Carlos de Bariloche, Argentina, June 18-23, 2023,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13939},
pages = {69--81},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-34048-2\_6},
doi = {10.1007/978-3-031-34048-2\_6},
timestamp = {Sat, 21 Oct 2023 10:46:26 +0200},
biburl = {https://dblp.org/rec/conf/ipmi/GongCGCMMAD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pqcrypto/GoertzenS23,
author = {Jason Goertzen and
Douglas Stebila},
editor = {Thomas Johansson and
Daniel Smith{-}Tone},
title = {Post-Quantum Signatures in {DNSSEC} via Request-Based Fragmentation},
booktitle = {Post-Quantum Cryptography - 14th International Workshop, PQCrypto
2023, College Park, MD, USA, August 16-18, 2023, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {14154},
pages = {535--564},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-40003-2\_20},
doi = {10.1007/978-3-031-40003-2\_20},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pqcrypto/GoertzenS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qce/IvoryBBBDHKKLMPS23,
author = {Megan Ivory and
Alisa Bettale and
Rachel Boren and
Ashlyn D. Burch and
Jake Douglass and
Lisa Hackett and
Boris Kiefer and
Alina Kononov and
Maryanne Long and
Mekena Metcalf and
Tzula B. Propp and
Mohan Sarovar},
editor = {Brian La Cour and
Lia Yeh and
Marek Osinski},
title = {Quantum Computing, Math, and Physics (QCaMP): Introducing Quantum
Computing in High Schools},
booktitle = {{IEEE} International Conference on Quantum Computing and Engineering,
{QCE} 2023, Bellevue, WA, USA, September 17-22, 2023},
pages = {1--9},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/QCE57702.2023.20318},
doi = {10.1109/QCE57702.2023.20318},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qce/IvoryBBBDHKKLMPS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/GiamphySDGHSD23,
author = {Edward Giamphy and
K{\'{e}}vin Sanchis and
Gohar Dashyan and
Jean{-}Loup Guillaume and
Ahmed Hamdi and
Lilian Sanselme and
Antoine Doucet},
title = {A Quantitative Analysis of Noise Impact on Document Ranking},
booktitle = {{IEEE} International Conference on Systems, Man, and Cybernetics,
{SMC} 2023, Honolulu, Oahu, HI, USA, October 1-4, 2023},
pages = {4612--4618},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SMC53992.2023.10394665},
doi = {10.1109/SMC53992.2023.10394665},
timestamp = {Tue, 13 Feb 2024 09:22:04 +0100},
biburl = {https://dblp.org/rec/conf/smc/GiamphySDGHSD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stacom-ws/DouYCWFM23,
author = {Quan Dou and
Kang Yan and
Sheng Chen and
Zhixing Wang and
Xue Feng and
Craig H. Meyer},
editor = {Oscar Camara and
Esther Puyol{-}Ant{\'{o}}n and
Maxime Sermesant and
Avan Suinesiaputra and
Qian Tao and
Chengyan Wang and
Alistair A. Young},
title = {C\({}^{\mbox{3}}\)-Net: Complex-Valued Cascading Cross-Domain Convolutional
Neural Network for Reconstructing Undersampled {CMR} Images},
booktitle = {Statistical Atlases and Computational Models of the Heart. Regular
and CMRxRecon Challenge Papers - 14th International Workshop, {STACOM}
2023, Held in Conjunction with {MICCAI} 2023, Vancouver, BC, Canada,
October 12, 2023, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {14507},
pages = {390--399},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-52448-6\_37},
doi = {10.1007/978-3-031-52448-6\_37},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/stacom-ws/DouYCWFM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wisa/LarasatiK23,
author = {Harashta Tatimma Larasati and
Howon Kim},
editor = {Howon Kim and
Jonghee M. Youn},
title = {Quantum Circuit Designs of Point Doubling Operation for Binary Elliptic
Curves},
booktitle = {Information Security Applications - 24th International Conference,
{WISA} 2023, Jeju Island, South Korea, August 23-25, 2023, Revised
Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {14402},
pages = {297--309},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-99-8024-6\_23},
doi = {10.1007/978-981-99-8024-6\_23},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wisa/LarasatiK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/WuWJDDY23,
author = {Shiguang Wu and
Yaqing Wang and
Qinghe Jing and
Daxiang Dong and
Dejing Dou and
Quanming Yao},
editor = {Ying Ding and
Jie Tang and
Juan F. Sequeda and
Lora Aroyo and
Carlos Castillo and
Geert{-}Jan Houben},
title = {ColdNAS: Search to Modulate for User Cold-Start Recommendation},
booktitle = {Proceedings of the {ACM} Web Conference 2023, {WWW} 2023, Austin,
TX, USA, 30 April 2023 - 4 May 2023},
pages = {1021--1031},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3543507.3583344},
doi = {10.1145/3543507.3583344},
timestamp = {Mon, 22 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/www/WuWJDDY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-00409,
author = {Shizhan Gong and
Cheng Chen and
Yuqi Gong and
Nga Yan Chan and
Wenao Ma and
Calvin Hoi{-}Kwan Mak and
Jill M. Abrigo and
Qi Dou},
title = {Diffusion Model based Semi-supervised Learning on Brain Hemorrhage
Images for Efficient Midline Shift Quantification},
journal = {CoRR},
volume = {abs/2301.00409},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.00409},
doi = {10.48550/ARXIV.2301.00409},
eprinttype = {arXiv},
eprint = {2301.00409},
timestamp = {Fri, 16 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-00409.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-03251,
author = {Huanyu Bian and
Zhilong Jia and
Menghan Dou and
Yuan Fang and
Lei Li and
Yiming Zhao and
Hanchao Wang and
Zhaohui Zhou and
Wei Wang and
Wenyu Zhu and
Ye Li and
Yang Yang and
Weiming Zhang and
Nenghai Yu and
Zhaoyun Chen and
Guoping Guo},
title = {VQNet 2.0: {A} New Generation Machine Learning Framework that Unifies
Classical and Quantum},
journal = {CoRR},
volume = {abs/2301.03251},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.03251},
doi = {10.48550/ARXIV.2301.03251},
eprinttype = {arXiv},
eprint = {2301.03251},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-03251.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-03606,
author = {Hristos Tyralis and
Georgia Papacharalampous and
Nikolaos D. Doulamis and
Anastasios D. Doulamis},
title = {Merging satellite and gauge-measured precipitation using LightGBM
with an emphasis on extreme quantiles},
journal = {CoRR},
volume = {abs/2302.03606},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.03606},
doi = {10.48550/ARXIV.2302.03606},
eprinttype = {arXiv},
eprint = {2302.03606},
timestamp = {Fri, 31 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-03606.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-09397,
author = {Navid Gholizadeh and
Joseph M. Hood and
Roger A. Dougal},
title = {Evaluation of Linear Implicit Quantized State System method for analyzing
mission performance of power systems},
journal = {CoRR},
volume = {abs/2302.09397},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.09397},
doi = {10.48550/ARXIV.2302.09397},
eprinttype = {arXiv},
eprint = {2302.09397},
timestamp = {Thu, 23 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-09397.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-13437,
author = {Navid Gholizadeh and
Joseph M. Hood and
Roger A. Dougal},
title = {Suitability of Quantized {DEVS} {LIM} Methods for Simulation of Power
Systems},
journal = {CoRR},
volume = {abs/2302.13437},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.13437},
doi = {10.48550/ARXIV.2302.13437},
eprinttype = {arXiv},
eprint = {2302.13437},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-13437.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-03387,
author = {Shiguang Wu and
Yaqing Wang and
Qinghe Jing and
Daxiang Dong and
Dejing Dou and
Quanming Yao},
title = {ColdNAS: Search to Modulate for User Cold-Start Recommendation},
journal = {CoRR},
volume = {abs/2306.03387},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.03387},
doi = {10.48550/ARXIV.2306.03387},
eprinttype = {arXiv},
eprint = {2306.03387},
timestamp = {Mon, 22 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-03387.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-07530,
author = {Harashta Tatimma Larasati and
Howon Kim},
title = {Quantum Circuit Designs of Point Doubling for Binary Elliptic Curves},
journal = {CoRR},
volume = {abs/2306.07530},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.07530},
doi = {10.48550/ARXIV.2306.07530},
eprinttype = {arXiv},
eprint = {2306.07530},
timestamp = {Mon, 19 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-07530.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-01752,
author = {Nir Douer and
Joachim Meyer},
title = {Quantifying Retrospective Human Responsibility in Intelligent Systems},
journal = {CoRR},
volume = {abs/2308.01752},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.01752},
doi = {10.48550/ARXIV.2308.01752},
eprinttype = {arXiv},
eprint = {2308.01752},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-01752.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-15696,
author = {Charles London and
Douglas Brown and
Wenduan Xu and
Sezen Vatansever and
Christopher James Langmead and
Dimitri Kartsaklis and
Stephen Clark and
Konstantinos Meichanetzidis},
title = {Peptide Binding Classification on Quantum Computers},
journal = {CoRR},
volume = {abs/2311.15696},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.15696},
doi = {10.48550/ARXIV.2311.15696},
eprinttype = {arXiv},
eprint = {2311.15696},
timestamp = {Wed, 29 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-15696.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-01777,
author = {Italo Atzeni and
Antti T{\"{o}}lli and
Duy H. N. Nguyen and
A. Lee Swindlehurst},
title = {Doubly 1-Bit Quantized Massive {MIMO}},
journal = {CoRR},
volume = {abs/2312.01777},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.01777},
doi = {10.48550/ARXIV.2312.01777},
eprinttype = {arXiv},
eprint = {2312.01777},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-01777.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-15186,
author = {Juncheng Jia and
Ji Liu and
Chendi Zhou and
Hao Tian and
Mianxiong Dong and
Dejing Dou},
title = {Efficient Asynchronous Federated Learning with Sparsification and
Quantization},
journal = {CoRR},
volume = {abs/2312.15186},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.15186},
doi = {10.48550/ARXIV.2312.15186},
eprinttype = {arXiv},
eprint = {2312.15186},
timestamp = {Tue, 09 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-15186.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/Larasati023,
author = {Harashta Tatimma Larasati and
Howon Kim},
title = {Quantum Circuit Designs of Point Doubling Operation for Binary Elliptic
Curves},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1140},
year = {2023},
url = {https://eprint.iacr.org/2023/1140},
timestamp = {Fri, 04 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/Larasati023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/TiepeltES23,
author = {Marcel Tiepelt and
Edward Eaton and
Douglas Stebila},
title = {Making an Asymmetric {PAKE} Quantum-Annoying by Hiding Group Elements},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1513},
year = {2023},
url = {https://eprint.iacr.org/2023/1513},
timestamp = {Thu, 09 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iacr/TiepeltES23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/RassekhSSJ22,
author = {Amin Rassekh and
Majid Shalchian and
Jean{-}Michel Sallese and
Farzan Jazaeri},
title = {Tunneling Current Through a Double Quantum Dots System},
journal = {{IEEE} Access},
volume = {10},
pages = {75245--75256},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3190617},
doi = {10.1109/ACCESS.2022.3190617},
timestamp = {Mon, 08 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/RassekhSSJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ZhangW22,
author = {Quan{-}Quan Zhang and
Rong{-}Jong Wai},
title = {Design of Adaptive Distributed Secondary Control Using Double-Hidden-Layer
Recurrent-Neural-Network-Inherited Total-Sliding-Mode Scheme for Islanded
Micro-Grid},
journal = {{IEEE} Access},
volume = {10},
pages = {5990--6009},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3140360},
doi = {10.1109/ACCESS.2022.3140360},
timestamp = {Tue, 08 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/ZhangW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aei/YouDDJWZ22,
author = {Ke You and
Lieyun Ding and
Quanli Dou and
Yutian Jiang and
Zhangang Wu and
Cheng Zhou},
title = {An imitation from observation approach for dozing distance learning
in autonomous bulldozer operation},
journal = {Adv. Eng. Informatics},
volume = {54},
pages = {101735},
year = {2022},
url = {https://doi.org/10.1016/j.aei.2022.101735},
doi = {10.1016/J.AEI.2022.101735},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aei/YouDDJWZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/XiongLCCCRF22,
author = {Lin Xiong and
David Lagomasino and
Sean P. Charles and
Edward Casta{\~{n}}eda{-}Moya and
Bruce D. Cook and
Jed Redwine and
Lola Fatoyinbo},
title = {Quantifying mangrove canopy regrowth and recovery after Hurricane
Irma with large-scale repeat airborne lidar in the Florida Everglades},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {114},
pages = {103031},
year = {2022},
url = {https://doi.org/10.1016/j.jag.2022.103031},
doi = {10.1016/J.JAG.2022.103031},
timestamp = {Wed, 30 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aeog/XiongLCCCRF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aisy/BrionP22,
author = {Douglas A. J. Brion and
Sebastian W. Pattinson},
title = {Quantitative and Real-Time Control of 3D Printing Material Flow Through
Deep Learning},
journal = {Adv. Intell. Syst.},
volume = {4},
number = {11},
year = {2022},
url = {https://doi.org/10.1002/aisy.202200153},
doi = {10.1002/AISY.202200153},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aisy/BrionP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/LiuLG22,
author = {Zhe Liu and
Shurong Li and
Yulei Ge},
title = {A parallel algorithm based on quantum annealing and double-elite spiral
search for mixed-integer optimal control problems in engineering},
journal = {Appl. Soft Comput.},
volume = {124},
pages = {109018},
year = {2022},
url = {https://doi.org/10.1016/j.asoc.2022.109018},
doi = {10.1016/J.ASOC.2022.109018},
timestamp = {Thu, 06 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asc/LiuLG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/ZhangCSDXCZ22,
author = {Zilong Zhang and
Feifei Cui and
Wei Su and
Lijun Dou and
Anqi Xu and
Chen Cao and
Quan Zou},
title = {webSCST: an interactive web application for single-cell RNA-sequencing
data and spatial transcriptomic data integration},
journal = {Bioinform.},
volume = {38},
number = {13},
pages = {3488--3489},
year = {2022},
url = {https://doi.org/10.1093/bioinformatics/btac350},
doi = {10.1093/BIOINFORMATICS/BTAC350},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/ZhangCSDXCZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcmi/ZorigtNKJT22,
author = {Odgerel Zorigt and
Takahito Nakajima and
Yuka Kumasaka and
Akiko Jingu and
Yoshito Tsushima},
title = {Synthetic double inversion recovery imaging in brain {MRI:} quantitative
evaluation and feasibility of synthetic {MRI} and a comparison with
conventional double inversion recovery and fluid-attenuated inversion
recovery sequences},
journal = {{BMC} Medical Imaging},
volume = {22},
number = {1},
pages = {183},
year = {2022},
url = {https://doi.org/10.1186/s12880-022-00877-4},
doi = {10.1186/S12880-022-00877-4},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcmi/ZorigtNKJT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cea/WangFQLDHLX22,
author = {Shuo Wang and
Wei Feng and
Yinghui Quan and
Qiang Li and
Gabriel Dauphin and
Wenjiang Huang and
Jing Li and
Mengdao Xing},
title = {A heterogeneous double ensemble algorithm for soybean planting area
extraction in Google Earth Engine},
journal = {Comput. Electron. Agric.},
volume = {197},
pages = {106955},
year = {2022},
url = {https://doi.org/10.1016/j.compag.2022.106955},
doi = {10.1016/J.COMPAG.2022.106955},
timestamp = {Wed, 08 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cea/WangFQLDHLX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/LiuLCZ22,
author = {Heng{-}Li Liu and
Quan{-}Lin Li and
Yan{-}Xia Chang and
Chi Zhang},
title = {Double-ended queues with non-Poisson inputs and their effective algorithms},
journal = {Comput. Oper. Res.},
volume = {144},
pages = {105793},
year = {2022},
url = {https://doi.org/10.1016/j.cor.2022.105793},
doi = {10.1016/J.COR.2022.105793},
timestamp = {Mon, 13 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cor/LiuLCZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/JiangZY22,
author = {Jiefang Jiang and
Xianyong Zhang and
Jilin Yang},
title = {Double-quantitative feature selection using bidirectional three-level
dependency measurements in divergence-based fuzzy rough sets},
journal = {Eng. Appl. Artif. Intell.},
volume = {115},
pages = {105226},
year = {2022},
url = {https://doi.org/10.1016/j.engappai.2022.105226},
doi = {10.1016/J.ENGAPPAI.2022.105226},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eaai/JiangZY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/Plotnitsky22a,
author = {Arkady Plotnitsky},
title = {"Yet Once More": The Double-Slit Experiment and Quantum Discontinuity},
journal = {Entropy},
volume = {24},
number = {10},
pages = {1455},
year = {2022},
url = {https://doi.org/10.3390/e24101455},
doi = {10.3390/E24101455},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/entropy/Plotnitsky22a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/YuHXSM22,
author = {Wenxin Yu and
Lenian He and
Jianxiong Xi and
Quan Sun and
Changyou Men},
title = {A 2.2ppm/{\textdegree}C compensated bandgap voltage reference with
a double-ended current trimming technique},
journal = {{IEICE} Electron. Express},
volume = {19},
number = {21},
pages = {20220390},
year = {2022},
url = {https://doi.org/10.1587/elex.19.20220390},
doi = {10.1587/ELEX.19.20220390},
timestamp = {Wed, 15 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/YuHXSM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijns/WuWM22,
author = {Binyi Wu and
Bernd Waschneck and
Christian Georg Mayr},
title = {Convolutional Neural Networks Quantization with Double-Stage Squeeze-and-Threshold},
journal = {Int. J. Neural Syst.},
volume = {32},
number = {12},
pages = {2250051:1--2250051:13},
year = {2022},
url = {https://doi.org/10.1142/S0129065722500514},
doi = {10.1142/S0129065722500514},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijns/WuWM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsysc/ZhuLY22,
author = {Quanmin Zhu and
Ruobing Li and
Xinggang Yan},
title = {U-model-based double sliding mode control (U\({}_{\mbox{DSM}}\)-control)
of nonlinear dynamic systems},
journal = {Int. J. Syst. Sci.},
volume = {53},
number = {6},
pages = {1153--1169},
year = {2022},
url = {https://doi.org/10.1080/00207721.2021.1991503},
doi = {10.1080/00207721.2021.1991503},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsysc/ZhuLY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcst/GaoTCLYGWWHQZDC22,
author = {Yixiao Gao and
Chen Tian and
Wei Chen and
Duo{-}Xing Li and
Jian Yan and
Yuan{-}Yuan Gong and
Bing{-}Quan Wang and
Tao Wu and
Lei Han and
Fa{-}Zhi Qi and
Shan Zeng and
Wan{-}Chun Dou and
Gui{-}Hai Chen},
title = {Analyzing and Optimizing Packet Corruption in {RDMA} Network},
journal = {J. Comput. Sci. Technol.},
volume = {37},
number = {4},
pages = {743--762},
year = {2022},
url = {https://doi.org/10.1007/s11390-022-2123-8},
doi = {10.1007/S11390-022-2123-8},
timestamp = {Wed, 06 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcst/GaoTCLYGWWHQZDC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/LinWXD22,
author = {Jinxing Lin and
Xiang Wu and
Min Xiao and
Jie Ding},
title = {Stabilization of networked singular control systems under double-channel
quantization and DoS attacks},
journal = {J. Frankl. Inst.},
volume = {359},
number = {8},
pages = {3517--3548},
year = {2022},
url = {https://doi.org/10.1016/j.jfranklin.2022.03.016},
doi = {10.1016/J.JFRANKLIN.2022.03.016},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfi/LinWXD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/LuoWZ22,
author = {Mei Luo and
JinRong Wang and
Quanxin Zhu},
title = {Resilient control of double-integrator stochastic multi-agent systems
under denial-of-service attacks},
journal = {J. Frankl. Inst.},
volume = {359},
number = {16},
pages = {8431--8453},
year = {2022},
url = {https://doi.org/10.1016/j.jfranklin.2022.09.009},
doi = {10.1016/J.JFRANKLIN.2022.09.009},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfi/LuoWZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/LiZDH22,
author = {Rao Li and
Cheng Zhou and
Quanli Dou and
Bin Hu},
title = {Cover Image, Volume 39, Number 7, October 2022},
journal = {J. Field Robotics},
volume = {39},
number = {7},
pages = {i},
year = {2022},
url = {https://doi.org/10.1002/rob.22115},
doi = {10.1002/ROB.22115},
timestamp = {Fri, 09 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/LiZDH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/LiZDH22a,
author = {Rao Li and
Cheng Zhou and
Quanli Dou and
Bin Hu},
title = {Complete coverage path planning and performance factor analysis for
autonomous bulldozer},
journal = {J. Field Robotics},
volume = {39},
number = {7},
pages = {1014--1034},
year = {2022},
url = {https://doi.org/10.1002/rob.22085},
doi = {10.1002/ROB.22085},
timestamp = {Fri, 09 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/LiZDH22a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jql/Hirota22,
author = {Harunobu Hirota},
title = {The Indicative/subjunctive Mood Alternation with Adverbs of Doubt
in Spanish},
journal = {J. Quant. Linguistics},
volume = {29},
number = {4},
pages = {450--464},
year = {2022},
url = {https://doi.org/10.1080/09296174.2021.1919376},
doi = {10.1080/09296174.2021.1919376},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jql/Hirota22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvcir/BattiatoGGP22,
author = {Sebastiano Battiato and
Oliver Giudice and
Francesco Guarnera and
Giovanni Puglisi},
title = {CNN-based first quantization estimation of double compressed {JPEG}
images},
journal = {J. Vis. Commun. Image Represent.},
volume = {89},
pages = {103635},
year = {2022},
url = {https://doi.org/10.1016/j.jvcir.2022.103635},
doi = {10.1016/J.JVCIR.2022.103635},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jvcir/BattiatoGGP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jzusc/Khajehnasir-Jahromi22,
author = {Hamideh Khajehnasir{-}Jahromi and
Pooya Torkzadeh and
Massoud Dousti},
title = {Introducing scalable 1-bit full adders for designing quantum-dot cellular
automata arithmetic circuits},
journal = {Frontiers Inf. Technol. Electron. Eng.},
volume = {23},
number = {8},
pages = {1264--1276},
year = {2022},
url = {https://doi.org/10.1631/FITEE.2100287},
doi = {10.1631/FITEE.2100287},
timestamp = {Sat, 10 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jzusc/Khajehnasir-Jahromi22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/ZhangG22,
author = {Xianyong Zhang and
Hongyuan Gou},
title = {Statistical-mean double-quantitative K-nearest neighbor classification
learning based on neighborhood distance measurement},
journal = {Knowl. Based Syst.},
volume = {250},
pages = {109018},
year = {2022},
url = {https://doi.org/10.1016/j.knosys.2022.109018},
doi = {10.1016/J.KNOSYS.2022.109018},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kbs/ZhangG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/PengF22,
author = {Disen Peng and
Quanyuan Feng},
title = {A 4H-SiC double trench {MOSFET} with split gate and integrated {MPS}
diode},
journal = {Microelectron. J.},
volume = {128},
pages = {105553},
year = {2022},
url = {https://doi.org/10.1016/j.mejo.2022.105553},
doi = {10.1016/J.MEJO.2022.105553},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/PengF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlc/ChenX22,
author = {Xiuwei Chen and
Weihua Xu},
title = {Double-quantitative multigranulation rough fuzzy set based on logical
operations in multi-source decision systems},
journal = {Int. J. Mach. Learn. Cybern.},
volume = {13},
number = {4},
pages = {1021--1048},
year = {2022},
url = {https://doi.org/10.1007/s13042-021-01433-2},
doi = {10.1007/S13042-021-01433-2},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mlc/ChenX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlc/LiZCX22,
author = {Mengmeng Li and
Chiping Zhang and
Minghao Chen and
Weihua Xu},
title = {Multigranulation double-quantitative decision-theoretic rough sets
based on logical operations},
journal = {Int. J. Mach. Learn. Cybern.},
volume = {13},
number = {6},
pages = {1661--1684},
year = {2022},
url = {https://doi.org/10.1007/s13042-021-01476-5},
doi = {10.1007/S13042-021-01476-5},
timestamp = {Fri, 29 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mlc/LiZCX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/MoodyADTKOKA22,
author = {Jason F. Moody and
Nakul Aggarwal and
Douglas C. Dean III and
Do P. M. Tromp and
Steve R. Kecskemeti and
Jonathan A. Oler and
Ned H. Kalin and
Andrew L. Alexander},
title = {Longitudinal assessment of early-life white matter development with
quantitative relaxometry in nonhuman primates},
journal = {NeuroImage},
volume = {251},
pages = {118989},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2022.118989},
doi = {10.1016/J.NEUROIMAGE.2022.118989},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/MoodyADTKOKA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/0001SJLVKLSLYFD22,
author = {Qi Dou and
Tiffany Y. So and
Meirui Jiang and
Quande Liu and
Varut Vardhanabhuti and
Georgios Kaissis and
Zeju Li and
Weixin Si and
Heather H. C. Lee and
Kevin Yu and
Zuxin Feng and
Li Dong and
Egon Burian and
Friederike Jungmann and
Rickmer Braren and
Marcus R. Makowski and
Bernhard Kainz and
Daniel Rueckert and
Ben Glocker and
Simon C. H. Yu and
Pheng{-}Ann Heng},
title = {Author Correction: Federated deep learning for detecting {COVID-19}
lung abnormalities in {CT:} a privacy-preserving multinational validation
study},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-022-00600-1},
doi = {10.1038/S41746-022-00600-1},
timestamp = {Mon, 01 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/0001SJLVKLSLYFD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/GueddanaL22,
author = {Amor Gueddana and
Vasudevan Lakshminarayanan},
title = {Double controlled quantum phase gate based on three atoms trapped
in separate optical cavities},
journal = {Quantum Inf. Process.},
volume = {21},
number = {6},
pages = {208},
year = {2022},
url = {https://doi.org/10.1007/s11128-022-03539-0},
doi = {10.1007/S11128-022-03539-0},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/GueddanaL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SunQSCX22,
author = {Hanrong Sun and
Zhiguo Qu and
Le Sun and
Xiubo Chen and
Gang Xu},
title = {High-efficiency quantum image steganography protocol based on double-layer
matrix coding},
journal = {Quantum Inf. Process.},
volume = {21},
number = {5},
pages = {165},
year = {2022},
url = {https://doi.org/10.1007/s11128-022-03513-w},
doi = {10.1007/S11128-022-03513-W},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/SunQSCX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/VerasSS22,
author = {Tiago Mendon{\c{c}}a Lucena de Veras and
Leon D. da Silva and
Adenilton J. da Silva},
title = {Double sparse quantum state preparation},
journal = {Quantum Inf. Process.},
volume = {21},
number = {6},
pages = {204},
year = {2022},
url = {https://doi.org/10.1007/s11128-022-03549-y},
doi = {10.1007/S11128-022-03549-Y},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/VerasSS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/YuanWZ22,
author = {Zhong{-}Hui Yuan and
Hong{-}Fu Wang and
Ai{-}Dong Zhu},
title = {Controllable photon blockade in double-cavity optomechanical system
with Kerr-type nonlinearity},
journal = {Quantum Inf. Process.},
volume = {21},
number = {1},
pages = {22},
year = {2022},
url = {https://doi.org/10.1007/s11128-021-03360-1},
doi = {10.1007/S11128-021-03360-1},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/YuanWZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ZhaoZCPZ22,
author = {Yabo Zhao and
Ruiqing Zhao and
Lanxin Chen and
Jingyu Pan and
Mei Zhang},
title = {Steady-state entanglement in a mechanically coupled double cavity
containing magnetic spheres},
journal = {Quantum Inf. Process.},
volume = {21},
number = {9},
pages = {307},
year = {2022},
url = {https://doi.org/10.1007/s11128-022-03653-z},
doi = {10.1007/S11128-022-03653-Z},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/ZhaoZCPZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/LiLGDDL22,
author = {Shengkun Li and
Xiaobing Li and
Jirui Gong and
Dongliang Dang and
Huashun Dou and
Xin Lyu},
title = {Quantitative Analysis of Natural and Anthropogenic Factors Influencing
Vegetation {NDVI} Changes in Temperate Drylands from a Spatial Stratified
Heterogeneity Perspective: {A} Case Study of Inner Mongolia Grasslands,
China},
journal = {Remote. Sens.},
volume = {14},
number = {14},
pages = {3320},
year = {2022},
url = {https://doi.org/10.3390/rs14143320},
doi = {10.3390/RS14143320},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/LiLGDDL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/QuanFDWHX22,
author = {Daying Quan and
Wei Feng and
Gabriel Dauphin and
Xiaofeng Wang and
Wenjiang Huang and
Mengdao Xing},
title = {A Novel Double Ensemble Algorithm for the Classification of Multi-Class
Imbalanced Hyperspectral Data},
journal = {Remote. Sens.},
volume = {14},
number = {15},
pages = {3765},
year = {2022},
url = {https://doi.org/10.3390/rs14153765},
doi = {10.3390/RS14153765},
timestamp = {Wed, 09 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/QuanFDWHX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/XingSQSWL22,
author = {Shiqi Xing and
Shaoqiu Song and
Sinong Quan and
Dou Sun and
Junpeng Wang and
Yongzhen Li},
title = {Near-Field 3D Sparse {SAR} Direct Imaging with Irregular Samples},
journal = {Remote. Sens.},
volume = {14},
number = {24},
pages = {6321},
year = {2022},
url = {https://doi.org/10.3390/rs14246321},
doi = {10.3390/RS14246321},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/XingSQSWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ZhuSZDZZ22,
author = {Fang Zhu and
Fuqi Si and
Haijin Zhou and
Ke Dou and
Minjie Zhao and
Quan Zhang},
title = {Sensitivity Analysis of Ozone Profiles Retrieved from {SCIAMACHY}
Limb Radiance Based on the Weighted Multiplicative Algebraic Reconstruction
Technique},
journal = {Remote. Sens.},
volume = {14},
number = {16},
pages = {3954},
year = {2022},
url = {https://doi.org/10.3390/rs14163954},
doi = {10.3390/RS14163954},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/ZhuSZDZZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/MasarraQBHPL22,
author = {Nour{-}Alhoda Masarra and
Jean{-}Christophe Quantin and
Marcos Batistella and
Roland El Hage and
Monica Francesca Pucci and
Jos{\'{e}}{-}Marie Lopez{-}Cuesta},
title = {Influence of Polymer Processing on the Double Electrical Percolation
Threshold in {PLA/PCL/GNP} Nanocomposites},
journal = {Sensors},
volume = {22},
number = {23},
pages = {9231},
year = {2022},
url = {https://doi.org/10.3390/s22239231},
doi = {10.3390/S22239231},
timestamp = {Fri, 10 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/MasarraQBHPL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/QuirosDALM22,
author = {Mariano Bernaldo de Quir{\'{o}}s and
E. H. Douma and
Inge van den Akker{-}Scheek and
Claudine J. C. Lamoth and
Natasha M. Maurits},
title = {Quantification of Movement in Stroke Patients under Free Living Conditions
Using Wearable Sensors: {A} Systematic Review},
journal = {Sensors},
volume = {22},
number = {3},
pages = {1050},
year = {2022},
url = {https://doi.org/10.3390/s22031050},
doi = {10.3390/S22031050},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/QuirosDALM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/WangWFCCCSY22,
author = {Senmiao Wang and
Quanying Wu and
Junliu Fan and
Baohua Chen and
Xiaoyi Chen and
Lei Chen and
Donghui Shen and
Lidong Yin},
title = {Piston Sensing for Golay-6 Sparse Aperture System with Double-Defocused
Sharpness Metrics via ResNet-34},
journal = {Sensors},
volume = {22},
number = {23},
pages = {9484},
year = {2022},
url = {https://doi.org/10.3390/s22239484},
doi = {10.3390/S22239484},
timestamp = {Tue, 24 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/WangWFCCCSY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/YangYZL22,
author = {Yuanyu Yang and
Dayi Yin and
Quan Zhang and
Zhiming Li},
title = {Construction of the Guide Star Catalog for Double Fine Guidance Sensors
Based on {SSBK} Clustering},
journal = {Sensors},
volume = {22},
number = {13},
pages = {4996},
year = {2022},
url = {https://doi.org/10.3390/s22134996},
doi = {10.3390/S22134996},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/YangYZL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/ChenGLLL22,
author = {Xinliang Chen and
Jiyu Gai and
Zhennan Liang and
Quanhua Liu and
Teng Long},
title = {Adaptive Double Threshold Detection Method for Range-Spread Targets},
journal = {{IEEE} Signal Process. Lett.},
volume = {29},
pages = {254--258},
year = {2022},
url = {https://doi.org/10.1109/lsp.2021.3129981},
doi = {10.1109/LSP.2021.3129981},
timestamp = {Mon, 06 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spl/ChenGLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/DouH22,
author = {Peng Dou and
Zhen Han},
title = {Quantifying Land Use/Land Cover Change and Urban Expansion in Dongguan,
China, From 1987 to 2020},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {15},
pages = {201--209},
year = {2022},
url = {https://doi.org/10.1109/JSTARS.2021.3133703},
doi = {10.1109/JSTARS.2021.3133703},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/DouH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/Cardoso-Isidoro22,
author = {Carlos Cardoso{-}Isidoro and
Francisco Delgado},
title = {Shared Quantum Key Distribution Based on Asymmetric Double Quantum
Teleportation},
journal = {Symmetry},
volume = {14},
number = {4},
pages = {713},
year = {2022},
url = {https://doi.org/10.3390/sym14040713},
doi = {10.3390/SYM14040713},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/Cardoso-Isidoro22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tase/KangXZTH22,
author = {Kai Kang and
Su Xiu Xu and
Ray Y. Zhong and
Bing Qing Tan and
George Q. Huang},
title = {Double Auction-Based Manufacturing Cloud Service Allocation in an
Industrial Park},
journal = {{IEEE} Trans Autom. Sci. Eng.},
volume = {19},
number = {1},
pages = {295--307},
year = {2022},
url = {https://doi.org/10.1109/TASE.2020.3029081},
doi = {10.1109/TASE.2020.3029081},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tase/KangXZTH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/NiuLZN22,
author = {Yakun Niu and
Xiaolong Li and
Yao Zhao and
Rongrong Ni},
title = {Detection of Double {JPEG} Compression With the Same Quantization
Matrix via Convergence Analysis},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {32},
number = {5},
pages = {3279--3290},
year = {2022},
url = {https://doi.org/10.1109/TCSVT.2021.3097351},
doi = {10.1109/TCSVT.2021.3097351},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcsv/NiuLZN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/WangWLZMSJ22,
author = {Hao Wang and
Jinwei Wang and
Xiangyang Luo and
Yuhui Zheng and
Bin Ma and
Jinsheng Sun and
Sunil Kr. Jha},
title = {Detecting Aligned Double {JPEG} Compressed Color Image With Same Quantization
Matrix Based on the Stability of Image},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {32},
number = {6},
pages = {4065--4080},
year = {2022},
url = {https://doi.org/10.1109/TCSVT.2021.3111195},
doi = {10.1109/TCSVT.2021.3111195},
timestamp = {Mon, 13 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcsv/WangWLZMSJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/te/HughesFGMVL22,
author = {Ciaran Hughes and
Doug Finke and
Dan{-}Adrian German and
Celia Merzbacher and
Patrick M. Vora and
H. J. Lewandowski},
title = {Assessing the Needs of the Quantum Industry},
journal = {{IEEE} Trans. Educ.},
volume = {65},
number = {4},
pages = {592--601},
year = {2022},
url = {https://doi.org/10.1109/TE.2022.3153841},
doi = {10.1109/TE.2022.3153841},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/te/HughesFGMVL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/HeJSWLQYZ22,
author = {Pei He and
Licheng Jiao and
Ronghua Shang and
Shuang Wang and
Xu Liu and
Dou Quan and
Kun Yang and
Dong Zhao},
title = {MANet: Multi-Scale Aware-Relation Network for Semantic Segmentation
in Aerial Scenes},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--15},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2022.3179379},
doi = {10.1109/TGRS.2022.3179379},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/HeJSWLQYZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/HuyanZQCJ22,
author = {Ning Huyan and
Xiangrong Zhang and
Dou Quan and
Jocelyn Chanussot and
Licheng Jiao},
title = {Cluster-Memory Augmented Deep Autoencoder via Optimal Transportation
for Hyperspectral Anomaly Detection},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--16},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2022.3180548},
doi = {10.1109/TGRS.2022.3180548},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/HuyanZQCJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/LinZZY22,
author = {Tingting Lin and
Kun Zhou and
Hanqing Zhao and
Yujing Yang},
title = {Surface Magnetic-Field Enhancement Technology With a Double-Polarization
Coil for Urban Hydrology Quantitative Survey},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--11},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2021.3139303},
doi = {10.1109/TGRS.2021.3139303},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/LinZZY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/QuanWGLYWHJ22,
author = {Dou Quan and
Shuang Wang and
Yu Gu and
Ruiqi Lei and
Bowu Yang and
Shaowei Wei and
Biao Hou and
Licheng Jiao},
title = {Deep Feature Correlation Learning for Multi-Modal Remote Sensing Image
Registration},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--16},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2022.3187015},
doi = {10.1109/TGRS.2022.3187015},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/QuanWGLYWHJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/QuanWWLDLHJ22,
author = {Dou Quan and
Huiyuan Wei and
Shuang Wang and
Ruiqi Lei and
Baorui Duan and
Yi Li and
Biao Hou and
Licheng Jiao},
title = {Self-Distillation Feature Learning Network for Optical and {SAR} Image
Registration},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--18},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2022.3173476},
doi = {10.1109/TGRS.2022.3173476},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/QuanWWLDLHJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/XiangLZJFQ22,
author = {Zixuan Xiang and
Zirun Lu and
Xiaoyong Zhu and
Min Jiang and
Deyang Fan and
Li Quan},
title = {Research on Magnetic Coupling Characteristic of a Double Rotor Flux-Switching
{PM} Machine From the Perspective of Air-Gap Harmonic Groups},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {69},
number = {12},
pages = {12551--12563},
year = {2022},
url = {https://doi.org/10.1109/TIE.2021.3139182},
doi = {10.1109/TIE.2021.3139182},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/XiangLZJFQ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/HuyanQZLCJ22,
author = {Ning Huyan and
Dou Quan and
Xiangrong Zhang and
Xuefeng Liang and
Jocelyn Chanussot and
Licheng Jiao},
title = {Unsupervised Outlier Detection Using Memory and Contrastive Learning},
journal = {{IEEE} Trans. Image Process.},
volume = {31},
pages = {6440--6454},
year = {2022},
url = {https://doi.org/10.1109/TIP.2022.3211476},
doi = {10.1109/TIP.2022.3211476},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tip/HuyanQZLCJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tits/0053LY0QD22,
author = {Jie Zhang and
Jiawei Lu and
Xuan Yan and
Xiaolong Xu and
Lianyong Qi and
Wanchun Dou},
title = {Quantified Edge Server Placement With Quantum Encoding in Internet
of Vehicles},
journal = {{IEEE} Trans. Intell. Transp. Syst.},
volume = {23},
number = {7},
pages = {9370--9379},
year = {2022},
url = {https://doi.org/10.1109/TITS.2021.3116960},
doi = {10.1109/TITS.2021.3116960},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tits/0053LY0QD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/0013DJLH22,
author = {Cheng Chen and
Qi Dou and
Yueming Jin and
Quande Liu and
Pheng{-}Ann Heng},
title = {Learning With Privileged Multimodal Knowledge for Unimodal Segmentation},
journal = {{IEEE} Trans. Medical Imaging},
volume = {41},
number = {3},
pages = {621--632},
year = {2022},
url = {https://doi.org/10.1109/TMI.2021.3119385},
doi = {10.1109/TMI.2021.3119385},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmi/0013DJLH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/Yang0JLCH022,
author = {Hongzheng Yang and
Cheng Chen and
Meirui Jiang and
Quande Liu and
Jianfeng Cao and
Pheng{-}Ann Heng and
Qi Dou},
title = {{DLTTA:} Dynamic Learning Rate for Test-Time Adaptation on Cross-Domain
Medical Images},
journal = {{IEEE} Trans. Medical Imaging},
volume = {41},
number = {12},
pages = {3575--3586},
year = {2022},
url = {https://doi.org/10.1109/TMI.2022.3191535},
doi = {10.1109/TMI.2022.3191535},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmi/Yang0JLCH022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/QuanWHCWLHJ22,
author = {Dou Quan and
Shuang Wang and
Ning Huyan and
Jocelyn Chanussot and
Ruojing Wang and
Xuefeng Liang and
Biao Hou and
Licheng Jiao},
title = {Element-Wise Feature Relation Learning Network for Cross-Spectral
Image Patch Matching},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {33},
number = {8},
pages = {3372--3386},
year = {2022},
url = {https://doi.org/10.1109/TNNLS.2021.3052756},
doi = {10.1109/TNNLS.2021.3052756},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnn/QuanWHCWLHJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/todaes/HanWDQ22,
author = {Ming Han and
Ye Wang and
Jian Dong and
Gang Qu},
title = {Double-Shift: {A} Low-Power {DNN} Weights Storage and Access Framework
based on Approximate Decomposition and Quantization},
journal = {{ACM} Trans. Design Autom. Electr. Syst.},
volume = {27},
number = {2},
pages = {15:1--15:16},
year = {2022},
url = {https://doi.org/10.1145/3477047},
doi = {10.1145/3477047},
timestamp = {Sat, 26 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/todaes/HanWDQ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tweb/ChenLZSZ22,
author = {Qi Chen and
Guohui Li and
Quan Zhou and
Si Shi and
Deqing Zou},
title = {Double Attention Convolutional Neural Network for Sequential Recommendation},
journal = {{ACM} Trans. Web},
volume = {16},
number = {4},
pages = {19:1--19:23},
year = {2022},
url = {https://doi.org/10.1145/3555350},
doi = {10.1145/3555350},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tweb/ChenLZSZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vlsisp/Xiao-FengHGLKMC22,
author = {Yang Xiao{-}Feng and
Huang Hong{-}Quan and
Zeng Guo{-}Qiang and
Ge Liang{-}Quan and
Jiang Kai{-}ming and
Gu Min and
Hu Chuan{-}Hao and
Lai Mao{-}Lin},
title = {Pulse Pile-up Correction by Particle Swarm Optimization with Double-layer
Parameter Identification Model in X-ray Spectroscopy},
journal = {J. Signal Process. Syst.},
volume = {94},
number = {4},
pages = {377--386},
year = {2022},
url = {https://doi.org/10.1007/s11265-021-01698-4},
doi = {10.1007/S11265-021-01698-4},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vlsisp/Xiao-FengHGLKMC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/Liu0DH22,
author = {Quande Liu and
Cheng Chen and
Qi Dou and
Pheng{-}Ann Heng},
title = {Single-Domain Generalization in Medical Image Segmentation via Test-Time
Adaptation from Shape Dictionary},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {1756--1764},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i2.20068},
doi = {10.1609/AAAI.V36I2.20068},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/Liu0DH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/DouthitBGRWM22,
author = {Brian J. Douthit and
Katherine Bashaw and
Kimberly Gerant and
Thomas Reese and
Adam Wright and
Allison B. McCoy},
title = {Quality Versus Quantity: Assessing the Impact of Nursing Documentation
on Preventing Hospital Acquired Pressure Injuries},
booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 5-9, 2022},
publisher = {{AMIA}},
year = {2022},
url = {https://knowledge.amia.org/76677-amia-1.4637602/f008-1.4640715/f008-1.4640716/44-1.4641536/501-1.4641533},
timestamp = {Wed, 17 Apr 2024 11:46:45 +0200},
biburl = {https://dblp.org/rec/conf/amia/DouthitBGRWM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apweb/XuanPWQ22,
author = {Dongzhe Xuan and
Yanji Piao and
Dechao Wang and
Zhijun Quan},
editor = {Shiyu Yang and
Md. Saiful Islam},
title = {Failure Simulation Study of Double-Layer Exhaust Manifold for Turbocharged
Engine Under {LCF} {\&} {HCF}},
booktitle = {Web and Big Data. APWeb-WAIM 2022 International Workshops - {KGMA}
2022, SemiBDMA 2022, DeepLUDA 2022, Nanjing, China, November 25-27,
2022, Proceedings},
series = {Communications in Computer and Information Science},
volume = {1784},
pages = {125--137},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-981-99-1354-1\_12},
doi = {10.1007/978-981-99-1354-1\_12},
timestamp = {Wed, 12 Jul 2023 12:24:42 +0200},
biburl = {https://dblp.org/rec/conf/apweb/XuanPWQ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdceo/ZhaoZWQW22,
author = {Dong Zhao and
Qi Zang and
Zining Wang and
Dou Quan and
Shuang Wang},
editor = {Aleksandra Gruca and
Caleb Robinson and
Naoto Yokoya and
Jun Zhou and
Pedram Ghamisi},
title = {SwinLS: Adapting Swin Transformer to Landslide Detection},
booktitle = {Proceedings of the Second Workshop on Complex Data Challenges in Earth
Observation {(CDCEO} 2022) co-located with 31st International Joint
Conference on Artificial Intelligence and the 25th European Conference
on Artificial Intelligence {(IJCAI-ECAI} 2022), Vienna, Austria, July
25th, 2022},
series = {{CEUR} Workshop Proceedings},
volume = {3207},
pages = {91--95},
publisher = {CEUR-WS.org},
year = {2022},
url = {https://ceur-ws.org/Vol-3207/paper14.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:10 +0100},
biburl = {https://dblp.org/rec/conf/cdceo/ZhaoZWQW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhengWYD22,
author = {Kaixin Zheng and
Yaqing Wang and
Quanming Yao and
Dejing Dou},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {Simplified Graph Learning for Inductive Short Text Classification},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {10717--10724},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.735},
doi = {10.18653/V1/2022.EMNLP-MAIN.735},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhengWYD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/LoisVPA22,
author = {Elena Rodr{\'{\i}}guez Lois and
David V{\'{a}}zquez{-}Pad{\'{\i}}n and
Fernando P{\'{e}}rez{-}Gonz{\'{a}}lez and
Pedro {Comesa{~{n}}a Alfaro}},
title = {A Critical Look into Quantization Table Generalization Capabilities
of CNN-based Double {JPEG} Compression Detection},
booktitle = {30th European Signal Processing Conference, {EUSIPCO} 2022, Belgrade,
Serbia, August 29 - Sept. 2, 2022},
pages = {1022--1026},
publisher = {{IEEE}},
year = {2022},
url = {https://ieeexplore.ieee.org/document/9909784},
timestamp = {Tue, 25 Oct 2022 21:20:45 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/LoisVPA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/BrownT22,
author = {Katherine E. Brown and
Douglas A. Talbert},
editor = {Roman Bart{\'{a}}k and
Fazel Keshtkar and
Michael Franklin},
title = {A Simple Direct Uncertainty Quantification Technique Based on Machine
Learning Regression},
booktitle = {Proceedings of the Thirty-Fifth International Florida Artificial Intelligence
Research Society Conference, {FLAIRS} 2022, Hutchinson Island, Jensen
Beach, Florida, USA, May 15-18, 2022},
year = {2022},
url = {https://doi.org/10.32473/flairs.v35i.130655},
doi = {10.32473/FLAIRS.V35I.130655},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/flairs/BrownT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/YangWY22,
author = {Guosong Yang and
Peng Wang and
Xinyu Yin},
editor = {Jonathan E. Fieldsend and
Markus Wagner},
title = {A novel dynamic analysis on multi-scale quantum harmonic oscillator
algorithm using double-well function},
booktitle = {{GECCO} '22: Genetic and Evolutionary Computation Conference, Companion
Volume, Boston, Massachusetts, USA, July 9 - 13, 2022},
pages = {411--414},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3520304.3528965},
doi = {10.1145/3520304.3528965},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/YangWY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/DasPMCSQD22,
author = {Poulami Das and
Christopher A. Pattison and
Srilatha Manne and
Douglas M. Carmean and
Krysta M. Svore and
Moinuddin K. Qureshi and
Nicolas Delfosse},
title = {{AFS:} Accurate, Fast, and Scalable Error-Decoding for Fault-Tolerant
Quantum Computers},
booktitle = {{IEEE} International Symposium on High-Performance Computer Architecture,
{HPCA} 2022, Seoul, South Korea, April 2-6, 2022},
pages = {259--273},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/HPCA53966.2022.00027},
doi = {10.1109/HPCA53966.2022.00027},
timestamp = {Mon, 23 May 2022 16:36:22 +0200},
biburl = {https://dblp.org/rec/conf/hpca/DasPMCSQD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icccsec/ZhangCDLYCL22,
author = {Huali Zhang and
Bichen Che and
Zhao Dou and
Hengji Li and
Yu Yang and
Xiubo Chen and
Jian Li},
editor = {Xingming Sun and
Xiaorui Zhang and
Zhihua Xia and
Elisa Bertino},
title = {A Rational Hierarchical Quantum State Sharing Protocol},
booktitle = {Artificial Intelligence and Security - 8th International Conference,
{ICAIS} 2022, Qinghai, China, July 15-20, 2022, Proceedings, Part
{III}},
series = {Lecture Notes in Computer Science},
volume = {13340},
pages = {108--119},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-06791-4\_9},
doi = {10.1007/978-3-031-06791-4\_9},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icccsec/ZhangCDLYCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/HeXZQ22,
author = {Zheng He and
Zeke Xie and
Quanzhi Zhu and
Zengchang Qin},
editor = {Kamalika Chaudhuri and
Stefanie Jegelka and
Le Song and
Csaba Szepesv{\'{a}}ri and
Gang Niu and
Sivan Sabato},
title = {Sparse Double Descent: Where Network Pruning Aggravates Overfitting},
booktitle = {International Conference on Machine Learning, {ICML} 2022, 17-23 July
2022, Baltimore, Maryland, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {162},
pages = {8635--8659},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v162/he22d.html},
timestamp = {Tue, 12 Jul 2022 17:36:52 +0200},
biburl = {https://dblp.org/rec/conf/icml/HeXZQ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/HonigZM22,
author = {Robert H{\"{o}}nig and
Yiren Zhao and
Robert D. Mullins},
editor = {Kamalika Chaudhuri and
Stefanie Jegelka and
Le Song and
Csaba Szepesv{\'{a}}ri and
Gang Niu and
Sivan Sabato},
title = {DAdaQuant: Doubly-adaptive quantization for communication-efficient
Federated Learning},
booktitle = {International Conference on Machine Learning, {ICML} 2022, 17-23 July
2022, Baltimore, Maryland, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {162},
pages = {8852--8866},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v162/honig22a.html},
timestamp = {Fri, 06 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/HonigZM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/LiHZLY0D22,
author = {Guanghao Li and
Yue Hu and
Miao Zhang and
Ji Liu and
Quanjun Yin and
Yong Peng and
Dejing Dou},
title = {FedHiSyn: {A} Hierarchical Synchronous Federated Learning Framework
for Resource and Data Heterogeneity},
booktitle = {Proceedings of the 51st International Conference on Parallel Processing,
{ICPP} 2022, Bordeaux, France, 29 August 2022 - 1 September 2022},
pages = {8:1--8:11},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3545008.3545065},
doi = {10.1145/3545008.3545065},
timestamp = {Wed, 15 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/LiHZLY0D22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-4/DouardSGC22,
author = {Nicolas Douard and
Ahmed Samet and
George C. Giakos and
Denis Cavallucci},
editor = {Robert Nowak and
Jerzy Chrzaszcz and
Stelian Brad},
title = {Bridging Two Different Domains to Pair Their Inherent Problem-Solution
Text Contents: Applications to Quantum Sensing and Biology},
booktitle = {Systematic Innovation Partnerships with Artificial Intelligence and
Information Technology - 22nd International {TRIZ} Future Conference,
{TFC} 2022, Warsaw, Poland, September 27-29, 2022, Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {655},
pages = {61--69},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-17288-5\_6},
doi = {10.1007/978-3-031-17288-5\_6},
timestamp = {Tue, 22 Nov 2022 14:24:25 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-4/DouardSGC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/WeiQLDWLHJ22,
author = {Huiyuan Wei and
Dou Quan and
Ruiqi Lei and
Baorui Duan and
Shuang Wang and
Yi Li and
Biao Hou and
Licheng Jiao},
title = {Deep Modality Independent Descriptor Learning for Optical and {SAR}
Image Patch Matching},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2022, Kuala Lumpur, Malaysia, July 17-22, 2022},
pages = {1936--1939},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IGARSS46834.2022.9883314},
doi = {10.1109/IGARSS46834.2022.9883314},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/WeiQLDWLHJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iip/LiuD22,
author = {Huan Liu and
Quansheng Dou},
editor = {Zhongzhi Shi and
Jean{-}Daniel Zucker and
Bo An},
title = {Neighborhood Network for Aspect-Based Sentiment Analysis},
booktitle = {Intelligent Information Processing {XI} - 12th {IFIP} {TC} 12 International
Conference, {IIP} 2022, Qingdao, China, May 27-30, 2022, Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {643},
pages = {216--227},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-03948-5\_18},
doi = {10.1007/978-3-031-03948-5\_18},
timestamp = {Tue, 24 May 2022 15:58:35 +0200},
biburl = {https://dblp.org/rec/conf/iip/LiuD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iip/ZhangDC22,
author = {Guoxi Zhang and
Yongquan Dong and
Huafeng Chen},
editor = {Zhongzhi Shi and
Jean{-}Daniel Zucker and
Bo An},
title = {Double-Channel Multi-layer Information Fusion for Text Matching},
booktitle = {Intelligent Information Processing {XI} - 12th {IFIP} {TC} 12 International
Conference, {IIP} 2022, Qingdao, China, May 27-30, 2022, Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {643},
pages = {114--123},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-03948-5\_10},
doi = {10.1007/978-3-031-03948-5\_10},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iip/ZhangDC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iip/ZhaoDJ22,
author = {Ping Zhao and
Quansheng Dou and
Ping Jiang},
editor = {Zhongzhi Shi and
Jean{-}Daniel Zucker and
Bo An},
title = {Attention Adaptive Chinese Named Entity Recognition Based on Vocabulary
Enhancement},
booktitle = {Intelligent Information Processing {XI} - 12th {IFIP} {TC} 12 International
Conference, {IIP} 2022, Qingdao, China, May 27-30, 2022, Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {643},
pages = {399--406},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-03948-5\_32},
doi = {10.1007/978-3-031-03948-5\_32},
timestamp = {Tue, 24 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iip/ZhaoDJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismir/ZhouMT22,
author = {Michael Zhou and
Andrew Mcgraw and
Douglas R. Turnbull},
editor = {Preeti Rao and
Hema A. Murthy and
Ajay Srinivasamurthy and
Rachel M. Bittner and
Rafael Caro Repetto and
Masataka Goto and
Xavier Serra and
Marius Miron},
title = {Towards Quantifying the Strength of Music Scenes Using Live Event
Data},
booktitle = {Proceedings of the 23rd International Society for Music Information
Retrieval Conference, {ISMIR} 2022, Bengaluru, India, December 4-8,
2022},
pages = {583--590},
year = {2022},
url = {https://archives.ismir.net/ismir2022/paper/000070.pdf},
timestamp = {Mon, 08 May 2023 14:44:00 +0200},
biburl = {https://dblp.org/rec/conf/ismir/ZhouMT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ist/BarnesPBDNAPKD022,
author = {C. Barnes and
Alec Puran and
Anthony Beninati and
Nicolas Douard and
Martin Nowak and
Obed Appiah and
C. Prashad and
Alexandros Kerwick and
N. Das and
Yi Wang and
A. Hussein and
Georgios K. Giakos},
title = {Space Situational Awareness {(SSA)} and Quantum Neuromorphic Computing},
booktitle = {{IEEE} International Conference on Imaging Systems and Techniques,
{IST} 2022, Kaohsiung, Taiwan, June 21-23, 2022},
pages = {1--6},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IST55454.2022.9827746},
doi = {10.1109/IST55454.2022.9827746},
timestamp = {Mon, 19 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ist/BarnesPBDNAPKD022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/DaiLWDZZZS22,
author = {Quanyu Dai and
Haoxuan Li and
Peng Wu and
Zhenhua Dong and
Xiao{-}Hua Zhou and
Rui Zhang and
Rui Zhang and
Jie Sun},
editor = {Aidong Zhang and
Huzefa Rangwala},
title = {A Generalized Doubly Robust Learning Framework for Debiasing Post-Click
Conversion Rate Prediction},
booktitle = {{KDD} '22: The 28th {ACM} {SIGKDD} Conference on Knowledge Discovery
and Data Mining, Washington, DC, USA, August 14 - 18, 2022},
pages = {252--262},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3534678.3539270},
doi = {10.1145/3534678.3539270},
timestamp = {Tue, 16 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kdd/DaiLWDZZZS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/meditcom/RenDB22,
author = {Zhihan Ren and
Angela Doufexi and
Mark A. Beach},
title = {Lattice Quantization for Centralized and Scalable Cell-Free Massive
{MIMO} with Realistic Fronthaul},
booktitle = {{IEEE} International Mediterranean Conference on Communications and
Networking, MeditCom 2022, Athens, Greece, September 5-8, 2022},
pages = {298--303},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/MeditCom55741.2022.9928751},
doi = {10.1109/MEDITCOM55741.2022.9928751},
timestamp = {Fri, 11 Nov 2022 17:01:56 +0100},
biburl = {https://dblp.org/rec/conf/meditcom/RenDB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mhci/ParkCKLS22,
author = {Doeun Park and
Myounglee Choo and
Jinwoo Kim and
Junghan Lee and
Yee{-}Jin Shin},
editor = {Pourang P. Irani and
Xiaojuan Ma and
Jason Alexander and
Bing{-}Yu Chen and
Petra Isenberg},
title = {Conversational Agent for Creating Regularity in Children with {ADHD:}
{A} Quantitative and Qualitative Pilot Study},
booktitle = {MobileHCI '22: Adjunct Publication of the 24th International Conference
on Human-Computer Interaction with Mobile Devices and Services, Vancouver,
BC, Canada, 28 September 2022 - 1 October 2022},
pages = {21:1--21:6},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3528575.3551452},
doi = {10.1145/3528575.3551452},
timestamp = {Mon, 16 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mhci/ParkCKLS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/JiangYLLHD22,
author = {Meirui Jiang and
Hongzheng Yang and
Xiaoxiao Li and
Quande Liu and
Pheng{-}Ann Heng and
Qi Dou},
editor = {Linwei Wang and
Qi Dou and
P. Thomas Fletcher and
Stefanie Speidel and
Shuo Li},
title = {Dynamic Bank Learning for Semi-supervised Federated Image Diagnosis
with Class Imbalance},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2022 - 25th International Conference, Singapore, September 18-22,
2022, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {13433},
pages = {196--206},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-16437-8\_19},
doi = {10.1007/978-3-031-16437-8\_19},
timestamp = {Tue, 13 Dec 2022 14:39:06 +0100},
biburl = {https://dblp.org/rec/conf/miccai/JiangYLLHD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miigp/RettmannHKNDKMF22,
author = {Maryam E. Rettmann and
Stephan Hohmann and
Hiroki Konishi and
Laura K. Newman and
Amanda J. Deisher and
Jon J. Kruse and
Kelly Merrell and
R. Foote and
Michael G. Herman and
Douglas L. Packer},
editor = {Cristian A. Linte and
Jeffrey H. Siewerdsen},
title = {Quantification of cardiac motion using in vivo fiducial markers for
beam ablation of cardiac arrhythmias},
booktitle = {Medical Imaging 2022: Image-Guided Procedures, Robotic Interventions,
and Modeling, San Diego, CA, USA, February 20-24, 2022 / Online, March
21-27, 2022},
series = {{SPIE} Proceedings},
volume = {12034},
publisher = {{SPIE}},
year = {2022},
url = {https://doi.org/10.1117/12.2613484},
doi = {10.1117/12.2613484},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miigp/RettmannHKNDKMF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ChenHWF22,
author = {Hongwei Chen and
Douglas Hendry and
Phillip Weinberg and
Adrian E. Feiguin},
editor = {Sanmi Koyejo and
S. Mohamed and
A. Agarwal and
Danielle Belgrave and
K. Cho and
A. Oh},
title = {Systematic improvement of neural network quantum states using Lanczos},
booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference
on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
LA, USA, November 28 - December 9, 2022},
year = {2022},
url = {http://papers.nips.cc/paper\_files/paper/2022/hash/3173c427cb4ed2d5eaab029c17f221ae-Abstract-Conference.html},
timestamp = {Mon, 08 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ChenHWF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pkc/BrendelF0JS22,
author = {Jacqueline Brendel and
Rune Fiedler and
Felix G{\"{u}}nther and
Christian Janson and
Douglas Stebila},
editor = {Goichiro Hanaoka and
Junji Shikata and
Yohei Watanabe},
title = {Post-quantum Asynchronous Deniable Key Exchange and the Signal Handshake},
booktitle = {Public-Key Cryptography - {PKC} 2022 - 25th {IACR} International Conference
on Practice and Theory of Public-Key Cryptography, Virtual Event,
March 8-11, 2022, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {13178},
pages = {3--34},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-030-97131-1\_1},
doi = {10.1007/978-3-030-97131-1\_1},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pkc/BrendelF0JS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-01246,
author = {Tong Dou and
Guofeng Zhang and
Wei Cui},
title = {Efficient Quantum Feature Extraction for CNN-based Learning},
journal = {CoRR},
volume = {abs/2201.01246},
year = {2022},
url = {https://arxiv.org/abs/2201.01246},
eprinttype = {arXiv},
eprint = {2201.01246},
timestamp = {Wed, 12 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-01246.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-05821,
author = {Arnaud Huaulm{\'{e}} and
Kanako Harada and
Quang{-}Minh Nguyen and
Bogyu Park and
Seungbum Hong and
Min{-}Kook Choi and
Michael Peven and
Yunshuang Li and
Yonghao Long and
Qi Dou and
Satyadwyoom Kumar and
Seenivasan Lalithkumar and
Hongliang Ren and
Hiroki Matsuzaki and
Yuto Ishikawa and
Yuriko Harai and
Satoshi Kondo and
Mamoru Mitsuishi and
Pierre Jannin},
title = {PEg TRAnsfer Workflow recognition challenge report: Does multi-modal
data improve recognition?},
journal = {CoRR},
volume = {abs/2202.05821},
year = {2022},
url = {https://arxiv.org/abs/2202.05821},
eprinttype = {arXiv},
eprint = {2202.05821},
timestamp = {Mon, 04 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-05821.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-13723,
author = {Hongzheng Yang and
Cheng Chen and
Meirui Jiang and
Quande Liu and
Jianfeng Cao and
Pheng{-}Ann Heng and
Qi Dou},
title = {{DLTTA:} Dynamic Learning Rate for Test-time Adaptation on Cross-domain
Medical Images},
journal = {CoRR},
volume = {abs/2205.13723},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.13723},
doi = {10.48550/ARXIV.2205.13723},
eprinttype = {arXiv},
eprint = {2205.13723},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-13723.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04615,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {CoRR},
volume = {abs/2206.04615},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.04615},
doi = {10.48550/ARXIV.2206.04615},
eprinttype = {arXiv},
eprint = {2206.04615},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-04615.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-05824,
author = {Richard J. Licata and
Piyush M. Mehta and
Daniel R. Weimer and
Douglas P. Drob and
W. Kent Tobiska and
Jean Yoshii},
title = {Science through Machine Learning: Quantification of Poststorm Thermospheric
Cooling},
journal = {CoRR},
volume = {abs/2206.05824},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.05824},
doi = {10.48550/ARXIV.2206.05824},
eprinttype = {arXiv},
eprint = {2206.05824},
timestamp = {Mon, 20 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-05824.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-08684,
author = {Zheng He and
Zeke Xie and
Quanzhi Zhu and
Zengchang Qin},
title = {Sparse Double Descent: Where Network Pruning Aggravates Overfitting},
journal = {CoRR},
volume = {abs/2206.08684},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.08684},
doi = {10.48550/ARXIV.2206.08684},
eprinttype = {arXiv},
eprint = {2206.08684},
timestamp = {Tue, 21 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-08684.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-10546,
author = {Guanghao Li and
Yue Hu and
Miao Zhang and
Ji Liu and
Quanjun Yin and
Yong Peng and
Dejing Dou},
title = {FedHiSyn: {A} Hierarchical Synchronous Federated Learning Framework
for Resource and Data Heterogeneity},
journal = {CoRR},
volume = {abs/2206.10546},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.10546},
doi = {10.48550/ARXIV.2206.10546},
eprinttype = {arXiv},
eprint = {2206.10546},
timestamp = {Tue, 13 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-10546.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-13079,
author = {Meirui Jiang and
Hongzheng Yang and
Xiaoxiao Li and
Quande Liu and
Pheng{-}Ann Heng and
Qi Dou},
title = {Dynamic Bank Learning for Semi-supervised Federated Image Diagnosis
with Class Imbalance},
journal = {CoRR},
volume = {abs/2206.13079},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.13079},
doi = {10.48550/ARXIV.2206.13079},
eprinttype = {arXiv},
eprint = {2206.13079},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-13079.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-14467,
author = {Quande Liu and
Cheng Chen and
Qi Dou and
Pheng{-}Ann Heng},
title = {Single-domain Generalization in Medical Image Segmentation via Test-time
Adaptation from Shape Dictionary},
journal = {CoRR},
volume = {abs/2206.14467},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.14467},
doi = {10.48550/ARXIV.2206.14467},
eprinttype = {arXiv},
eprint = {2206.14467},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-14467.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-14483,
author = {Lei Liu and
Xinglei Dou},
title = {QuCloud+: {A} Holistic Qubit Mapping Scheme for Single/Multi-programming
on 2D/3D {NISQ} Quantum Computers},
journal = {CoRR},
volume = {abs/2207.14483},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2207.14483},
doi = {10.48550/ARXIV.2207.14483},
eprinttype = {arXiv},
eprint = {2207.14483},
timestamp = {Tue, 02 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2207-14483.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-06684,
author = {Quanyu Dai and
Haoxuan Li and
Peng Wu and
Zhenhua Dong and
Xiao{-}Hua Zhou and
Rui Zhang and
Rui Zhang and
Jie Sun},
title = {A Generalized Doubly Robust Learning Framework for Debiasing Post-Click
Conversion Rate Prediction},
journal = {CoRR},
volume = {abs/2211.06684},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.06684},
doi = {10.48550/ARXIV.2211.06684},
eprinttype = {arXiv},
eprint = {2211.06684},
timestamp = {Mon, 22 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-06684.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-14196,
author = {Jason Goertzen and
Douglas Stebila},
title = {Post-Quantum Signatures in {DNSSEC} via Request-Based Fragmentation},
journal = {CoRR},
volume = {abs/2211.14196},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.14196},
doi = {10.48550/ARXIV.2211.14196},
eprinttype = {arXiv},
eprint = {2211.14196},
timestamp = {Tue, 29 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-14196.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-15671,
author = {Quan Feng and
Jiayu Yao and
Zhisong Pan and
Guojun Zhou},
title = {Deep Semi-supervised Learning with Double-Contrast of Features and
Semantics},
journal = {CoRR},
volume = {abs/2211.15671},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.15671},
doi = {10.48550/ARXIV.2211.15671},
eprinttype = {arXiv},
eprint = {2211.15671},
timestamp = {Fri, 02 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-15671.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-11446,
author = {Tao Li and
Quanyan Zhu},
title = {Commitment with Signaling under Double-sided Information Asymmetry},
journal = {CoRR},
volume = {abs/2212.11446},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.11446},
doi = {10.48550/ARXIV.2212.11446},
eprinttype = {arXiv},
eprint = {2212.11446},
timestamp = {Wed, 04 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-11446.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-13859,
author = {Nicolas Jolly and
Giuseppe Di Molfetta},
title = {Twisted quantum walks, generalised Dirac equation and Fermion doubling},
journal = {CoRR},
volume = {abs/2212.13859},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.13859},
doi = {10.48550/ARXIV.2212.13859},
eprinttype = {arXiv},
eprint = {2212.13859},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-13859.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-14201,
author = {Menghan Dou and
Tianrui Zou and
Yuan Fang and
Jing Wang and
Dongyi Zhao and
Lei Yu and
Boying Chen and
Wenbo Guo and
Ye Li and
Zhaoyun Chen and
Guoping Guo},
title = {QPanda: high-performance quantum computing framework for multiple
application scenarios},
journal = {CoRR},
volume = {abs/2212.14201},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.14201},
doi = {10.48550/ARXIV.2212.14201},
eprinttype = {arXiv},
eprint = {2212.14201},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-14201.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BhaumikCFN22,
author = {Ritam Bhaumik and
Andr{\'{e}} Chailloux and
Paul Frixons and
Mar{\'{\i}}a Naya{-}Plasencia},
title = {Safely Doubling your Block Ciphers for a Post-Quantum World},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1342},
year = {2022},
url = {https://eprint.iacr.org/2022/1342},
timestamp = {Sat, 22 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BhaumikCFN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/dnb/Neto21,
author = {Hugo de Morais Dourado Neto},
title = {Quantitative principles of optimal cellular resource allocation},
school = {University of D{\"{u}}sseldorf, Germany},
year = {2021},
url = {https://docserv.uni-duesseldorf.de/servlets/DocumentServlet?id=56127},
urn = {urn:nbn:de:hbz:061-20210507-113402-2},
timestamp = {Sat, 17 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/dnb/Neto21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/hal/Zhao21e,
author = {Yuan Zhao},
title = {Observations and quantifications of precipitation signatures from
C-band dual-polarized {SAR} measurements. (Observations et quantifications
des signatures de pr{\'{e}}cipitations {\`{a}} partir des mesures
{SAR} {\`{a}} double polarisation en bande {C)}},
school = {{IMT} Atlantique Bretagne Pays de la Loire, Brest, France},
year = {2021},
url = {https://tel.archives-ouvertes.fr/tel-03601164},
timestamp = {Sun, 03 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/phd/hal/Zhao21e.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/QiaoLSWWLLZQGBL21,
author = {Zhongliang Qiao and
Xiang Li and
Jia Xu Brian Sia and
Wanjun Wang and
Hong Wang and
Lin Li and
Zaijin Li and
Zhibin Zhao and
Yi Qu and
Xin Gao and
Baoxue Bo and
Chongyang Liu},
title = {Stable Mode-Locked Operation With High Temperature Characteristics
of a Two-Section InGaAs/GaAs Double Quantum Wells Laser},
journal = {{IEEE} Access},
volume = {9},
pages = {16608--16614},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3051179},
doi = {10.1109/ACCESS.2021.3051179},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/QiaoLSWWLLZQGBL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/RodasLLC21,
author = {Ricardo Neftali Pontaza Rodas and
Ying{-}Dar Lin and
Shih{-}Lien Lu and
Keh{-}Jeng Chang},
title = {O2MD{\({^2}\)}: {A} New Post-Quantum Cryptosystem With One-to-Many
Distributed Key Management Based on Prime Modulo Double Encapsulation},
journal = {{IEEE} Access},
volume = {9},
pages = {109260--109288},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3100551},
doi = {10.1109/ACCESS.2021.3100551},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/RodasLLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SeeNTCLH21,
author = {Jin{-}Chuan See and
Hui{-}Fuang Ng and
Hung{-}Khoon Tan and
Jing{-}Jing Chang and
Wai{-}Kong Lee and
Seong Oun Hwang},
title = {DoubleQExt: Hardware and Memory Efficient {CNN} Through Two Levels
of Quantization},
journal = {{IEEE} Access},
volume = {9},
pages = {169082--169091},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3138756},
doi = {10.1109/ACCESS.2021.3138756},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/SeeNTCLH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/YoonQD21,
author = {Byung{-}Jun Yoon and
Xiaoning Qian and
Edward R. Dougherty},
title = {Quantifying the Multi-Objective Cost of Uncertainty},
journal = {{IEEE} Access},
volume = {9},
pages = {80351--80359},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3085486},
doi = {10.1109/ACCESS.2021.3085486},
timestamp = {Tue, 15 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/YoonQD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/MalikRBG21,
author = {Karim Malik and
Colin Robertson and
Douglas Braun and
Clara Greig},
title = {U-Net convolutional neural network models for detecting and quantifying
placer mining disturbances at watershed scales},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {104},
pages = {102510},
year = {2021},
url = {https://doi.org/10.1016/j.jag.2021.102510},
doi = {10.1016/J.JAG.2021.102510},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aeog/MalikRBG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/HanHY21,
author = {Kunlun Han and
Tianwei Huang and
Linfei Yin},
title = {Quantum parallel multi-layer Monte Carlo optimization algorithm for
controller parameters optimization of doubly-fed induction generator-based
wind turbines},
journal = {Appl. Soft Comput.},
volume = {112},
pages = {107813},
year = {2021},
url = {https://doi.org/10.1016/j.asoc.2021.107813},
doi = {10.1016/J.ASOC.2021.107813},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/asc/HanHY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/DouYXZ21,
author = {Lijun Dou and
Fenglong Yang and
Lei Xu and
Quan Zou},
title = {A comprehensive review of the imbalance classification of protein
post-translational modifications},
journal = {Briefings Bioinform.},
volume = {22},
number = {5},
year = {2021},
url = {https://doi.org/10.1093/bib/bbab089},
doi = {10.1093/BIB/BBAB089},
timestamp = {Wed, 22 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/DouYXZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/DokmegangNKSCPD21,
author = {Joel Dokmegang and
Hanh Nguyen and
Elena Kardash and
Thierry Savy and
Matteo Cavaliere and
Nadine Peyri{\'{e}}ras and
Ren{\'{e}} Doursat},
title = {Quantification of cell behaviors and computational modeling show that
cell directional behaviors drive zebrafish pectoral fin morphogenesis},
journal = {Bioinform.},
volume = {37},
number = {18},
pages = {2946--2954},
year = {2021},
url = {https://doi.org/10.1093/bioinformatics/btab201},
doi = {10.1093/BIOINFORMATICS/BTAB201},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/DokmegangNKSCPD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/ZervouDPT21,
author = {Michaela Areti Zervou and
Effrosyni Doutsi and
Pavlos Pavlidis and
Panagiotis Tsakalides},
title = {Structural classification of proteins based on the computationally
efficient recurrence quantification analysis and horizontal visibility
graphs},
journal = {Bioinform.},
volume = {37},
number = {13},
pages = {1796--1804},
year = {2021},
url = {https://doi.org/10.1093/bioinformatics/btab407},
doi = {10.1093/BIOINFORMATICS/BTAB407},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/ZervouDPT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/MashatanH21,
author = {Atefeh Mashatan and
Douglas Heintzman},
title = {The complex path to quantum resistance},
journal = {Commun. {ACM}},
volume = {64},
number = {9},
pages = {46--53},
year = {2021},
url = {https://doi.org/10.1145/3464905},
doi = {10.1145/3464905},
timestamp = {Mon, 20 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/MashatanH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccfthpc/WenJDXX21,
author = {Dong Wen and
Jingfei Jiang and
Yong Dou and
Jinwei Xu and
Tao Xiao},
title = {An energy-efficient convolutional neural network accelerator for speech
classification based on {FPGA} and quantization},
journal = {{CCF} Trans. High Perform. Comput.},
volume = {3},
number = {1},
pages = {4--16},
year = {2021},
url = {https://doi.org/10.1007/s42514-020-00055-4},
doi = {10.1007/S42514-020-00055-4},
timestamp = {Wed, 22 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ccfthpc/WenJDXX21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/YinCLHG21,
author = {Linfei Yin and
Lichun Chen and
Dongduan Liu and
Xiao Huang and
Fang Gao},
title = {Quantum deep reinforcement learning for rotor side converter control
of double-fed induction generator-based wind turbines},
journal = {Eng. Appl. Artif. Intell.},
volume = {106},
pages = {104451},
year = {2021},
url = {https://doi.org/10.1016/j.engappai.2021.104451},
doi = {10.1016/J.ENGAPPAI.2021.104451},
timestamp = {Thu, 11 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eaai/YinCLHG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecoi/GohrBSI21,
author = {Charlotte Gohr and
Jeanette S. Blumr{\"{o}}der and
Douglas Sheil and
Pierre L. Ibisch},
title = {Quantifying the mitigation of temperature extremes by forests and
wetlands in a temperate landscape},
journal = {Ecol. Informatics},
volume = {66},
pages = {101442},
year = {2021},
url = {https://doi.org/10.1016/j.ecoinf.2021.101442},
doi = {10.1016/J.ECOINF.2021.101442},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ecoi/GohrBSI21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejisec/TondiCHL21,
author = {Benedetta Tondi and
Andrea Costanzo and
Dequ Huang and
Bin Li},
title = {Boosting CNN-based primary quantization matrix estimation of double
{JPEG} images via a classification-like architecture},
journal = {{EURASIP} J. Inf. Secur.},
volume = {2021},
number = {1},
pages = {5},
year = {2021},
url = {https://doi.org/10.1186/s13635-021-00119-0},
doi = {10.1186/S13635-021-00119-0},
timestamp = {Mon, 31 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejisec/TondiCHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icl/CaoZZL21,
author = {Zhiwei Cao and
Hongfei Zhu and
Yuping Zhao and
Dou Li},
title = {Nonuniform Quantized Decoder for Polar Codes With Minimum Distortion
Quantizer},
journal = {{IEEE} Commun. Lett.},
volume = {25},
number = {3},
pages = {835--839},
year = {2021},
url = {https://doi.org/10.1109/LCOMM.2020.3041902},
doi = {10.1109/LCOMM.2020.3041902},
timestamp = {Tue, 23 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/icl/CaoZZL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/HuangLFGC21,
author = {Bing Huang and
Huaxiong Li and
Guofu Feng and
Chunxiang Guo and
Dafeng Chen},
title = {Double-quantitative rough sets, optimal scale selection and reduction
in multi-scale dominance {IF} decision tables},
journal = {Int. J. Approx. Reason.},
volume = {130},
pages = {170--191},
year = {2021},
url = {https://doi.org/10.1016/j.ijar.2020.12.001},
doi = {10.1016/J.IJAR.2020.12.001},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijar/HuangLFGC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/DouYGZ21,
author = {Ying Dou and
Yu Yun and
Quanxue Gao and
Xiangdong Zhang},
title = {Self-representation and matrix factorization based multi-view clustering},
journal = {Neurocomputing},
volume = {459},
pages = {395--407},
year = {2021},
url = {https://doi.org/10.1016/j.neucom.2021.06.092},
doi = {10.1016/J.NEUCOM.2021.06.092},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/DouYGZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/JiangL21,
author = {Lisheng Jiang and
Huchang Liao},
title = {Double-quantified linguistic variable},
journal = {Inf. Sci.},
volume = {545},
pages = {207--222},
year = {2021},
url = {https://doi.org/10.1016/j.ins.2020.08.026},
doi = {10.1016/J.INS.2020.08.026},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/JiangL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/istr/AparnaBSVSRPE21,
author = {H. Aparna and
B. Bhumijaa and
R. Santhiyadevi and
K. Vaishanavi and
M. Sathanarayanan and
Amirtharajan Rengarajan and
Padmapriya Praveenkumar and
Ahmed A. Abd El{-}Latif},
title = {Double layered Fridrich structure to conserve medical data privacy
using quantum cryptosystem},
journal = {J. Inf. Secur. Appl.},
volume = {63},
pages = {102972},
year = {2021},
url = {https://doi.org/10.1016/j.jisa.2021.102972},
doi = {10.1016/J.JISA.2021.102972},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/istr/AparnaBSVSRPE21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jetai/HuSWJ21,
author = {Xiaoyuan Hu and
Bingzhen Sun and
Ting Wang and
Chao Jiang},
title = {Double-quantitative decision rough set over two universes and application
to African swine fever decision-making},
journal = {J. Exp. Theor. Artif. Intell.},
volume = {33},
number = {2},
pages = {331--347},
year = {2021},
url = {https://doi.org/10.1080/0952813X.2020.1744195},
doi = {10.1080/0952813X.2020.1744195},
timestamp = {Thu, 08 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jetai/HuSWJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/XuEQCN21,
author = {Kaijie Xu and
Hanyu E and
Yinghui Quan and
Ye Cui and
Weike Nie},
title = {From granulation-degranulation mechanisms to fuzzy rule-based models:
Augmentation of granular-based models with a double fuzzy clustering},
journal = {J. Intell. Fuzzy Syst.},
volume = {40},
number = {6},
pages = {12243--12252},
year = {2021},
url = {https://doi.org/10.3233/JIFS-210336},
doi = {10.3233/JIFS-210336},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jifs/XuEQCN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jzusc/NavidiSD21,
author = {Alireza Navidi and
Reza Sabbaghi{-}Nadooshan and
Massoud Dousti},
title = {A creative concept for designing and simulating quaternary logic gates
in quantum-dot cellular automata},
journal = {Frontiers Inf. Technol. Electron. Eng.},
volume = {22},
number = {11},
pages = {1541--1550},
year = {2021},
url = {https://doi.org/10.1631/FITEE.2000590},
doi = {10.1631/FITEE.2000590},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jzusc/NavidiSD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/ZhangGLM21,
author = {Xianyong Zhang and
Hongyuan Gou and
Zhiying Lv and
Duoqian Miao},
title = {Double-quantitative distance measurement and classification learning
based on the tri-level granular structure of neighborhood system},
journal = {Knowl. Based Syst.},
volume = {217},
pages = {106799},
year = {2021},
url = {https://doi.org/10.1016/j.knosys.2021.106799},
doi = {10.1016/J.KNOSYS.2021.106799},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kbs/ZhangGLM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/HuangLDWMZJXMDY21,
author = {Ruobing Huang and
Zehui Lin and
Haoran Dou and
Jian Wang and
Juzheng Miao and
Guangquan Zhou and
Xiaohong Jia and
Wenwen Xu and
Zihan Mei and
Yijie Dong and
Xin Yang and
Jianqiao Zhou and
Dong Ni},
title = {{AW3M:} An auto-weighting and recovery framework for breast cancer
diagnosis using multi-modal ultrasound},
journal = {Medical Image Anal.},
volume = {72},
pages = {102137},
year = {2021},
url = {https://doi.org/10.1016/j.media.2021.102137},
doi = {10.1016/J.MEDIA.2021.102137},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mia/HuangLDWMZJXMDY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/RodrigoAABSA21,
author = {Santiago Rodrigo and
Sergi Abadal and
Eduard Alarc{\'{o}}n and
Medina Bandic and
Hans van Someren and
Carmen G. Almud{\'{e}}ver},
title = {On Double Full-Stack Communication-Enabled Architectures for Multicore
Quantum Computers},
journal = {{IEEE} Micro},
volume = {41},
number = {5},
pages = {48--56},
year = {2021},
url = {https://doi.org/10.1109/MM.2021.3092706},
doi = {10.1109/MM.2021.3092706},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/RodrigoAABSA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/WuGHYKLLYL21,
author = {Qi Wu and
Yinjing Guo and
Jiachen Hou and
Jiaojiao Yuan and
Fang Kong and
Wenhong Lyu and
Zhen Liu and
Wenjian Yang and
Quanquan Liang},
title = {Underwater optical image processing based on double threshold judgements
and optimized red dark channel prior method},
journal = {Multim. Tools Appl.},
volume = {80},
number = {19},
pages = {29985--30002},
year = {2021},
url = {https://doi.org/10.1007/s11042-021-11200-8},
doi = {10.1007/S11042-021-11200-8},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/WuGHYKLLYL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/HuangCZSS21,
author = {Zhaoyang Huang and
Zengqiang Chen and
Yuemin Zheng and
Mingwei Sun and
Qinglin Sun},
title = {Optimal design of load frequency active disturbance rejection control
via double-chains quantum genetic algorithm},
journal = {Neural Comput. Appl.},
volume = {33},
number = {8},
pages = {3325--3345},
year = {2021},
url = {https://doi.org/10.1007/s00521-020-05199-6},
doi = {10.1007/S00521-020-05199-6},
timestamp = {Thu, 28 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nca/HuangCZSS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/0001SJLVKLSLYFD21,
author = {Qi Dou and
Tiffany Y. So and
Meirui Jiang and
Quande Liu and
Varut Vardhanabhuti and
Georgios Kaissis and
Zeju Li and
Weixin Si and
Heather H. C. Lee and
Kevin Yu and
Zuxin Feng and
Li Dong and
Egon Burian and
Friederike Jungmann and
Rickmer Braren and
Marcus R. Makowski and
Bernhard Kainz and
Daniel Rueckert and
Ben Glocker and
Simon C. H. Yu and
Pheng{-}Ann Heng},
title = {Federated deep learning for detecting {COVID-19} lung abnormalities
in {CT:} a privacy-preserving multinational validation study},
journal = {npj Digit. Medicine},
volume = {4},
year = {2021},
url = {https://doi.org/10.1038/s41746-021-00431-6},
doi = {10.1038/S41746-021-00431-6},
timestamp = {Mon, 01 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/0001SJLVKLSLYFD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/orl/DownKKR21,
author = {Douglas G. Down and
George Karakostas and
Stavros G. Kolliopoulos and
Somayye Rostami},
title = {Single-item lot-sizing with quantity discount and bounded inventory},
journal = {Oper. Res. Lett.},
volume = {49},
number = {6},
pages = {877--882},
year = {2021},
url = {https://doi.org/10.1016/j.orl.2021.11.002},
doi = {10.1016/J.ORL.2021.11.002},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/orl/DownKKR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/BaghshahiHF21,
author = {Hamid Reza Baghshahi and
Mohammad Haddad and
Mohammad Javad Faghihi},
title = {Geometric discord in a dissipative double-cavity optomechanical system},
journal = {Quantum Inf. Process.},
volume = {20},
number = {7},
pages = {1--16},
year = {2021},
url = {https://doi.org/10.1007/s11128-021-03166-1},
doi = {10.1007/S11128-021-03166-1},
timestamp = {Thu, 12 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/BaghshahiHF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/PintoM21,
author = {Douglas F. Pinto and
Jonas Maziero},
title = {Aspects of quantum states asymmetry for the magnetic dipolar interaction
dynamics},
journal = {Quantum Inf. Process.},
volume = {20},
number = {11},
pages = {379},
year = {2021},
url = {https://doi.org/10.1007/s11128-021-03318-3},
doi = {10.1007/S11128-021-03318-3},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/PintoM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SunZ21,
author = {Shiya Sun and
Huisheng Zhang},
title = {Double-direction quantum cyclic controlled remote state preparation
of two-qubit states},
journal = {Quantum Inf. Process.},
volume = {20},
number = {6},
pages = {211},
year = {2021},
url = {https://doi.org/10.1007/s11128-021-03149-2},
doi = {10.1007/S11128-021-03149-2},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/SunZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ZhangDHJF21,
author = {Meixiang Zhang and
Yin Dou and
Yuting Huang and
Xueqin Jiang and
Yan Feng},
title = {Improved information reconciliation with systematic polar codes for
continuous variable quantum key distribution},
journal = {Quantum Inf. Process.},
volume = {20},
number = {10},
pages = {327},
year = {2021},
url = {https://doi.org/10.1007/s11128-021-03265-z},
doi = {10.1007/S11128-021-03265-Z},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/ZhangDHJF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/quantum/Deuar21,
author = {Piotr Deuar},
title = {Multi-time correlations in the positive-P, Q, and doubled phase-space
representations},
journal = {Quantum},
volume = {5},
pages = {455},
year = {2021},
url = {https://doi.org/10.22331/q-2021-05-10-455},
doi = {10.22331/Q-2021-05-10-455},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/quantum/Deuar21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/quantum/FuenteTE21,
author = {Julio Carlos Magdalena de la Fuente and
Nicolas Tarantino and
Jens Eisert},
title = {Non-Pauli topological stabilizer codes from twisted quantum doubles},
journal = {Quantum},
volume = {5},
pages = {398},
year = {2021},
url = {https://doi.org/10.22331/q-2021-02-17-398},
doi = {10.22331/Q-2021-02-17-398},
timestamp = {Tue, 13 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/quantum/FuenteTE21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/queue/MashatanH21,
author = {Atefeh Mashatan and
Douglas Heintzman},
title = {The Complex Path to Quantum Resistance: Is your organization prepared?},
journal = {{ACM} Queue},
volume = {19},
number = {2},
pages = {65--92},
year = {2021},
url = {https://doi.org/10.1145/3466132.3466779},
doi = {10.1145/3466132.3466779},
timestamp = {Fri, 30 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/queue/MashatanH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ras/ZhaoLCHDZSZH21,
author = {Quanliang Zhao and
Shiqi Liu and
Jinghao Chen and
Guangping He and
Jiejian Di and
Lei Zhao and
Tingting Su and
Mengying Zhang and
Zhiling Hou},
title = {Fast-moving piezoelectric micro-robotic fish with double caudal fins},
journal = {Robotics Auton. Syst.},
volume = {140},
pages = {103733},
year = {2021},
url = {https://doi.org/10.1016/j.robot.2021.103733},
doi = {10.1016/J.ROBOT.2021.103733},
timestamp = {Wed, 28 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ras/ZhaoLCHDZSZH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/LiDWZYZLW21,
author = {Chuanhua Li and
Tianbao Dou and
Yutao Wang and
Tongbin Zhu and
Huanhuan Yin and
Min Zhou and
Lihui Liu and
Xiaodong Wu},
title = {A Method for Quantifying the Impacts of Human Activities on Net Primary
Production of Grasslands in Northwest China},
journal = {Remote. Sens.},
volume = {13},
number = {13},
pages = {2479},
year = {2021},
url = {https://doi.org/10.3390/rs13132479},
doi = {10.3390/RS13132479},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/LiDWZYZLW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/DougakiuchiA21,
author = {Tatsuo Dougakiuchi and
Naota Akikusa},
title = {Application of High-Speed Quantum Cascade Detectors for Mid-Infrared,
Broadband, High-Resolution Spectroscopy},
journal = {Sensors},
volume = {21},
number = {17},
pages = {5706},
year = {2021},
url = {https://doi.org/10.3390/s21175706},
doi = {10.3390/S21175706},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/DougakiuchiA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcss/SirrianniLA21,
author = {Joseph Winstead Sirrianni and
Xiaoqing Liu and
Douglas Adams},
title = {Quantitative Modeling and Analysis of Argumentation Polarization in
Cyber Argumentation},
journal = {{IEEE} Trans. Comput. Soc. Syst.},
volume = {8},
number = {1},
pages = {45--61},
year = {2021},
url = {https://doi.org/10.1109/TCSS.2020.3035228},
doi = {10.1109/TCSS.2020.3035228},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcss/SirrianniLA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/FanQZXQ21,
author = {Deyang Fan and
Li Quan and
Xiaoyong Zhu and
Zixuan Xiang and
Hongjie Que},
title = {Airgap-Harmonic-Based Multilevel Design and Optimization of a Double-Stator
Flux-Modulated Permanent-Magnet Motor},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {68},
number = {11},
pages = {10534--10545},
year = {2021},
url = {https://doi.org/10.1109/TIE.2020.3039207},
doi = {10.1109/TIE.2020.3039207},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/FanQZXQ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/QuanHDWL21,
author = {Xiangjun Quan and
Qinran Hu and
Xiaobo Dou and
Zaijun Wu and
Wei Li},
title = {High-Order Frequency-Locked Loop: General Modeling and Design},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {68},
number = {12},
pages = {12626--12635},
year = {2021},
url = {https://doi.org/10.1109/TIE.2020.3040688},
doi = {10.1109/TIE.2020.3040688},
timestamp = {Thu, 20 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/QuanHDWL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/DoutsiFAT21,
author = {Effrosyni Doutsi and
Lionel Fillatre and
Marc Antonini and
Panagiotis Tsakalides},
title = {Dynamic Image Quantization Using Leaky Integrate-and-Fire Neurons},
journal = {{IEEE} Trans. Image Process.},
volume = {30},
pages = {4305--4315},
year = {2021},
url = {https://doi.org/10.1109/TIP.2021.3070193},
doi = {10.1109/TIP.2021.3070193},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tip/DoutsiFAT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/QuanWLYHCHJ21,
author = {Dou Quan and
Shuang Wang and
Yi Li and
Bowu Yang and
Ning Huyan and
Jocelyn Chanussot and
Biao Hou and
Licheng Jiao},
title = {Multi-Relation Attention Network for Image Patch Matching},
journal = {{IEEE} Trans. Image Process.},
volume = {30},
pages = {7127--7142},
year = {2021},
url = {https://doi.org/10.1109/TIP.2021.3101414},
doi = {10.1109/TIP.2021.3101414},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tip/QuanWLYHCHJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tosc/ChauhanKS21,
author = {Amit Kumar Chauhan and
Abhishek Kumar and
Somitra Kumar Sanadhya},
title = {Quantum Free-Start Collision Attacks on Double Block Length Hashing
with Round-Reduced {AES-256}},
journal = {{IACR} Trans. Symmetric Cryptol.},
volume = {2021},
number = {1},
pages = {316--336},
year = {2021},
url = {https://doi.org/10.46586/tosc.v2021.i1.316-336},
doi = {10.46586/TOSC.V2021.I1.316-336},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tosc/ChauhanKS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsg/XieQWCDH21,
author = {Xingfeng Xie and
Xiangjun Quan and
Zaijun Wu and
Xiaoyong Cao and
Xiaobo Dou and
Qinran Hu},
title = {Adaptive Master-Slave Control Strategy for Medium Voltage {DC} Distribution
Systems Based on a Novel Nonlinear Droop Controller},
journal = {{IEEE} Trans. Smart Grid},
volume = {12},
number = {6},
pages = {4765--4777},
year = {2021},
url = {https://doi.org/10.1109/TSG.2021.3104413},
doi = {10.1109/TSG.2021.3104413},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tsg/XieQWCDH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/GongZS21,
author = {Cheng Gong and
Guopu Zhu and
Peng Shi},
title = {Adaptive Event-Triggered and Double-Quantized Consensus of Leader-Follower
Multiagent Systems With Semi-Markovian Jump Parameters},
journal = {{IEEE} Trans. Syst. Man Cybern. Syst.},
volume = {51},
number = {9},
pages = {5867--5879},
year = {2021},
url = {https://doi.org/10.1109/TSMC.2019.2957530},
doi = {10.1109/TSMC.2019.2957530},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/GongZS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/DuZXZQL21,
author = {Yi Du and
Jiasheng Zhao and
Feng Xiao and
Xiaoyong Zhu and
Li Quan and
Feng Li},
title = {Partitioned Stator Hybrid Excitation Doubly Salient Machine With Slot
Halbach {PM} Arrays},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {70},
number = {4},
pages = {3187--3196},
year = {2021},
url = {https://doi.org/10.1109/TVT.2021.3065670},
doi = {10.1109/TVT.2021.3065670},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/DuZXZQL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/brainles-ws/YinYLJCDH21,
author = {Youtan Yin and
Hongzheng Yang and
Quande Liu and
Meirui Jiang and
Cheng Chen and
Qi Dou and
Pheng{-}Ann Heng},
editor = {Alessandro Crimi and
Spyridon Bakas},
title = {Efficient Federated Tumor Segmentation via Normalized Tensor Aggregation
and Client Pruning},
booktitle = {Brainlesion: Glioma, Multiple Sclerosis, Stroke and Traumatic Brain
Injuries - 7th International Workshop, BrainLes 2021, Held in Conjunction
with {MICCAI} 2021, Virtual Event, September 27, 2021, Revised Selected
Papers, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12963},
pages = {433--443},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-031-09002-8\_38},
doi = {10.1007/978-3-031-09002-8\_38},
timestamp = {Mon, 06 Nov 2023 12:57:51 +0100},
biburl = {https://dblp.org/rec/conf/brainles-ws/YinYLJCDH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/ZhongTLZLS21,
author = {Yi Zhong and
Xiyuan Tang and
Jiaxin Liu and
Wenda Zhao and
Shaolan Li and
Nan Sun},
title = {An 81.5dB-DR 1.25MHz-BW VCO-Based {CT} {\(\Delta\)}{\(\Sigma\)} {ADC}
with Double-PFD Quantizer},
booktitle = {{IEEE} Custom Integrated Circuits Conference, {CICC} 2021, Austin,
TX, USA, April 25-30, 2021},
pages = {1--2},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CICC51472.2021.9431499},
doi = {10.1109/CICC51472.2021.9431499},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cicc/ZhongTLZLS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/Jin0XG21,
author = {Tianyuan Jin and
Pan Xu and
Xiaokui Xiao and
Quanquan Gu},
editor = {Mikhail Belkin and
Samory Kpotufe},
title = {Double Explore-then-Commit: Asymptotic Optimality and Beyond},
booktitle = {Conference on Learning Theory, {COLT} 2021, 15-19 August 2021, Boulder,
Colorado, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {134},
pages = {2584--2633},
publisher = {{PMLR}},
year = {2021},
url = {http://proceedings.mlr.press/v134/jin21a.html},
timestamp = {Wed, 25 Aug 2021 17:11:16 +0200},
biburl = {https://dblp.org/rec/conf/colt/Jin0XG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csr2/PapathanasakiFM21,
author = {Maria Papathanasaki and
Panagiotis Fountas and
Leandros Maglaras and
Christos Douligeris and
Mohamed Amine Ferrag},
title = {Quantum Cryptography in Maritime Telecommunications},
booktitle = {{IEEE} International Conference on Cyber Security and Resilience,
{CSR} 2021, Rhodes, Greece, July 26-28, 2021},
pages = {530--535},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CSR51186.2021.9527973},
doi = {10.1109/CSR51186.2021.9527973},
timestamp = {Fri, 12 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/csr2/PapathanasakiFM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Liu00DH21,
author = {Quande Liu and
Cheng Chen and
Jing Qin and
Qi Dou and
Pheng{-}Ann Heng},
title = {FedDG: Federated Domain Generalization on Medical Image Segmentation
via Episodic Learning in Continuous Frequency Space},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
2021, virtual, June 19-25, 2021},
pages = {1013--1023},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2021},
url = {https://openaccess.thecvf.com/content/CVPR2021/html/Liu\_FedDG\_Federated\_Domain\_Generalization\_on\_Medical\_Image\_Segmentation\_via\_Episodic\_CVPR\_2021\_paper.html},
doi = {10.1109/CVPR46437.2021.00107},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/Liu00DH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/WangWYD21,
author = {Yaqing Wang and
Song Wang and
Quanming Yao and
Dejing Dou},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {Hierarchical Heterogeneous Graph Representation Learning for Short
Text Classification},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {3091--3101},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.247},
doi = {10.18653/V1/2021.EMNLP-MAIN.247},
timestamp = {Fri, 16 Feb 2024 08:27:36 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/WangWYD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esorics/SchwabeSW21,
author = {Peter Schwabe and
Douglas Stebila and
Thom Wiggers},
editor = {Elisa Bertino and
Haya Schulmann and
Michael Waidner},
title = {More Efficient Post-quantum {KEMTLS} with Pre-distributed Public Keys},
booktitle = {Computer Security - {ESORICS} 2021 - 26th European Symposium on Research
in Computer Security, Darmstadt, Germany, October 4-8, 2021, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {12972},
pages = {3--22},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-88418-5\_1},
doi = {10.1007/978-3-030-88418-5\_1},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esorics/SchwabeSW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LiuD21,
author = {Lei Liu and
Xinglei Dou},
title = {QuCloud: {A} New Qubit Mapping Mechanism for Multi-programming Quantum
Computing in Cloud Environment},
booktitle = {{IEEE} International Symposium on High-Performance Computer Architecture,
{HPCA} 2021, Seoul, South Korea, February 27 - March 3, 2021},
pages = {167--178},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/HPCA51647.2021.00024},
doi = {10.1109/HPCA51647.2021.00024},
timestamp = {Sun, 23 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpca/LiuD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icct/TaoLY21,
author = {Xiaofeng Tao and
Yang Lu and
Xueliang Yang},
title = {Short-Term Power Load Probability Density Forecasting Based on a Double-Layer
LSTM-Attention Quantile Regression},
booktitle = {21st International Conference on Communication Technology, {ICCT}
2021, Tianjin, China, October 13-16, 2021},
pages = {1046--1051},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCT52962.2021.9657948},
doi = {10.1109/ICCT52962.2021.9657948},
timestamp = {Tue, 11 Jan 2022 10:02:53 +0100},
biburl = {https://dblp.org/rec/conf/icct/TaoLY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/FuY0CL21,
author = {Yonggan Fu and
Qixuan Yu and
Meng Li and
Vikas Chandra and
Yingyan Lin},
editor = {Marina Meila and
Tong Zhang},
title = {Double-Win Quant: Aggressively Winning Robustness of Quantized Deep
Neural Networks via Random Precision Training and Inference},
booktitle = {Proceedings of the 38th International Conference on Machine Learning,
{ICML} 2021, 18-24 July 2021, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {139},
pages = {3492--3504},
publisher = {{PMLR}},
year = {2021},
url = {http://proceedings.mlr.press/v139/fu21c.html},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/FuY0CL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/LiZZFT21,
author = {Wentao Li and
Shi{-}Qi Zeng and
Tao Zhan and
Bingjiao Fan and
Eric C. C. Tsang},
title = {Double-Quantitative-Based Knowledge Reduction Approach to Inconsistency
Information System},
booktitle = {International Conference on Machine Learning and Cybernetics, {ICMLC}
2021, Adelaide, Australia, December 4-5, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICMLC54886.2021.9737268},
doi = {10.1109/ICMLC54886.2021.9737268},
timestamp = {Thu, 31 Mar 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmlc/LiZZFT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icspcc/MaGLLL21,
author = {Teng Ma and
Jiyu Gai and
Zhennan Liang and
Quanhua Liu and
Haibo Liu},
title = {Weighted Double Threshold Wideband Detector Based on Generalized Likelihood
Ratio Test},
booktitle = {{IEEE} International Conference on Signal Processing, Communications
and Computing, {ICSPCC} 2021, Xi'an, China, August 17-19, 2021},
pages = {1--4},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICSPCC52875.2021.9564811},
doi = {10.1109/ICSPCC52875.2021.9564811},
timestamp = {Tue, 12 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icspcc/MaGLLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/DuanQLL0HJ21,
author = {Baorui Duan and
Dou Quan and
Yi Li and
Ruiqi Lei and
Shuang Wang and
Biao Hou and
Licheng Jiao},
title = {A Feature Decomposition Framework for Multi-Modal Image Patch Matching},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2021, Brussels, Belgium, July 11-16, 2021},
pages = {2250--2253},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IGARSS47720.2021.9553278},
doi = {10.1109/IGARSS47720.2021.9553278},
timestamp = {Mon, 18 Oct 2021 10:57:39 +0200},
biburl = {https://dblp.org/rec/conf/igarss/DuanQLL0HJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LeiYQLDWJHJ21,
author = {Ruiqi Lei and
Bowu Yang and
Dou Quan and
Yi Li and
Baorui Duan and
Shuang Wang and
Huarong Jia and
Biao Hou and
Licheng Jiao},
title = {Deep Global Feature-Based Template Matching for Fast Multi-Modal Image
Registration},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2021, Brussels, Belgium, July 11-16, 2021},
pages = {5457--5460},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IGARSS47720.2021.9553820},
doi = {10.1109/IGARSS47720.2021.9553820},
timestamp = {Tue, 26 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/LeiYQLDWJHJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ima/HiroseK21,
author = {Shoichi Hirose and
Hidenori Kuwakado},
editor = {Maura B. Paterson},
title = {A Note on Quantum Collision Resistance of Double-Block-Length Compression
Functions},
booktitle = {Cryptography and Coding - 18th {IMA} International Conference, {IMACC}
2021, Virtual Event, December 14-15, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13129},
pages = {161--175},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-92641-0\_8},
doi = {10.1007/978-3-030-92641-0\_8},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ima/HiroseK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/LiLTWPMC21,
author = {Quan Li and
Huanbin Lin and
Chun Feng Tang and
Xiguang Wei and
Zhenhui Peng and
Xiaojuan Ma and
Tianjian Chen},
editor = {Dorota Glowacka and
Vinayak R. Krishnamurthy},
title = {Exploring the "Double-Edged Sword" Effect of Auto-Insight Recommendation
in Exploratory Data Analysis},
booktitle = {Joint Proceedings of the {ACM} {IUI} 2021 Workshops co-located with
26th {ACM} Conference on Intelligent User Interfaces {(ACM} {IUI}
2021), College Station, United States, April 13-17, 2021},
series = {{CEUR} Workshop Proceedings},
volume = {2903},
publisher = {CEUR-WS.org},
year = {2021},
url = {https://ceur-ws.org/Vol-2903/IUI21WS-ESIDA-2.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:10 +0100},
biburl = {https://dblp.org/rec/conf/iui/LiLTWPMC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/latincrypt/EatonSS21,
author = {Edward Eaton and
Douglas Stebila and
Roy Stracovsky},
editor = {Patrick Longa and
Carla R{\`{a}}fols},
title = {Post-quantum Key-Blinding for Authentication in Anonymity Networks},
booktitle = {Progress in Cryptology - {LATINCRYPT} 2021 - 7th International Conference
on Cryptology and Information Security in Latin America, Bogot{\'{a}},
Colombia, October 6-8, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12912},
pages = {67--87},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-88238-9\_4},
doi = {10.1007/978-3-030-88238-9\_4},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/latincrypt/EatonSS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/ChenLJDH21,
author = {Cheng Chen and
Quande Liu and
Yueming Jin and
Qi Dou and
Pheng{-}Ann Heng},
editor = {Marleen de Bruijne and
Philippe C. Cattin and
St{\'{e}}phane Cotin and
Nicolas Padoy and
Stefanie Speidel and
Yefeng Zheng and
Caroline Essert},
title = {Source-Free Domain Adaptive Fundus Image Segmentation with Denoised
Pseudo-Labeling},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2021 - 24th International Conference, Strasbourg, France, September
27 - October 1, 2021, Proceedings, Part {V}},
series = {Lecture Notes in Computer Science},
volume = {12905},
pages = {225--235},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-87240-3\_22},
doi = {10.1007/978-3-030-87240-3\_22},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miccai/ChenLJDH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/LiuYDH21,
author = {Quande Liu and
Hongzheng Yang and
Qi Dou and
Pheng{-}Ann Heng},
editor = {Marleen de Bruijne and
Philippe C. Cattin and
St{\'{e}}phane Cotin and
Nicolas Padoy and
Stefanie Speidel and
Yefeng Zheng and
Caroline Essert},
title = {Federated Semi-supervised Medical Image Classification via Inter-client
Relation Matching},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2021 - 24th International Conference, Strasbourg, France, September
27 - October 1, 2021, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {12903},
pages = {325--335},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-87199-4\_31},
doi = {10.1007/978-3-030-87199-4\_31},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miccai/LiuYDH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miigp/RettmannSDHIDKW21,
author = {Maryam E. Rettmann and
Atsushi Suzuki and
Amanda J. Deisher and
Stephan Hohmann and
Kimitake Imamura and
J. Dickow and
Hiroki Konishi and
Songyun Wang and
Laura K. Newman and
Kay D. Parker and
Kristi H. Monahan and
Jon J. Kruse and
Kelly Merrell and
R. Foote and
Michael G. Herman and
Douglas L. Packer},
editor = {Cristian A. Linte and
Jeffrey H. Siewerdsen},
title = {Quantitative assessment of proton beam dose and myocardial lesion
formation detected by high-resolution, ex vivo delayed contrast-enhanced
{MRI} for treatment of ventricular tachycardia},
booktitle = {Medical Imaging 2021: Image-Guided Procedures, Robotic Interventions,
and Modeling, Online, February 15-20, 2021},
series = {{SPIE} Proceedings},
volume = {11598},
publisher = {{SPIE}},
year = {2021},
url = {https://doi.org/10.1117/12.2582220},
doi = {10.1117/12.2582220},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miigp/RettmannSDHIDKW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miua/BernalXHEJCDSTT21,
author = {Jos{\'{e}} Bernal and
William Xu and
Maria del C. Vald{\'{e}}s Hern{\'{a}}ndez and
Javier Escudero and
Angela C. C. Jochems and
Una Clancy and
Fergus N. Doubal and
Michael S. Stringer and
Michael J. Thrippleton and
Rhian M. Touyz and
Joanna M. Wardlaw},
editor = {Bartlomiej W. Papiez and
Mohammad Yaqub and
Jianbo Jiao and
Ana I. L. Namburete and
J. Alison Noble},
title = {Selective Motion Artefact Reduction via Radiomics and k-space Reconstruction
for Improving Perivascular Space Quantification in Brain Magnetic
Resonance Imaging},
booktitle = {Medical Image Understanding and Analysis - 25th Annual Conference,
{MIUA} 2021, Oxford, United Kingdom, July 12-14, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12722},
pages = {151--164},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-80432-9\_12},
doi = {10.1007/978-3-030-80432-9\_12},
timestamp = {Thu, 23 Jun 2022 19:58:26 +0200},
biburl = {https://dblp.org/rec/conf/miua/BernalXHEJCDSTT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/KamarthiKRZP21,
author = {Harshavardhan Kamarthi and
Lingkai Kong and
Alexander Rodr{\'{\i}}guez and
Chao Zhang and
B. Aditya Prakash},
editor = {Marc'Aurelio Ranzato and
Alina Beygelzimer and
Yann N. Dauphin and
Percy Liang and
Jennifer Wortman Vaughan},
title = {When in Doubt: Neural Non-Parametric Uncertainty Quantification for
Epidemic Forecasting},
booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference
on Neural Information Processing Systems 2021, NeurIPS 2021, December
6-14, 2021, virtual},
pages = {19796--19807},
year = {2021},
url = {https://proceedings.neurips.cc/paper/2021/hash/a4a1108bbcc329a70efa93d7bf060914-Abstract.html},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/KamarthiKRZP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/WangAYD21,
author = {Yaqing Wang and
Abulikemu Abuduweili and
Quanming Yao and
Dejing Dou},
editor = {Marc'Aurelio Ranzato and
Alina Beygelzimer and
Yann N. Dauphin and
Percy Liang and
Jennifer Wortman Vaughan},
title = {Property-Aware Relation Networks for Few-Shot Molecular Property Prediction},
booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference
on Neural Information Processing Systems 2021, NeurIPS 2021, December
6-14, 2021, virtual},
pages = {17441--17454},
year = {2021},
url = {https://proceedings.neurips.cc/paper/2021/hash/91bc333f6967019ac47b49ca0f2fa757-Abstract.html},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/WangAYD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pqcrypto/EatonS21,
author = {Edward Eaton and
Douglas Stebila},
editor = {Jung Hee Cheon and
Jean{-}Pierre Tillich},
title = {The "Quantum Annoying" Property of Password-Authenticated Key Exchange
Protocols},
booktitle = {Post-Quantum Cryptography - 12th International Workshop, PQCrypto
2021, Daejeon, South Korea, July 20-22, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12841},
pages = {154--173},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-81293-5\_9},
doi = {10.1007/978-3-030-81293-5\_9},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pqcrypto/EatonS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawAABBBBBBCDD21,
author = {David E. Shaw and
Peter J. Adams and
Asaph Azaria and
Joseph A. Bank and
Brannon Batson and
Alistair Bell and
Michael Bergdorf and
Jhanvi Bhatt and
J. Adam Butts and
Timothy Correia and
Robert M. Dirks and
Ron O. Dror and
Michael P. Eastwood and
Bruce Edwards and
Amos Even and
Peter Feldmann and
Michael Fenn and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Maria Gorlatova and
Brian Greskamp and
J. P. Grossman and
Justin Gullingsrud and
Anissa Harper and
William Hasenplaugh and
Mark Heily and
Benjamin Colin Heshmat and
Jeremy Hunt and
Douglas J. Ierardi and
Lev Iserovich and
Bryan L. Jackson and
Nick P. Johnson and
Mollie M. Kirk and
John L. Klepeis and
Jeffrey S. Kuskin and
Kenneth M. Mackenzie and
Roy J. Mader and
Richard McGowen and
Adam McLaughlin and
Mark A. Moraes and
Mohamed H. Nasr and
Lawrence J. Nociolo and
Lief O'Donnell and
Andrew Parker and
Jon L. Peticolas and
Goran Pocina and
Cristian Predescu and
Terry Quan and
John K. Salmon and
Carl Schwink and
Keun Sup Shim and
Naseer Siddique and
Jochen Spengler and
Tamas Szalay and
Raymond Tabladillo and
Reinhard Tartler and
Andrew G. Taube and
Michael Theobald and
Brian Towles and
William Vick and
Stanley C. Wang and
Michael Wazlowski and
Madeleine J. Weingarten and
John M. Williams and
Kevin A. Yuh},
editor = {Bronis R. de Supinski and
Mary W. Hall and
Todd Gamblin},
title = {Anton 3: twenty microseconds of molecular dynamics simulation before
lunch},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, {SC} 2021, St. Louis, Missouri, USA, November
14-19, 2021},
pages = {1},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3458817.3487397},
doi = {10.1145/3458817.3487397},
timestamp = {Tue, 08 Nov 2022 16:03:02 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShawAABBBBBBCDD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wuwnet/QuanYW21,
author = {Tianqi Quan and
Xinghai Yang and
Jingjing Wang},
title = {{DOA} Estimation of Underwater Acoustic Array Signal Based on Wavelet
Transform with Double Branch Convolutional Neural Network},
booktitle = {WUWNet'21: The 15th International Conference on Underwater Networks
{\&} Systems, Shenzhen, Guangdong, China, November 22 - 24, 2021},
pages = {33:1--33:2},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3491315.3491348},
doi = {10.1145/3491315.3491348},
timestamp = {Sun, 30 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wuwnet/QuanYW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-06030,
author = {Quande Liu and
Cheng Chen and
Jing Qin and
Qi Dou and
Pheng{-}Ann Heng},
title = {FedDG: Federated Domain Generalization on Medical Image Segmentation
via Episodic Learning in Continuous Frequency Space},
journal = {CoRR},
volume = {abs/2103.06030},
year = {2021},
url = {https://arxiv.org/abs/2103.06030},
eprinttype = {arXiv},
eprint = {2103.06030},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-06030.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-11611,
author = {Zhimin He and
Lvzhou Li and
Shenggen Zheng and
Yongyao Li and
Haozhen Situ},
title = {Variational quantum compiling with double Q-learning},
journal = {CoRR},
volume = {abs/2103.11611},
year = {2021},
url = {https://arxiv.org/abs/2103.11611},
eprinttype = {arXiv},
eprint = {2103.11611},
timestamp = {Wed, 24 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-11611.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-06935,
author = {Mauro Mezzini and
Fernando L. Pelayo and
Fernando Cuartero},
title = {Quantum algorithm for doubling the amplitude of the search problem's
solution states},
journal = {CoRR},
volume = {abs/2105.06935},
year = {2021},
url = {https://arxiv.org/abs/2105.06935},
eprinttype = {arXiv},
eprint = {2105.06935},
timestamp = {Tue, 18 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-06935.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-03904,
author = {Harshavardhan Kamarthi and
Lingkai Kong and
Alexander Rodr{\'{\i}}guez and
Chao Zhang and
B. Aditya Prakash},
title = {When in Doubt: Neural Non-Parametric Uncertainty Quantification for
Epidemic Forecasting},
journal = {CoRR},
volume = {abs/2106.03904},
year = {2021},
url = {https://arxiv.org/abs/2106.03904},
eprinttype = {arXiv},
eprint = {2106.03904},
timestamp = {Fri, 11 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-03904.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-08600,
author = {Quande Liu and
Hongzheng Yang and
Qi Dou and
Pheng{-}Ann Heng},
title = {Federated Semi-supervised Medical Image Classification via Inter-client
Relation Matching},
journal = {CoRR},
volume = {abs/2106.08600},
year = {2021},
url = {https://arxiv.org/abs/2106.08600},
eprinttype = {arXiv},
eprint = {2106.08600},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-08600.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-10399,
author = {Anna Fedyukova and
Douglas Pires and
Daniel Capurro},
title = {Quantifying machine learning-induced overdiagnosis in sepsis},
journal = {CoRR},
volume = {abs/2107.10399},
year = {2021},
url = {https://arxiv.org/abs/2107.10399},
eprinttype = {arXiv},
eprint = {2107.10399},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-10399.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-12642,
author = {Ning Huyan and
Dou Quan and
Xiangrong Zhang and
Xuefeng Liang and
Jocelyn Chanussot and
Licheng Jiao},
title = {Unsupervised Outlier Detection using Memory and Contrastive Learning},
journal = {CoRR},
volume = {abs/2107.12642},
year = {2021},
url = {https://arxiv.org/abs/2107.12642},
eprinttype = {arXiv},
eprint = {2107.12642},
timestamp = {Fri, 30 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-12642.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-08129,
author = {George Deligiannidis and
Valentin De Bortoli and
Arnaud Doucet},
title = {Quantitative Uniform Stability of the Iterative Proportional Fitting
Procedure},
journal = {CoRR},
volume = {abs/2108.08129},
year = {2021},
url = {https://arxiv.org/abs/2108.08129},
eprinttype = {arXiv},
eprint = {2108.08129},
timestamp = {Mon, 23 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-08129.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-13527,
author = {Tiago Mendon{\c{c}}a Lucena de Veras and
Leon D. da Silva and
Adenilton J. da Silva},
title = {Double sparse quantum state preparation},
journal = {CoRR},
volume = {abs/2108.13527},
year = {2021},
url = {https://arxiv.org/abs/2108.13527},
eprinttype = {arXiv},
eprint = {2108.13527},
timestamp = {Fri, 03 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-13527.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-09735,
author = {Cheng Chen and
Quande Liu and
Yueming Jin and
Qi Dou and
Pheng{-}Ann Heng},
title = {Source-Free Domain Adaptive Fundus Image Segmentation with Denoised
Pseudo-Labeling},
journal = {CoRR},
volume = {abs/2109.09735},
year = {2021},
url = {https://arxiv.org/abs/2109.09735},
eprinttype = {arXiv},
eprint = {2109.09735},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-09735.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-07239,
author = {Michiya Kuramata and
Ryota Katsuki and
Kazuhide Nakata},
title = {Solving Large Break Minimization Problems in a Mirrored Double Round-robin
Tournament Using Quantum Annealing},
journal = {CoRR},
volume = {abs/2110.07239},
year = {2021},
url = {https://arxiv.org/abs/2110.07239},
eprinttype = {arXiv},
eprint = {2110.07239},
timestamp = {Mon, 25 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-07239.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-00180,
author = {Yaqing Wang and
Song Wang and
Quanming Yao and
Dejing Dou},
title = {Hierarchical Heterogeneous Graph Representation Learning for Short
Text Classification},
journal = {CoRR},
volume = {abs/2111.00180},
year = {2021},
url = {https://arxiv.org/abs/2111.00180},
eprinttype = {arXiv},
eprint = {2111.00180},
timestamp = {Fri, 05 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-00180.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-00465,
author = {Robert H{\"{o}}nig and
Yiren Zhao and
Robert D. Mullins},
title = {DAdaQuant: Doubly-adaptive quantization for communication-efficient
Federated Learning},
journal = {CoRR},
volume = {abs/2111.00465},
year = {2021},
url = {https://arxiv.org/abs/2111.00465},
eprinttype = {arXiv},
eprint = {2111.00465},
timestamp = {Fri, 05 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-00465.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-10074,
author = {Raghav Mehta and
Angelos Filos and
Ujjwal Baid and
Chiharu Sako and
Richard McKinley and
Michael Rebsamen and
Katrin D{\"{a}}twyler and
Raphael Meier and
Piotr Radojewski and
Gowtham Krishnan Murugesan and
Sahil S. Nalawade and
Chandan Ganesh and
Benjamin C. Wagner and
Fang F. Yu and
Baowei Fei and
Ananth J. Madhuranthakam and
Joseph A. Maldjian and
Laura Alexandra Daza and
Catalina G{\'{o}}mez Caballero and
Pablo Arbel{\'{a}}ez and
Chengliang Dai and
Shuo Wang and
Hadrien Raynaud and
Yuanhan Mo and
Elsa D. Angelini and
Yike Guo and
Wenjia Bai and
Subhashis Banerjee and
Linmin Pei and
Murat Ak and
Sarahi Rosas{-}Gonz{\'{a}}lez and
Ilyess Zemmoura and
Clovis Tauber and
Minh H. Vu and
Tufve Nyholm and
Tommy L{\"{o}}fstedt and
Laura Mora Ballestar and
Ver{\'{o}}nica Vilaplana and
Hugh McHugh and
Gonzalo D. Maso Talou and
Alan Wang and
Jay B. Patel and
Ken Chang and
Katharina Hoebel and
Mishka Gidwani and
Nishanth Thumbavanam Arun and
Sharut Gupta and
Mehak Aggarwal and
Praveer Singh and
Elizabeth R. Gerstner and
Jayashree Kalpathy{-}Cramer and
Nicolas Boutry and
Alexis Huard and
Lasitha Vidyaratne and
Md Monibor Rahman and
Khan M. Iftekharuddin and
Joseph Chazalon and
{\'{E}}lodie Puybareau and
Guillaume Tochon and
Jun Ma and
Mariano Cabezas and
Xavier Llad{\'{o}} and
Arnau Oliver and
Liliana Valencia and
Sergi Valverde and
Mehdi Amian and
Mohammadreza Soltaninejad and
Andriy Myronenko and
Ali Hatamizadeh and
Xue Feng and
Quan Dou and
Nicholas J. Tustison and
Craig H. Meyer and
Nisarg A. Shah and
Sanjay N. Talbar and
Marc{-}Andr{\'{e}} Weber and
Abhishek Mahajan and
Andr{\'{a}}s Jakab and
Roland Wiest and
Hassan M. Fathallah{-}Shaykh and
Arash Nazeri and
Mikhail Milchenko and
Daniel S. Marcus and
Aikaterini Kotrotsou and
Rivka Colen and
John B. Freymann and
Justin S. Kirby and
Christos Davatzikos and
Bjoern H. Menze and
Spyridon Bakas and
Yarin Gal and
Tal Arbel},
title = {QU-BraTS: {MICCAI} BraTS 2020 Challenge on Quantifying Uncertainty
in Brain Tumor Segmentation - Analysis of Ranking Metrics and Benchmarking
Results},
journal = {CoRR},
volume = {abs/2112.10074},
year = {2021},
url = {https://arxiv.org/abs/2112.10074},
eprinttype = {arXiv},
eprint = {2112.10074},
timestamp = {Wed, 28 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-10074.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BrendelFGJS21,
author = {Jacqueline Brendel and
Rune Fiedler and
Felix G{\"{u}}nther and
Christian Janson and
Douglas Stebila},
title = {Post-quantum Asynchronous Deniable Key Exchange and the Signal Handshake},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {769},
year = {2021},
url = {https://eprint.iacr.org/2021/769},
timestamp = {Wed, 07 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BrendelFGJS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/EatonS21,
author = {Edward Eaton and
Douglas Stebila},
title = {The "quantum annoying" property of password-authenticated key exchange
protocols},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {696},
year = {2021},
url = {https://eprint.iacr.org/2021/696},
timestamp = {Mon, 07 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/EatonS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/EatonSS21,
author = {Edward Eaton and
Douglas Stebila and
Roy Stracovsky},
title = {Post-Quantum Key-Blinding for Authentication in Anonymity Networks},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {963},
year = {2021},
url = {https://eprint.iacr.org/2021/963},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/EatonSS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/SchwabeSW21,
author = {Peter Schwabe and
Douglas Stebila and
Thom Wiggers},
title = {More efficient post-quantum {KEMTLS} with pre-distributed public keys},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {779},
year = {2021},
url = {https://eprint.iacr.org/2021/779},
timestamp = {Wed, 07 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/SchwabeSW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HuangZYRYHZ20,
author = {Donghai Huang and
Yongli Zhao and
Tiancheng Yang and
Sabidur Rahman and
Xiaosong Yu and
Xinyi He and
Jie Zhang},
title = {Quantum Key Distribution Over Double-Layer Quantum Satellite Networks},
journal = {{IEEE} Access},
volume = {8},
pages = {16087--16098},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.2966683},
doi = {10.1109/ACCESS.2020.2966683},
timestamp = {Fri, 07 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/HuangZYRYHZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SuoGPYH20,
author = {Jingwen Suo and
Lize Gu and
Yun Pan and
Sijia Yang and
Xiaoya Hu},
title = {Quantum Inspired Genetic Algorithm for Double Digest Problem},
journal = {{IEEE} Access},
volume = {8},
pages = {72910--72916},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.2988117},
doi = {10.1109/ACCESS.2020.2988117},
timestamp = {Wed, 23 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SuoGPYH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/YinZYCLYLZ20,
author = {Luqiao Yin and
Doudou Zhang and
Yuxian Yan and
Fan Cao and
Gongli Lin and
Xuyong Yang and
Wanwan Li and
Jianhua Zhang},
title = {Applying InP/ZnS Green-Emitting Quantum Dots and InP/ZnSe/ZnS Red-Emitting
Quantum Dots to Prepare {WLED} With Enhanced Photoluminescence Performances},
journal = {{IEEE} Access},
volume = {8},
pages = {154683--154690},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3015212},
doi = {10.1109/ACCESS.2020.3015212},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/YinZYCLYLZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biosystems/RashkovskiyK20,
author = {Sergey Rashkovskiy and
Andrei Yu. Khrennikov},
title = {Psychological 'double-slit experiment' in decision making: Quantum
versus classical},
journal = {Biosyst.},
volume = {195},
pages = {104171},
year = {2020},
url = {https://doi.org/10.1016/j.biosystems.2020.104171},
doi = {10.1016/J.BIOSYSTEMS.2020.104171},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/biosystems/RashkovskiyK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcmi/DouZSLLGZLSZWF20,
author = {Wanchen Dou and
Lei Zhao and
Changbao Su and
Qiang Lu and
Qi Liu and
Jinzhu Guo and
Yuming Zhao and
Yishan Luo and
Lin Shi and
Yiwei Zhang and
Renzhi Wang and
Feng Feng},
title = {A quantitative {MRI} index for assessing the severity of hippocampal
sclerosis in temporal lobe epilepsy},
journal = {{BMC} Medical Imaging},
volume = {20},
number = {1},
pages = {42},
year = {2020},
url = {https://doi.org/10.1186/s12880-020-00440-z},
doi = {10.1186/S12880-020-00440-Z},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcmi/DouZSLLGZLSZWF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cam/GrottiMBAG20,
author = {Ewerton Grotti and
Douglas Makoto Mizushima and
Artur Dieguez Backes and
Marcos Daniel de Freitas Awruch and
Herbert Martins Gomes},
title = {A novel multi-objective quantum particle swarm algorithm for suspension
optimization},
journal = {Comput. Appl. Math.},
volume = {39},
number = {2},
year = {2020},
url = {https://doi.org/10.1007/s40314-020-1131-y},
doi = {10.1007/S40314-020-1131-Y},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cam/GrottiMBAG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cryptography/MazzarellaLLJGM20,
author = {Luca Mazzarella and
Christopher John Lowe and
David Lowndes and
Siddarth Koduru Joshi and
Steve Greenland and
Doug McNeil and
Cassandra Mercury and
Malcolm Macdonald and
John G. Rarity and
Daniel Kuan Li Oi},
title = {{QUARC:} Quantum Research Cubesat - {A} Constellation for Quantum
Communication},
journal = {Cryptogr.},
volume = {4},
number = {1},
pages = {7},
year = {2020},
url = {https://doi.org/10.3390/cryptography4010007},
doi = {10.3390/CRYPTOGRAPHY4010007},
timestamp = {Fri, 20 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cryptography/MazzarellaLLJGM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejwcn/ChenHZL20,
author = {Suxia Chen and
Quanzheng Huang and
Yang Zhang and
Xin Li},
title = {Double sink energy hole avoidance strategy for wireless sensor network},
journal = {{EURASIP} J. Wirel. Commun. Netw.},
volume = {2020},
number = {1},
pages = {226},
year = {2020},
url = {https://doi.org/10.1186/s13638-020-01837-8},
doi = {10.1186/S13638-020-01837-8},
timestamp = {Sat, 14 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejwcn/ChenHZL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/UllahH20a,
author = {Rahmat Ullah and
Byoung S. Ham},
title = {Analysis of Controlled Rabi Flopping in a Double Rephasing Photon
Echo Scheme for Quantum Memories},
journal = {Entropy},
volume = {22},
number = {9},
pages = {1007},
year = {2020},
url = {https://doi.org/10.3390/e22091007},
doi = {10.3390/E22091007},
timestamp = {Thu, 28 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/UllahH20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ficn/AnTWJPWYL20,
author = {Lingling An and
Yuanhong Tang and
Doudou Wang and
Shanshan Jia and
Qingqi Pei and
Quan Wang and
Zhaofei Yu and
Jian K. Liu},
title = {Intrinsic and Synaptic Properties Shaping Diverse Behaviors of Neural
Dynamics},
journal = {Frontiers Comput. Neurosci.},
volume = {14},
pages = {26},
year = {2020},
url = {https://doi.org/10.3389/fncom.2020.00026},
doi = {10.3389/FNCOM.2020.00026},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ficn/AnTWJPWYL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/LiXXZF20,
author = {Wentao Li and
Xiaoping Xue and
Weihua Xu and
Tao Zhan and
Bingjiao Fan},
title = {Double-quantitative variable consistency dominance-based rough set
approach},
journal = {Int. J. Approx. Reason.},
volume = {124},
pages = {1--26},
year = {2020},
url = {https://doi.org/10.1016/j.ijar.2020.05.002},
doi = {10.1016/J.IJAR.2020.05.002},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijar/LiXXZF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/WangGSD20,
author = {Qianqian Wang and
Quanxue Gao and
Gan Sun and
Chris Ding},
title = {Double robust principal component analysis},
journal = {Neurocomputing},
volume = {391},
pages = {119--128},
year = {2020},
url = {https://doi.org/10.1016/j.neucom.2020.01.097},
doi = {10.1016/J.NEUCOM.2020.01.097},
timestamp = {Mon, 19 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/WangGSD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/LiYMJZ20,
author = {Quanyi Li and
Haipeng Yao and
Tianle Mai and
Chunxiao Jiang and
Yan Zhang},
title = {Reinforcement-Learning- and Belief-Learning-Based Double Auction Mechanism
for Edge Computing Resource Allocation},
journal = {{IEEE} Internet Things J.},
volume = {7},
number = {7},
pages = {5976--5985},
year = {2020},
url = {https://doi.org/10.1109/JIOT.2019.2953108},
doi = {10.1109/JIOT.2019.2953108},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/LiYMJZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jat/KritzerPPW20,
author = {Peter Kritzer and
Friedrich Pillichshammer and
Leszek Plaskota and
Grzegorz W. Wasilkowski},
title = {On alternative quantization for doubly weighted approximation and
integration over unbounded domains},
journal = {J. Approx. Theory},
volume = {256},
pages = {105433},
year = {2020},
url = {https://doi.org/10.1016/j.jat.2020.105433},
doi = {10.1016/J.JAT.2020.105433},
timestamp = {Fri, 26 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jat/KritzerPPW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcam/WangYD20,
author = {Zeng{-}Qi Wang and
Jun{-}Feng Yin and
Quan{-}Yu Dou},
title = {Preconditioned modified Hermitian and skew-Hermitian splitting iteration
methods for fractional nonlinear Schr{\"{o}}dinger equations},
journal = {J. Comput. Appl. Math.},
volume = {367},
year = {2020},
url = {https://doi.org/10.1016/j.cam.2019.112420},
doi = {10.1016/J.CAM.2019.112420},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcam/WangYD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossac/LiLL20,
author = {Hanfang Li and
Yuan Liu and
Youxi Luo},
title = {Double Penalized Quantile Regression for the Linear Mixed Effects
Model},
journal = {J. Syst. Sci. Complex.},
volume = {33},
number = {6},
pages = {2080--2102},
year = {2020},
url = {https://doi.org/10.1007/s11424-020-9065-4},
doi = {10.1007/S11424-020-9065-4},
timestamp = {Mon, 11 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jossac/LiLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/LueckBD20,
author = {Stefanie Lueck and
Ulrike Beukert and
Dimitar Douchkov},
title = {BluVision Macro - a software for automated powdery mildew and rust
disease quantification on detached leaves},
journal = {J. Open Source Softw.},
volume = {5},
number = {51},
pages = {2259},
year = {2020},
url = {https://doi.org/10.21105/joss.02259},
doi = {10.21105/JOSS.02259},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jossw/LueckBD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/GuoTHLCXS20,
author = {Yanting Guo and
Eric C. C. Tsang and
Meng Hu and
Xuxin Lin and
Degang Chen and
Weihua Xu and
Binbin Sang},
title = {Incremental updating approximations for double-quantitative decision-theoretic
rough sets with the variation of objects},
journal = {Knowl. Based Syst.},
volume = {189},
year = {2020},
url = {https://doi.org/10.1016/j.knosys.2019.105082},
doi = {10.1016/J.KNOSYS.2019.105082},
timestamp = {Mon, 06 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/GuoTHLCXS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlc/HuSC20,
author = {Xiaoyuan Hu and
Bingzhen Sun and
Xiangtang Chen},
title = {Double quantitative fuzzy rough set-based improved {AHP} method and
application to supplier selection decision making},
journal = {Int. J. Mach. Learn. Cybern.},
volume = {11},
number = {1},
pages = {153--167},
year = {2020},
url = {https://doi.org/10.1007/s13042-019-00964-z},
doi = {10.1007/S13042-019-00964-Z},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mlc/HuSC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/WangRM20,
author = {Ling Wang and
Qiwen Ran and
Jing Ma},
title = {Double quantum color images encryption scheme based on {DQRCI}},
journal = {Multim. Tools Appl.},
volume = {79},
number = {9-10},
pages = {6661--6687},
year = {2020},
url = {https://doi.org/10.1007/s11042-019-08514-z},
doi = {10.1007/S11042-019-08514-Z},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/WangRM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/osn/SasithongQSVHW20,
author = {Pruk Sasithong and
Le Quang Quynh and
Poompat Saengudomlert and
Pisit Vanichchanunt and
Nguyen Hoang Hai and
Lunchakorn Wuttisittikulkij},
title = {Maximizing double-link failure recovery of over-dimensioned optical
mesh networks},
journal = {Opt. Switch. Netw.},
volume = {36},
pages = {100541},
year = {2020},
url = {https://doi.org/10.1016/j.osn.2019.100541},
doi = {10.1016/J.OSN.2019.100541},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/osn/SasithongQSVHW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/CorcolesKJMCTNS20,
author = {Antonio D. C{\'{o}}rcoles and
Abhinav Kandala and
Ali Javadi{-}Abhari and
Douglas T. McClure and
Andrew W. Cross and
Kristan Temme and
Paul D. Nation and
Matthias Steffen and
Jay M. Gambetta},
title = {Challenges and Opportunities of Near-Term Quantum Computing Systems},
journal = {Proc. {IEEE}},
volume = {108},
number = {8},
pages = {1338--1352},
year = {2020},
url = {https://doi.org/10.1109/JPROC.2019.2954005},
doi = {10.1109/JPROC.2019.2954005},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/CorcolesKJMCTNS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/DouXCNYY20,
author = {Zhao Dou and
Gang Xu and
Xiu{-}Bo Chen and
Xinxin Niu and
Yi{-}Xian Yang and
Yu Yang},
title = {Searching for optimal quantum secret sharing scheme based on local
distinguishability},
journal = {Quantum Inf. Process.},
volume = {19},
number = {10},
pages = {368},
year = {2020},
url = {https://doi.org/10.1007/s11128-020-02809-z},
doi = {10.1007/S11128-020-02809-Z},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/DouXCNYY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/HuangZLXX20,
author = {Jin{-}Song Huang and
Ji{-}Tai Zhong and
Yan{-}Ling Li and
Zhonghui Xu and
Qing{-}Sheng Xiao},
title = {Efficient single-photon routing in a double-waveguide system with
a mirror},
journal = {Quantum Inf. Process.},
volume = {19},
number = {9},
pages = {290},
year = {2020},
url = {https://doi.org/10.1007/s11128-020-02789-0},
doi = {10.1007/S11128-020-02789-0},
timestamp = {Sat, 19 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/HuangZLXX20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SunZ20,
author = {Shiya Sun and
Huisheng Zhang},
title = {Quantum double-direction cyclic controlled communication via a thirteen-qubit
entangled state},
journal = {Quantum Inf. Process.},
volume = {19},
number = {4},
pages = {120},
year = {2020},
url = {https://doi.org/10.1007/s11128-020-2619-5},
doi = {10.1007/S11128-020-2619-5},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/SunZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/Yang20,
author = {Chun{-}Wei Yang},
title = {Efficient and secure semi-quantum secure direct communication protocol
against double {CNOT} attack},
journal = {Quantum Inf. Process.},
volume = {19},
number = {2},
pages = {50},
year = {2020},
url = {https://doi.org/10.1007/s11128-019-2550-9},
doi = {10.1007/S11128-019-2550-9},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/Yang20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/quantum/CuiDHPRRS20,
author = {Shawn X. Cui and
Dawei Ding and
Xizhi Han and
Geoffrey Penington and
Daniel Ranard and
Brandon C. Rayhaun and
Zhou Shangnan},
title = {Kitaev's quantum double model as an error correcting code},
journal = {Quantum},
volume = {4},
pages = {331},
year = {2020},
url = {https://doi.org/10.22331/q-2020-09-24-331},
doi = {10.22331/Q-2020-09-24-331},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/quantum/CuiDHPRRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/GhirriCA20,
author = {Alberto Ghirri and
Samuele Cornia and
Marco Affronte},
title = {Microwave Photon Detectors Based on Semiconducting Double Quantum
Dots},
journal = {Sensors},
volume = {20},
number = {14},
pages = {4010},
year = {2020},
url = {https://doi.org/10.3390/s20144010},
doi = {10.3390/S20144010},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/GhirriCA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LiHHGW20,
author = {Chuangze Li and
Benguang Han and
Jie He and
Zhongjie Guo and
Longsheng Wu},
title = {A Highly Linear {CMOS} Image Sensor Design Based on an Adaptive Nonlinear
Ramp Generator and Fully Differential Pipeline Sampling Quantization
with a Double Auto-Zeroing Technique},
journal = {Sensors},
volume = {20},
number = {4},
pages = {1046},
year = {2020},
url = {https://doi.org/10.3390/s20041046},
doi = {10.3390/S20041046},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LiHHGW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/YaoWQZ20,
author = {Heng Yao and
Hongbin Wei and
Chuan Qin and
Xinpeng Zhang},
title = {An improved first quantization matrix estimation for nonaligned double
compressed {JPEG} images},
journal = {Signal Process.},
volume = {170},
pages = {107430},
year = {2020},
url = {https://doi.org/10.1016/j.sigpro.2019.107430},
doi = {10.1016/J.SIGPRO.2019.107430},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/YaoWQZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sj/PereiraDPVCH20,
author = {Cristiane Salgado Pereira and
Douglas Mota Dias and
Marco Aur{\'{e}}lio Cavalcanti Pacheco and
Marley M. B. R. Vellasco and
Andr{\'{e}} Vargas Abs da Cruz and
Estefane Horn Hollmann},
title = {Quantum-Inspired Genetic Programming Algorithm for the Crude Oil Scheduling
of a Real-World Refinery},
journal = {{IEEE} Syst. J.},
volume = {14},
number = {3},
pages = {3926--3937},
year = {2020},
url = {https://doi.org/10.1109/JSYST.2020.2968039},
doi = {10.1109/JSYST.2020.2968039},
timestamp = {Sat, 19 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sj/PereiraDPVCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/LiuDWDYL20,
author = {Tianliang Liu and
Xiaodong Dong and
Yanzhang Wang and
Xiubin Dai and
Quanzeng You and
Jiebo Luo},
title = {Double-layer conditional random fields model for human action recognition},
journal = {Signal Process. Image Commun.},
volume = {80},
year = {2020},
url = {https://doi.org/10.1016/j.image.2019.115672},
doi = {10.1016/J.IMAGE.2019.115672},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spic/LiuDWDYL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/NiuTZB20,
author = {Yakun Niu and
Benedetta Tondi and
Yao Zhao and
Mauro Barni},
title = {Primary Quantization Matrix Estimation of Double Compressed {JPEG}
Images via {CNN}},
journal = {{IEEE} Signal Process. Lett.},
volume = {27},
pages = {191--195},
year = {2020},
url = {https://doi.org/10.1109/LSP.2019.2962997},
doi = {10.1109/LSP.2019.2962997},
timestamp = {Tue, 03 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spl/NiuTZB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/Mandal20,
author = {Ipsita Mandal},
title = {Effect of Interactions on the Quantization of the Chiral Photocurrent
for Double-Weyl Semimetals},
journal = {Symmetry},
volume = {12},
number = {6},
pages = {919},
year = {2020},
url = {https://doi.org/10.3390/sym12060919},
doi = {10.3390/SYM12060919},
timestamp = {Fri, 14 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/Mandal20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/XueZLZS20,
author = {Zhanao Xue and
Min Zhang and
Yongxiang Li and
Liping Zhao and
Bing{-}xin Sun},
title = {Double-Quantitative Generalized Multi-Granulation Set-Pair Dominance
Rough Sets in Incomplete Ordered Information System},
journal = {Symmetry},
volume = {12},
number = {1},
pages = {133},
year = {2020},
url = {https://doi.org/10.3390/sym12010133},
doi = {10.3390/SYM12010133},
timestamp = {Tue, 09 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/symmetry/XueZLZS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tase/DouerM20,
author = {Nir Douer and
Joachim Meyer},
title = {The Responsibility Quantification Model of Human Interaction With
Automation},
journal = {{IEEE} Trans Autom. Sci. Eng.},
volume = {17},
number = {2},
pages = {1044--1060},
year = {2020},
url = {https://doi.org/10.1109/TASE.2020.2965466},
doi = {10.1109/TASE.2020.2965466},
timestamp = {Fri, 11 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tase/DouerM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/WangWLLSJ20,
author = {Jinwei Wang and
Hao Wang and
Jian Li and
Xiangyang Luo and
Yun{-}Qing Shi and
Sunil Kr. Jha},
title = {Detecting Double {JPEG} Compressed Color Images With the Same Quantization
Matrix in Spherical Coordinates},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {30},
number = {8},
pages = {2736--2749},
year = {2020},
url = {https://doi.org/10.1109/TCSVT.2019.2922309},
doi = {10.1109/TCSVT.2019.2922309},
timestamp = {Tue, 12 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcsv/WangWLLSJ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/WangLD20,
author = {Zhao Wang and
Quande Liu and
Qi Dou},
title = {Contrastive Cross-Site Learning With Redesigned Net for {COVID-19}
{CT} Classification},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {24},
number = {10},
pages = {2806--2813},
year = {2020},
url = {https://doi.org/10.1109/JBHI.2020.3023246},
doi = {10.1109/JBHI.2020.3023246},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/titb/WangLD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tits/TamaniBLG20,
author = {Nouredine Tamani and
Bouziane Brik and
Nasreddine Lagraa and
Yacine Ghamri{-}Doudane},
title = {On Link Stability Metric and Fuzzy Quantification for Service Selection
in Mobile Vehicular Cloud},
journal = {{IEEE} Trans. Intell. Transp. Syst.},
volume = {21},
number = {5},
pages = {2050--2062},
year = {2020},
url = {https://doi.org/10.1109/TITS.2019.2911860},
doi = {10.1109/TITS.2019.2911860},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tits/TamaniBLG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/DouLHG20,
author = {Qi Dou and
Quande Liu and
Pheng{-}Ann Heng and
Ben Glocker},
title = {Unpaired Multi-Modal Segmentation via Knowledge Distillation},
journal = {{IEEE} Trans. Medical Imaging},
volume = {39},
number = {7},
pages = {2415--2425},
year = {2020},
url = {https://doi.org/10.1109/TMI.2019.2963882},
doi = {10.1109/TMI.2019.2963882},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/DouLHG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/LiuDYH20,
author = {Quande Liu and
Qi Dou and
Lequan Yu and
Pheng{-}Ann Heng},
title = {MS-Net: Multi-Site Network for Improving Prostate Segmentation With
Heterogeneous {MRI} Data},
journal = {{IEEE} Trans. Medical Imaging},
volume = {39},
number = {9},
pages = {2713--2724},
year = {2020},
url = {https://doi.org/10.1109/TMI.2020.2974574},
doi = {10.1109/TMI.2020.2974574},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmi/LiuDYH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/LiuYLDH20,
author = {Quande Liu and
Lequan Yu and
Luyang Luo and
Qi Dou and
Pheng{-}Ann Heng},
title = {Semi-Supervised Medical Image Classification With Relation-Driven
Self-Ensembling Model},
journal = {{IEEE} Trans. Medical Imaging},
volume = {39},
number = {11},
pages = {3429--3440},
year = {2020},
url = {https://doi.org/10.1109/TMI.2020.2995518},
doi = {10.1109/TMI.2020.2995518},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmi/LiuYLDH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEpact/DouL20,
author = {Xinglei Dou and
Lei Liu},
editor = {Vivek Sarkar and
Hyesoon Kim},
title = {A New Qubits Mapping Mechanism for Multi-programming Quantum Computing},
booktitle = {{PACT} '20: International Conference on Parallel Architectures and
Compilation Techniques, Virtual Event, GA, USA, October 3-7, 2020},
pages = {349--350},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3410463.3414659},
doi = {10.1145/3410463.3414659},
timestamp = {Sun, 23 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/IEEEpact/DouL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccs/SchwabeSW20,
author = {Peter Schwabe and
Douglas Stebila and
Thom Wiggers},
editor = {Jay Ligatti and
Xinming Ou and
Jonathan Katz and
Giovanni Vigna},
title = {Post-Quantum {TLS} Without Handshake Signatures},
booktitle = {{CCS} '20: 2020 {ACM} {SIGSAC} Conference on Computer and Communications
Security, Virtual Event, USA, November 9-13, 2020},
pages = {1461--1480},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3372297.3423350},
doi = {10.1145/3372297.3423350},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccs/SchwabeSW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csae/ZhangJXLQYL20,
author = {Nan Zhang and
Hao Jiang and
Chunbao Xu and
Xuemei Liu and
Zekun Quan and
Yinfa Yan and
Shuangxi Liu},
editor = {Ali Emrouznejad and
Jui{-}Sheng Rayson Chou},
title = {Research on {BLDCM} Double Loop {PWM} Control Based on Positionless
Sensor},
booktitle = {{CSAE} 2020: The 4th International Conference on Computer Science
and Application Engineering, Sanya, China, October 20-22, 2020},
pages = {86:1--86:5},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3424978.3425065},
doi = {10.1145/3424978.3425065},
timestamp = {Tue, 27 Oct 2020 18:19:37 +0100},
biburl = {https://dblp.org/rec/conf/csae/ZhangJXLQYL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/TranCPPF20,
author = {Minh C. Tran and
Douglas C. Crockett and
Phi Anh Phan and
Stephen J. Payne and
Andrew Farmery},
title = {A tidal lung simulation to quantify lung heterogeneity with the Inspired
Sinewave Test},
booktitle = {42nd Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2020, Montreal, QC, Canada,
July 20-24, 2020},
pages = {2438--2441},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/EMBC44109.2020.9176375},
doi = {10.1109/EMBC44109.2020.9176375},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/TranCPPF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/VeysehNDTDN20,
author = {Amir Pouran Ben Veyseh and
Nasim Nouri and
Franck Dernoncourt and
Quan Hung Tran and
Dejing Dou and
Thien Huu Nguyen},
editor = {Trevor Cohn and
Yulan He and
Yang Liu},
title = {Improving Aspect-based Sentiment Analysis with Gated Graph Convolutional
Networks and Syntax-based Regulation},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2020, Online Event, 16-20 November 2020},
series = {Findings of {ACL}},
volume = {{EMNLP} 2020},
pages = {4543--4548},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.findings-emnlp.407},
doi = {10.18653/V1/2020.FINDINGS-EMNLP.407},
timestamp = {Tue, 20 Aug 2024 07:54:42 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/VeysehNDTDN20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/BrownBT20,
author = {Katherine E. Brown and
Farzana Ahamed Bhuiyan and
Douglas A. Talbert},
editor = {Roman Bart{\'{a}}k and
Eric Bell},
title = {Uncertainty Quantification in Multimodal Ensembles of Deep Learners},
booktitle = {Proceedings of the Thirty-Third International Florida Artificial Intelligence
Research Society Conference, Originally to be held in North Miami
Beach, Florida, USA, May 17-20, 2020},
pages = {422--427},
publisher = {{AAAI} Press},
year = {2020},
url = {https://aaai.org/ocs/index.php/FLAIRS/FLAIRS20/paper/view/18474},
timestamp = {Wed, 26 Oct 2022 08:35:06 +0200},
biburl = {https://dblp.org/rec/conf/flairs/BrownBT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcc/WeiL0ZZY20,
author = {Xiaojuan Wei and
Jinglin Li and
Quan Yuan and
Zhe Zhang and
Yangyang Zha and
Fangchun Yang},
title = {Enabling Self-defined Navigation on Road Graph via Double Rewarded
Generalized {VIN}},
booktitle = {22nd {IEEE} International Conference on High Performance Computing
and Communications; 18th {IEEE} International Conference on Smart
City; 6th {IEEE} International Conference on Data Science and Systems,
HPCC/SmartCity/DSS 2020, Yanuca Island, Cuvu, Fiji, December 14-16,
2020},
pages = {985--990},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/HPCC-SmartCity-DSS50907.2020.00132},
doi = {10.1109/HPCC-SMARTCITY-DSS50907.2020.00132},
timestamp = {Wed, 05 May 2021 11:23:31 +0200},
biburl = {https://dblp.org/rec/conf/hpcc/WeiL0ZZY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/JianLVBS20,
author = {Yubing Jian and
Yuchen Liu and
Shyam Krishnan Venkateswaran and
Douglas M. Blough and
Raghupathy Sivakumar},
title = {A Quantitative Exploration of Access Point Mobility for mmWave WiFi
Networks},
booktitle = {2020 {IEEE} International Conference on Communications, {ICC} 2020,
Dublin, Ireland, June 7-11, 2020},
pages = {1--7},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICC40277.2020.9148974},
doi = {10.1109/ICC40277.2020.9148974},
timestamp = {Tue, 22 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icc/JianLVBS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icit/MaDJL20,
author = {Tengfei Ma and
Quansheng Dou and
Ping Jiang and
Huan Liu},
title = {Named entity recognition based on semi-supervised ensemble learning
with the improved tri-training algorithm},
booktitle = {{ICIT} 2020, Proceedings of the 8th International Conference on Information
Technology: IoT and Smart City, Xi'an, China, December 25-27, 2020},
pages = {13--18},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3446999.3447002},
doi = {10.1145/3446999.3447002},
timestamp = {Wed, 21 Apr 2021 11:46:21 +0200},
biburl = {https://dblp.org/rec/conf/icit/MaDJL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/BattiatoGGP20a,
author = {Sebastiano Battiato and
Oliver Giudice and
Francesco Guarnera and
Giovanni Puglisi},
title = {Computational Data Analysis for First Quantization Estimation on {JPEG}
Double Compressed Images},
booktitle = {25th International Conference on Pattern Recognition, {ICPR} 2020,
Virtual Event / Milan, Italy, January 10-15, 2021},
pages = {5951--5958},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICPR48806.2021.9412528},
doi = {10.1109/ICPR48806.2021.9412528},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/BattiatoGGP20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icton/WatsonGGMSKSGYD20,
author = {Scott Watson and
Steffan Gwyn and
Eugenio Di Gaetano and
Euan McBrearty and
Thomas J. Slight and
Martin Knapp and
Szymon Stanczyk and
Szymon Grzanka and
Amit Yadav and
Kevin E. Docherty and
Edik U. Rafailov and
Piotr Perlin and
Steve Najda and
Mike Leszczynski and
Mohsin Haji and
Marc Sorel and
Douglas J. Paul and
Anthony E. Kelly},
title = {Distributed Feedback Lasers for Quantum Cooling Applications},
booktitle = {22nd International Conference on Transparent Optical Networks, {ICTON}
2020, Bari, Italy, July 19-23, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICTON51198.2020.9203200},
doi = {10.1109/ICTON51198.2020.9203200},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icton/WatsonGGMSKSGYD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/Wang0XLXW20,
author = {Doudou Wang and
Xin Hu and
Quan Xue and
Ze Li and
Lexi Xu and
Weidong Wang},
editor = {Jia Hu and
Geyong Min and
Nektarios Georgalas and
Zhiwei Zhao and
Fei Hao and
Wang Miao},
title = {Resource Scheduling Algorithm on Mobile {P2P} Distribution Networks},
booktitle = {{IEEE} International Conference on Parallel {\&} Distributed Processing
with Applications, Big Data {\&} Cloud Computing, Sustainable
Computing {\&} Communications, Social Computing {\&} Networking,
ISPA/BDCloud/SocialCom/SustainCom 2020, Exeter, United Kingdom, December
17-19, 2020},
pages = {666--673},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISPA-BDCloud-SocialCom-SustainCom51426.2020.00109},
doi = {10.1109/ISPA-BDCLOUD-SOCIALCOM-SUSTAINCOM51426.2020.00109},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispa/Wang0XLXW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/GuevelBJFZTVSMJ20,
author = {Lo{\"{\i}}ck Le Guevel and
G{\'{e}}rard Billiot and
Xavier Jehl and
Silvano De Franceschi and
Marcos Zurita and
Yvain Thonnart and
Maud Vinet and
Marc Sanquer and
Romain Maurand and
Aloysius G. M. Jansen and
Ga{\"{e}}l Pillonnet},
title = {19.2 {A} 110mK 295{\(\mathrm{\mu}\)}W 28nm {FDSOI} {CMOS} Quantum
Integrated Circuit with a 2.8GHz Excitation and nA Current Sensing
of an On-Chip Double Quantum Dot},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {306--308},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9063090},
doi = {10.1109/ISSCC19947.2020.9063090},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/GuevelBJFZTVSMJ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/LiYLSCDLGZFLHFC20,
author = {Haoming Li and
Xin Yang and
Jiamin Liang and
Wenlong Shi and
Chaoyu Chen and
Haoran Dou and
Rui Li and
Rui Gao and
Guangquan Zhou and
Jinghui Fang and
Xiaowen Liang and
Ruobing Huang and
Alejandro Frangi and
Zhiyi Chen and
Dong Ni},
editor = {Anne L. Martel and
Purang Abolmaesumi and
Danail Stoyanov and
Diana Mateus and
Maria A. Zuluaga and
S. Kevin Zhou and
Daniel Racoceanu and
Leo Joskowicz},
title = {Contrastive Rendering for Ultrasound Image Segmentation},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2020 - 23rd International Conference, Lima, Peru, October 4-8, 2020,
Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {12263},
pages = {563--572},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-59716-0\_54},
doi = {10.1007/978-3-030-59716-0\_54},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miccai/LiYLSCDLGZFLHFC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/LiuDH20,
author = {Quande Liu and
Qi Dou and
Pheng{-}Ann Heng},
editor = {Anne L. Martel and
Purang Abolmaesumi and
Danail Stoyanov and
Diana Mateus and
Maria A. Zuluaga and
S. Kevin Zhou and
Daniel Racoceanu and
Leo Joskowicz},
title = {Shape-Aware Meta-learning for Generalizing Prostate {MRI} Segmentation
to Unseen Domains},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2020 - 23rd International Conference, Lima, Peru, October 4-8, 2020,
Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12262},
pages = {475--485},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-59713-9\_46},
doi = {10.1007/978-3-030-59713-9\_46},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miccai/LiuDH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miua/BernalHBEJCDSTT20,
author = {Jos{\'{e}} Bernal and
Maria del C. Vald{\'{e}}s Hern{\'{a}}ndez and
Lucia Ballerini and
Javier Escudero and
Angela C. C. Jochems and
Una Clancy and
Fergus N. Doubal and
Michael S. Stringer and
Michael J. Thrippleton and
Rhian M. Touyz and
Joanna M. Wardlaw},
editor = {Bartlomiej W. Papiez and
Ana I. L. Namburete and
Mohammad Yaqub and
J. Alison Noble},
title = {A Framework for Jointly Assessing and Reducing Imaging Artefacts Automatically
Using Texture Analysis and Total Variation Optimisation for Improving
Perivascular Spaces Quantification in Brain Magnetic Resonance Imaging},
booktitle = {Medical Image Understanding and Analysis - 24th Annual Conference,
{MIUA} 2020, Oxford, UK, July 15-17, 2020, Proceedings},
series = {Communications in Computer and Information Science},
volume = {1248},
pages = {171--183},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-52791-4\_14},
doi = {10.1007/978-3-030-52791-4\_14},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miua/BernalHBEJCDSTT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlsp/HarishVK20,
author = {Abhinav Narayan Harish and
Vinay Verma and
Nitin Khanna},
title = {Double {JPEG} Compression Detection for Distinguishable Blocks in
Images Compressed with Same Quantization Matrix},
booktitle = {30th {IEEE} International Workshop on Machine Learning for Signal
Processing, {MLSP} 2020, Espoo, Finland, September 21-24, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/MLSP49062.2020.9231749},
doi = {10.1109/MLSP49062.2020.9231749},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mlsp/HarishVK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/WilliamsRAMDH20,
author = {Will Williams and
Sam Ringer and
Tom Ash and
David MacLeod and
Jamie Dougherty and
John Hughes},
editor = {Hugo Larochelle and
Marc'Aurelio Ranzato and
Raia Hadsell and
Maria{-}Florina Balcan and
Hsuan{-}Tien Lin},
title = {Hierarchical Quantized Autoencoders},
booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference
on Neural Information Processing Systems 2020, NeurIPS 2020, December
6-12, 2020, virtual},
year = {2020},
url = {https://proceedings.neurips.cc/paper/2020/hash/309fee4e541e51de2e41f21bebb342aa-Abstract.html},
timestamp = {Wed, 02 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/WilliamsRAMDH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pqcrypto/PaquinST20,
author = {Christian Paquin and
Douglas Stebila and
Goutam Tamvada},
editor = {Jintai Ding and
Jean{-}Pierre Tillich},
title = {Benchmarking Post-quantum Cryptography in {TLS}},
booktitle = {Post-Quantum Cryptography - 11th International Conference, PQCrypto
2020, Paris, France, April 15-17, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12100},
pages = {72--91},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-44223-1\_5},
doi = {10.1007/978-3-030-44223-1\_5},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pqcrypto/PaquinST20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sacrypt/BrendelFGJS20,
author = {Jacqueline Brendel and
Marc Fischlin and
Felix G{\"{u}}nther and
Christian Janson and
Douglas Stebila},
editor = {Orr Dunkelman and
Michael J. Jacobson Jr. and
Colin O'Flynn},
title = {Towards Post-Quantum Security for Signal's {X3DH} Handshake},
booktitle = {Selected Areas in Cryptography - {SAC} 2020 - 27th International Conference,
Halifax, NS, Canada (Virtual Event), October 21-23, 2020, Revised
Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {12804},
pages = {404--430},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-81652-0\_16},
doi = {10.1007/978-3-030-81652-0\_16},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sacrypt/BrendelFGJS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/springsim/HoodD20,
author = {Joseph M. Hood and
Roger A. Dougal},
editor = {Fernando J. Barros and
Xiaolin Hu and
Hamdi Kavak and
Alberto A. Del Barrio},
title = {A Linear-Implicit Quantized Devs Nethod For Very Stiff Electrical
Networks Using {A} Latency Insertion Method},
booktitle = {Spring Simulation Conference, SpringSim 2020, Fairfax, VA, USA, May
18-21, 2020},
pages = {1--12},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.22360/SpringSim.2020.TMS.003},
doi = {10.22360/SPRINGSIM.2020.TMS.003},
timestamp = {Tue, 22 Sep 2020 11:39:00 +0200},
biburl = {https://dblp.org/rec/conf/springsim/HoodD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tqc/ChabaudDGKM20,
author = {Ulysse Chabaud and
Tom Douce and
Fr{\'{e}}d{\'{e}}ric Grosshans and
Elham Kashefi and
Damian Markham},
editor = {Steven T. Flammia},
title = {Building Trust for Continuous Variable Quantum States},
booktitle = {15th Conference on the Theory of Quantum Computation, Communication
and Cryptography, {TQC} 2020, June 9-12, 2020, Riga, Latvia},
series = {LIPIcs},
volume = {158},
pages = {3:1--3:15},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2020},
url = {https://doi.org/10.4230/LIPIcs.TQC.2020.3},
doi = {10.4230/LIPICS.TQC.2020.3},
timestamp = {Wed, 21 Aug 2024 22:46:00 +0200},
biburl = {https://dblp.org/rec/conf/tqc/ChabaudDGKM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-00946,
author = {Heng{-}Li Liu and
Quan{-}Lin Li and
Yan{-}Xia Chang and
Chi Zhang},
title = {Block-Structured Double-Ended Queues and Bilateral {QBD} Processes},
journal = {CoRR},
volume = {abs/2001.00946},
year = {2020},
url = {http://arxiv.org/abs/2001.00946},
eprinttype = {arXiv},
eprint = {2001.00946},
timestamp = {Mon, 13 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-00946.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-03111,
author = {Qi Dou and
Quande Liu and
Pheng{-}Ann Heng and
Ben Glocker},
title = {Unpaired Multi-modal Segmentation via Knowledge Distillation},
journal = {CoRR},
volume = {abs/2001.03111},
year = {2020},
url = {http://arxiv.org/abs/2001.03111},
eprinttype = {arXiv},
eprint = {2001.03111},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-03111.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-06598,
author = {Poulami Das and
Christopher A. Pattison and
Srilatha Manne and
Douglas M. Carmean and
Krysta M. Svore and
Moinuddin K. Qureshi and
Nicolas Delfosse},
title = {A Scalable Decoder Micro-architecture for Fault-Tolerant Quantum Computing},
journal = {CoRR},
volume = {abs/2001.06598},
year = {2020},
url = {https://arxiv.org/abs/2001.06598},
eprinttype = {arXiv},
eprint = {2001.06598},
timestamp = {Fri, 14 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-06598.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-03366,
author = {Quande Liu and
Qi Dou and
Lequan Yu and
Pheng{-}Ann Heng},
title = {MS-Net: Multi-Site Network for Improving Prostate Segmentation with
Heterogeneous {MRI} Data},
journal = {CoRR},
volume = {abs/2002.03366},
year = {2020},
url = {https://arxiv.org/abs/2002.03366},
eprinttype = {arXiv},
eprint = {2002.03366},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-03366.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-08111,
author = {Will Williams and
Sam Ringer and
Tom Ash and
John Hughes and
David MacLeod and
Jamie Dougherty},
title = {Hierarchical Quantized Autoencoders},
journal = {CoRR},
volume = {abs/2002.08111},
year = {2020},
url = {https://arxiv.org/abs/2002.08111},
eprinttype = {arXiv},
eprint = {2002.08111},
timestamp = {Wed, 02 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-08111.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-09174,
author = {Tianyuan Jin and
Pan Xu and
Xiaokui Xiao and
Quanquan Gu},
title = {Double Explore-then-Commit: Asymptotic Optimality and Beyond},
journal = {CoRR},
volume = {abs/2002.09174},
year = {2020},
url = {https://arxiv.org/abs/2002.09174},
eprinttype = {arXiv},
eprint = {2002.09174},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-09174.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-03870,
author = {Zhiyuan Dong and
Wei Cui and
Guofeng Zhang},
title = {On the dynamics of a quantum coherent feedback network of cavity-mediated
double quantum dot qubits},
journal = {CoRR},
volume = {abs/2004.03870},
year = {2020},
url = {https://arxiv.org/abs/2004.03870},
eprinttype = {arXiv},
eprint = {2004.03870},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-03870.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-12854,
author = {Lei Liu and
Xinglei Dou},
title = {A New Qubits Mapping Mechanism for Multi-programming Quantum Computing},
journal = {CoRR},
volume = {abs/2004.12854},
year = {2020},
url = {https://arxiv.org/abs/2004.12854},
eprinttype = {arXiv},
eprint = {2004.12854},
timestamp = {Wed, 29 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-12854.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-07377,
author = {Quande Liu and
Lequan Yu and
Luyang Luo and
Qi Dou and
Pheng{-}Ann Heng},
title = {Semi-supervised Medical Image Classification with Relation-driven
Self-ensembling Model},
journal = {CoRR},
volume = {abs/2005.07377},
year = {2020},
url = {https://arxiv.org/abs/2005.07377},
eprinttype = {arXiv},
eprint = {2005.07377},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-07377.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-16243,
author = {Katsuaki Tanabe},
title = {Mutual Information in Coupled Double Quantum Dots: {A} Simple Analytic
Model for Potential Artificial Consciousness},
journal = {CoRR},
volume = {abs/2006.16243},
year = {2020},
url = {https://arxiv.org/abs/2006.16243},
eprinttype = {arXiv},
eprint = {2006.16243},
timestamp = {Thu, 02 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-16243.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-02035,
author = {Quande Liu and
Qi Dou and
Pheng{-}Ann Heng},
title = {Shape-aware Meta-learning for Generalizing Prostate {MRI} Segmentation
to Unseen Domains},
journal = {CoRR},
volume = {abs/2007.02035},
year = {2020},
url = {https://arxiv.org/abs/2007.02035},
eprinttype = {arXiv},
eprint = {2007.02035},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-02035.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-07652,
author = {Zhao Wang and
Quande Liu and
Qi Dou},
title = {Contrastive Cross-site Learning with Redesigned Net for {COVID-19}
{CT} Classification},
journal = {CoRR},
volume = {abs/2009.07652},
year = {2020},
url = {https://arxiv.org/abs/2009.07652},
eprinttype = {arXiv},
eprint = {2009.07652},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-07652.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-08186,
author = {Santiago Rodrigo and
Sergi Abadal and
Eduard Alarc{\'{o}}n and
Carmen G. Almud{\'{e}}ver},
title = {Exploring a Double Full-Stack Communications-Enabled Architecture
for Multi-Core Quantum Computers},
journal = {CoRR},
volume = {abs/2009.08186},
year = {2020},
url = {https://arxiv.org/abs/2009.08186},
eprinttype = {arXiv},
eprint = {2009.08186},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-08186.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-04653,
author = {Byung{-}Jun Yoon and
Xiaoning Qian and
Edward R. Dougherty},
title = {Quantifying the multi-objective cost of uncertainty},
journal = {CoRR},
volume = {abs/2010.04653},
year = {2020},
url = {https://arxiv.org/abs/2010.04653},
eprinttype = {arXiv},
eprint = {2010.04653},
timestamp = {Tue, 13 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-04653.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-04928,
author = {Haoming Li and
Xin Yang and
Jiamin Liang and
Wenlong Shi and
Chaoyu Chen and
Haoran Dou and
Rui Li and
Rui Gao and
Guangquan Zhou and
Jinghui Fang and
Xiaowen Liang and
Ruobing Huang and
Alejandro Frangi and
Zhiyi Chen and
Dong Ni},
title = {Contrastive Rendering for Ultrasound Image Segmentation},
journal = {CoRR},
volume = {abs/2010.04928},
year = {2020},
url = {https://arxiv.org/abs/2010.04928},
eprinttype = {arXiv},
eprint = {2010.04928},
timestamp = {Mon, 11 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-04928.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-13389,
author = {Amir Pouran Ben Veyseh and
Nasim Nouri and
Franck Dernoncourt and
Quan Hung Tran and
Dejing Dou and
Thien Huu Nguyen},
title = {Improving Aspect-based Sentiment Analysis with Gated Graph Convolutional
Networks and Syntax-based Regulation},
journal = {CoRR},
volume = {abs/2010.13389},
year = {2020},
url = {https://arxiv.org/abs/2010.13389},
eprinttype = {arXiv},
eprint = {2010.13389},
timestamp = {Tue, 03 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-13389.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-13778,
author = {Clarice D. Aiello and
D. D. Awschalom and
Hannes Bernien and
Tina Brower{-}Thomas and
Kenneth R. Brown and
Todd A. Brun and
Justin R. Caram and
Eric Chitambar and
Rosa Di Felice and
Michael F. J. Fox and
Stephan Haas and
Alexander W. Holleitner and
Eric R. Hudson and
Jeffrey H. Hunt and
Robert Joynt and
Scott Koziol and
H. J. Lewandowski and
Douglas T. McClure and
Jens Palsberg and
Gina Passante and
Kristen L. Pudenz and
Christopher J. K. Richardson and
Jessica L. Rosenberg and
R. S. Ross and
Mark Saffman and
M. Singh and
David W. Steuerman and
Chad Stark and
Jos Thijssen and
A. Nick Vamivakas and
James D. Whitfield and
Benjamin M. Zwickl},
title = {Achieving a quantum smart workforce},
journal = {CoRR},
volume = {abs/2010.13778},
year = {2020},
url = {https://arxiv.org/abs/2010.13778},
eprinttype = {arXiv},
eprint = {2010.13778},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-13778.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-03460,
author = {Wei Cui and
Tong Dou and
Shilu Yan},
title = {Threats and Opportunities: Blockchain Meets Quantum Computation},
journal = {CoRR},
volume = {abs/2011.03460},
year = {2020},
url = {https://arxiv.org/abs/2011.03460},
eprinttype = {arXiv},
eprint = {2011.03460},
timestamp = {Thu, 03 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-03460.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-07202,
author = {Zhiwei Cao and
Hongfei Zhu and
Yuping Zhao and
Dou Li},
title = {Nonuniform Quantized Decoder for Polar Codes with Minimum Distortion
Quantizer},
journal = {CoRR},
volume = {abs/2011.07202},
year = {2020},
url = {https://arxiv.org/abs/2011.07202},
eprinttype = {arXiv},
eprint = {2011.07202},
timestamp = {Wed, 18 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-07202.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-00468,
author = {Benedetta Tondi and
Andrea Costanzo and
Dequ Huang and
Bin Li},
title = {Boosting CNN-based primary quantization matrix estimation of double
{JPEG} images via a classification-like architecture},
journal = {CoRR},
volume = {abs/2012.00468},
year = {2020},
url = {https://arxiv.org/abs/2012.00468},
eprinttype = {arXiv},
eprint = {2012.00468},
timestamp = {Mon, 31 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2012-00468.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/DingEMRW20,
author = {Jintai Ding and
Doug Emery and
Johannes M{\"{u}}ller and
Peter Y. A. Ryan and
Vonn Kee Wong},
title = {Post-Quantum Anonymous Veto Networks},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1023},
year = {2020},
url = {https://eprint.iacr.org/2020/1023},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/DingEMRW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/SchwabeSW20,
author = {Peter Schwabe and
Douglas Stebila and
Thom Wiggers},
title = {Post-quantum {TLS} without handshake signatures},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {534},
year = {2020},
url = {https://eprint.iacr.org/2020/534},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/SchwabeSW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AprilPyoneKK19,
author = {MaungMaung AprilPyone and
Yuma Kinoshita and
Hitoshi Kiya},
title = {Adversarial Robustness by One Bit Double Quantization for Visual Classification},
journal = {{IEEE} Access},
volume = {7},
pages = {177932--177943},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2958358},
doi = {10.1109/ACCESS.2019.2958358},
timestamp = {Wed, 15 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/AprilPyoneKK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/JiangZXL19,
author = {She{-}Xiang Jiang and
Ri{-}Gui Zhou and
Ruiqing Xu and
GaoFeng Luo},
title = {Cyclic Hybrid Double-Channel Quantum Communication via Bell-State
and GHZ-State in Noisy Environments},
journal = {{IEEE} Access},
volume = {7},
pages = {80530--80541},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2923322},
doi = {10.1109/ACCESS.2019.2923322},
timestamp = {Thu, 08 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/JiangZXL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Ocampos-Guillen19,
author = {Alejandro Ocampos{-}Guillen and
Jorge G{\'{o}}mez{-}Garc{\'{\i}}a and
Natalia Denisenko and
Veronica Fernandez},
title = {Double-Loop Wavefront Tilt Correction for Free-Space Quantum Key Distribution},
journal = {{IEEE} Access},
volume = {7},
pages = {114033--114041},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2933694},
doi = {10.1109/ACCESS.2019.2933694},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/Ocampos-Guillen19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ThaiC19,
author = {Thanh Hai Thai and
R{\'{e}}mi Cogranne},
title = {Estimation of Primary Quantization Steps in Double-Compressed {JPEG}
Images Using a Statistical Model of Discrete Cosine Transform},
journal = {{IEEE} Access},
volume = {7},
pages = {76203--76216},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2921324},
doi = {10.1109/ACCESS.2019.2921324},
timestamp = {Mon, 08 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ThaiC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/WangZXDZPXX19,
author = {Yong Wang and
Dengguo Zhang and
Biaogang Xu and
Zheng Dong and
Xuanke Zeng and
Jihong Pei and
Shixiang Xu and
Quan Xue},
title = {Four Ports Double Y-Shaped Ultra-Wideband Magneto-Photonic Crystals
Circulator for 5G Communication System},
journal = {{IEEE} Access},
volume = {7},
pages = {120463--120474},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2932331},
doi = {10.1109/ACCESS.2019.2932331},
timestamp = {Mon, 27 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/WangZXDZPXX19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/NikasND19,
author = {Alexandros Nikas and
Emmanouil Ntanos and
Haris Ch. Doukas},
title = {A semi-quantitative modelling application for assessing energy efficiency
strategies},
journal = {Appl. Soft Comput.},
volume = {76},
pages = {140--155},
year = {2019},
url = {https://doi.org/10.1016/j.asoc.2018.12.015},
doi = {10.1016/J.ASOC.2018.12.015},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asc/NikasND19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/KimID19,
author = {Eunji Kim and
Ivan Ivanov and
Edward R. Dougherty},
title = {Quantifying the notions of canalizing and master genes in a gene regulatory
network - a Boolean network modeling perspective},
journal = {Bioinform.},
volume = {35},
number = {4},
pages = {643--649},
year = {2019},
url = {https://doi.org/10.1093/bioinformatics/bty665},
doi = {10.1093/BIOINFORMATICS/BTY665},
timestamp = {Fri, 01 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/KimID19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cnsns/ChaudhuriC19,
author = {Shatadru Chaudhuri and
A. Roy Chowdhury},
title = {Four component strongly coupled quantum dusty plasma and generation
of dark-bright solitons and double-layers},
journal = {Commun. Nonlinear Sci. Numer. Simul.},
volume = {75},
pages = {236--250},
year = {2019},
url = {https://doi.org/10.1016/j.cnsns.2018.12.002},
doi = {10.1016/J.CNSNS.2018.12.002},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cnsns/ChaudhuriC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejc/Hoffmann-Ostenhof19,
author = {Arthur Hoffmann{-}Ostenhof and
Cun{-}Quan Zhang and
Zhang Zhang},
title = {Cycle double covers and non-separating cycles},
journal = {Eur. J. Comb.},
volume = {81},
pages = {276--284},
year = {2019},
url = {https://doi.org/10.1016/j.ejc.2019.06.006},
doi = {10.1016/J.EJC.2019.06.006},
timestamp = {Fri, 09 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejc/Hoffmann-Ostenhof19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/MizugakiHS19,
author = {Yoshinao Mizugaki and
Komei Higuchi and
Hiroshi Shimada},
title = {Enhanced voltage swing of rapid-single-flux-quantum distributed output
amplifier equipped with double-stack superconducting quantum interference
devices},
journal = {{IEICE} Electron. Express},
volume = {16},
number = {14},
pages = {20190331},
year = {2019},
url = {https://doi.org/10.1587/elex.16.20190331},
doi = {10.1587/ELEX.16.20190331},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/MizugakiHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-ifs/LiWX19,
author = {Qian Li and
Rangding Wang and
Dawen Xu},
title = {Detection of double compression in {HEVC} videos based on {TU} size
and quantised {DCT} coefficients},
journal = {{IET} Inf. Secur.},
volume = {13},
number = {1},
pages = {1--6},
year = {2019},
url = {https://doi.org/10.1049/iet-ifs.2017.0555},
doi = {10.1049/IET-IFS.2017.0555},
timestamp = {Thu, 27 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-ifs/LiWX19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/SangYCXGY19,
author = {Binbin Sang and
Lei Yang and
Hongmei Chen and
Weihua Xu and
Yanting Guo and
Zhong Yuan},
title = {Generalized multi-granulation double-quantitative decision-theoretic
rough set of multi-source information system},
journal = {Int. J. Approx. Reason.},
volume = {115},
pages = {157--179},
year = {2019},
url = {https://doi.org/10.1016/j.ijar.2019.09.009},
doi = {10.1016/J.IJAR.2019.09.009},
timestamp = {Mon, 06 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijar/SangYCXGY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmms/DouZSH19,
author = {Qi Dou and
Xianjun Sam Zheng and
Tongfang Sun and
Pheng{-}Ann Heng},
title = {Webthetics: Quantifying webpage aesthetics with deep learning},
journal = {Int. J. Hum. Comput. Stud.},
volume = {124},
pages = {56--66},
year = {2019},
url = {https://doi.org/10.1016/j.ijhcs.2018.11.006},
doi = {10.1016/J.IJHCS.2018.11.006},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmms/DouZSH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/GuoTXC19,
author = {Yanting Guo and
Eric C. C. Tsang and
Weihua Xu and
Degang Chen},
title = {Local logical disjunction double-quantitative rough sets},
journal = {Inf. Sci.},
volume = {500},
pages = {87--112},
year = {2019},
url = {https://doi.org/10.1016/j.ins.2019.05.033},
doi = {10.1016/J.INS.2019.05.033},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/GuoTXC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jaciii/ZhangZFLXT19,
author = {Shangfeng Zhang and
Jiani Zhu and
Qi Fang and
Yaoxin Liu and
Siwa Xu and
Ming{-}Hsueh Tsai},
title = {Solving the Time-Varying Cobb-Douglas Production Function Using a
Varying-Coefficient Quantile Regression Model},
journal = {J. Adv. Comput. Intell. Intell. Informatics},
volume = {23},
number = {5},
pages = {831--837},
year = {2019},
url = {https://doi.org/10.20965/jaciii.2019.p0831},
doi = {10.20965/JACIII.2019.P0831},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jaciii/ZhangZFLXT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/ChenSC19,
author = {Zhenzhu Chen and
Sihong Shao and
Wei Cai},
title = {A high order efficient numerical method for 4-D Wigner equation of
quantum double-slit interferences},
journal = {J. Comput. Phys.},
volume = {396},
pages = {54--71},
year = {2019},
url = {https://doi.org/10.1016/j.jcp.2019.06.047},
doi = {10.1016/J.JCP.2019.06.047},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/ChenSC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/ToP19,
author = {Thu{-}Hien To and
Stephen M. Pederson},
title = {strandCheckR: An {R} package for quantifying and removing double strand
sequences for strand-specific RNA-seq},
journal = {J. Open Source Softw.},
volume = {4},
number = {34},
pages = {1145},
year = {2019},
url = {https://doi.org/10.21105/joss.01145},
doi = {10.21105/JOSS.01145},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jossw/ToP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsan/SenguptaBP19,
author = {Saptarshi Sengupta and
Sanchita Basak and
Richard Alan Peters II},
title = {Chaotic Quantum Double Delta Swarm Algorithm Using Chebyshev Maps:
Theoretical Foundations, Performance Analyses and Convergence Issues},
journal = {J. Sens. Actuator Networks},
volume = {8},
number = {1},
pages = {9},
year = {2019},
url = {https://doi.org/10.3390/jsan8010009},
doi = {10.3390/JSAN8010009},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsan/SenguptaBP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/YangJF19,
author = {Hong{-}Jin Yang and
Tao Jin and
Quanyuan Feng},
title = {Design novel structure of high-voltage {MOSFET} with double trench
gates},
journal = {Microelectron. J.},
volume = {92},
year = {2019},
url = {https://doi.org/10.1016/j.mejo.2019.104612},
doi = {10.1016/J.MEJO.2019.104612},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/YangJF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlc/LiCX19,
author = {Mengmeng Li and
Minghao Chen and
Weihua Xu},
title = {Double-quantitative multigranulation decision-theoretic rough fuzzy
set model},
journal = {Int. J. Mach. Learn. Cybern.},
volume = {10},
number = {11},
pages = {3225--3244},
year = {2019},
url = {https://doi.org/10.1007/s13042-019-01013-5},
doi = {10.1007/S13042-019-01013-5},
timestamp = {Thu, 09 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mlc/LiCX19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlc/LiPXXF19,
author = {Wentao Li and
Witold Pedrycz and
Xiaoping Xue and
Weihua Xu and
Bingjiao Fan},
title = {Fuzziness and incremental information of disjoint regions in double-quantitative
decision-theoretic rough set model},
journal = {Int. J. Mach. Learn. Cybern.},
volume = {10},
number = {10},
pages = {2669--2690},
year = {2019},
url = {https://doi.org/10.1007/s13042-018-0893-7},
doi = {10.1007/S13042-018-0893-7},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mlc/LiPXXF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mp/RazaviyaynHRL19,
author = {Meisam Razaviyayn and
Mingyi Hong and
Navid Reyhanian and
Zhi{-}Quan Luo},
title = {A linearly convergent doubly stochastic Gauss-Seidel algorithm for
solving linear equations and a certain class of over-parameterized
optimization problems},
journal = {Math. Program.},
volume = {176},
number = {1-2},
pages = {465--496},
year = {2019},
url = {https://doi.org/10.1007/s10107-019-01404-0},
doi = {10.1007/S10107-019-01404-0},
timestamp = {Mon, 26 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mp/RazaviyaynHRL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/XieL019,
author = {Xiaozhu Xie and
Chia{-}Chen Lin and
Chin{-}Chen Chang},
title = {A reversible data hiding scheme for {JPEG} images by doubling small
quantized {AC} coefficients},
journal = {Multim. Tools Appl.},
volume = {78},
number = {9},
pages = {11443--11462},
year = {2019},
url = {https://doi.org/10.1007/s11042-018-6651-8},
doi = {10.1007/S11042-018-6651-8},
timestamp = {Thu, 04 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mta/XieL019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SunXDXCY19,
author = {Yi{-}Ru Sun and
Nan Xiang and
Zhao Dou and
Gang Xu and
Xiu{-}Bo Chen and
Yi{-}Xian Yang},
title = {A universal protocol for controlled bidirectional quantum state transmission},
journal = {Quantum Inf. Process.},
volume = {18},
number = {9},
pages = {281},
year = {2019},
url = {https://doi.org/10.1007/s11128-019-2390-7},
doi = {10.1007/S11128-019-2390-7},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/SunXDXCY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/YiXYQ19,
author = {Xiao{-}Feng Yi and
Peng Xu and
Qi Yao and
Xianfu Quan},
title = {Quantum repeater without Bell measurements in double-quantum-dot systems},
journal = {Quantum Inf. Process.},
volume = {18},
number = {3},
pages = {82},
year = {2019},
url = {https://doi.org/10.1007/s11128-019-2185-x},
doi = {10.1007/S11128-019-2185-X},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/YiXYQ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/FangS19,
author = {Rong Fang and
Bogdan M. Strimbu},
title = {Comparison of Mature Douglas-Firs' Crown Structures Developed with
Two Quantitative Structural Models Using {TLS} Point Clouds for Neighboring
Trees in a Natural Regime Stand},
journal = {Remote. Sens.},
volume = {11},
number = {14},
pages = {1661},
year = {2019},
url = {https://doi.org/10.3390/rs11141661},
doi = {10.3390/RS11141661},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/FangS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/NiuLZN19,
author = {Yakun Niu and
Xiaolong Li and
Yao Zhao and
Rongrong Ni},
title = {An enhanced approach for detecting double {JPEG} compression with
the same quantization matrix},
journal = {Signal Process. Image Commun.},
volume = {76},
pages = {89--96},
year = {2019},
url = {https://doi.org/10.1016/j.image.2019.04.016},
doi = {10.1016/J.IMAGE.2019.04.016},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spic/NiuLZN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/CuiD19,
author = {Wei Cui and
Daoyi Dong},
title = {Modeling and Control of Quantum Measurement-Induced Backaction in
Double Quantum Dots},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {27},
number = {6},
pages = {2499--2509},
year = {2019},
url = {https://doi.org/10.1109/TCST.2018.2871790},
doi = {10.1109/TCST.2018.2871790},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcst/CuiD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/DuZZXSZQ19,
author = {Yi Du and
Chao Zhang and
Xiaoyong Zhu and
Feng Xiao and
Yandong Sun and
Yuefei Zuo and
Li Quan},
title = {Principle and Analysis of Doubly Salient {PM} Motor With {\(\Pi\)}-Shaped
Stator Iron Core Segments},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {66},
number = {3},
pages = {1962--1972},
year = {2019},
url = {https://doi.org/10.1109/TIE.2018.2838060},
doi = {10.1109/TIE.2018.2838060},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/DuZZXSZQ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/WangZTZQ19,
author = {Mingqiao Wang and
Ping Zheng and
Chengde Tong and
Quanbin Zhao and
Guangyuan Qiao},
title = {Research on a Transverse-Flux Brushless Double-Rotor Machine for Hybrid
Electric Vehicles},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {66},
number = {2},
pages = {1032--1043},
year = {2019},
url = {https://doi.org/10.1109/TIE.2018.2835418},
doi = {10.1109/TIE.2018.2835418},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/WangZTZQ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ZhuFMCQ19,
author = {Xiaoyong Zhu and
Deyang Fan and
Lihong Mo and
Yunyun Chen and
Li Quan},
title = {Multiobjective Optimization Design of a Double-Rotor Flux-Switching
Permanent Magnet Machine Considering Multimode Operation},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {66},
number = {1},
pages = {641--653},
year = {2019},
url = {https://doi.org/10.1109/TIE.2018.2818643},
doi = {10.1109/TIE.2018.2818643},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/ZhuFMCQ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/XieMZDYC19,
author = {Hongtao Xie and
Zhendong Mao and
Yongdong Zhang and
Han Deng and
Chenggang Yan and
Zhineng Chen},
title = {Double-Bit Quantization and Index Hashing for Nearest Neighbor Search},
journal = {{IEEE} Trans. Multim.},
volume = {21},
number = {5},
pages = {1248--1260},
year = {2019},
url = {https://doi.org/10.1109/TMM.2018.2872898},
doi = {10.1109/TMM.2018.2872898},
timestamp = {Thu, 29 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmm/XieMZDYC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/LiFYZCYY19,
author = {Jinglin Li and
Dawei Fu and
Quan Yuan and
Haohan Zhang and
Kaihui Chen and
Shu Yang and
Fangchun Yang},
title = {A Traffic Prediction Enabled Double Rewarded Value Iteration Network
for Route Planning},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {68},
number = {5},
pages = {4170--4181},
year = {2019},
url = {https://doi.org/10.1109/TVT.2019.2893173},
doi = {10.1109/TVT.2019.2893173},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/LiFYZCYY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/AprilPyoneKK19,
author = {MaungMaung AprilPyone and
Yuma Kinoshita and
Hitoshi Kiya},
title = {Filtering Adversarial Noise with Double Quantization},
booktitle = {2019 Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} {ASC} 2019, Lanzhou, China, November
18-21, 2019},
pages = {1745--1749},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/APSIPAASC47483.2019.9023341},
doi = {10.1109/APSIPAASC47483.2019.9023341},
timestamp = {Fri, 13 Mar 2020 10:17:58 +0100},
biburl = {https://dblp.org/rec/conf/apsipa/AprilPyoneKK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/FangJSX019,
author = {Qianan Fang and
Xinghao Jiang and
Tanfeng Sun and
Qiang Xu and
Ke Xu},
title = {Detection of {HEVC} Double Compression with Different Quantization
Parameters Based on Property of {DCT} Coefficients and TUs},
booktitle = {12th International Congress on Image and Signal Processing, BioMedical
Engineering and Informatics, {CISP-BMEI} 2019, Suzhou, China, October
19-21, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CISP-BMEI48845.2019.8966004},
doi = {10.1109/CISP-BMEI48845.2019.8966004},
timestamp = {Thu, 03 Dec 2020 11:15:26 +0100},
biburl = {https://dblp.org/rec/conf/bmei/FangJSX019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/brainles-ws/FengDTM19,
author = {Xue Feng and
Quan Dou and
Nicholas J. Tustison and
Craig H. Meyer},
editor = {Alessandro Crimi and
Spyridon Bakas},
title = {Brain Tumor Segmentation with Uncertainty Estimation and Overall Survival
Prediction},
booktitle = {Brainlesion: Glioma, Multiple Sclerosis, Stroke and Traumatic Brain
Injuries - 5th International Workshop, BrainLes 2019, Held in Conjunction
with {MICCAI} 2019, Shenzhen, China, October 17, 2019, Revised Selected
Papers, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {11992},
pages = {304--314},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-46640-4\_29},
doi = {10.1007/978-3-030-46640-4\_29},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/brainles-ws/FengDTM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/DouglasRKR19,
author = {Hannah M. Douglas and
Adriana Rossi and
Rachel W. Kallen and
Michael J. Richardson},
editor = {Ashok K. Goel and
Colleen M. Seifert and
Christian Freksa},
title = {Liar's Intent: {A} Multidimensional Recurrence Quantification Analysis
Approach to Deception Detection},
booktitle = {Proceedings of the 41th Annual Meeting of the Cognitive Science Society,
CogSci 2019: Creativity + Cognition + Computation, Montreal, Canada,
July 24-27, 2019},
pages = {3264},
publisher = {cognitivesciencesociety.org},
year = {2019},
url = {https://mindmodeling.org/cogsci2019/papers/0572/index.html},
timestamp = {Wed, 17 Apr 2024 12:43:09 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/DouglasRKR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cyberc/DouC19,
author = {Quansheng Dou and
Panpan Cui},
title = {Slot Filling Using En-Training},
booktitle = {2019 International Conference on Cyber-Enabled Distributed Computing
and Knowledge Discovery, CyberC 2019, Guilin, China, October 17-19,
2019},
pages = {271--276},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CyberC.2019.00053},
doi = {10.1109/CYBERC.2019.00053},
timestamp = {Tue, 21 Jan 2020 19:19:11 +0100},
biburl = {https://dblp.org/rec/conf/cyberc/DouC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/MakkiBGABSR19,
author = {Karim Makki and
Bhushan Borotikar and
Marc Garetier and
Oscar Acosta and
Sylvain Brochard and
Douraied Ben Salem and
Fran{\c{c}}ois Rousseau},
title = {4D in vivo quantification of ankle joint space width using dynamic
{MRI}},
booktitle = {41st Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2019, Berlin, Germany, July 23-27,
2019},
pages = {2115--2118},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/EMBC.2019.8856687},
doi = {10.1109/EMBC.2019.8856687},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/MakkiBGABSR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/QuanL0WLHJ19,
author = {Dou Quan and
Xuefeng Liang and
Shuang Wang and
Shaowei Wei and
Yanfeng Li and
Ning Huyan and
Licheng Jiao},
title = {AFD-Net: Aggregated Feature Difference Learning for Cross-Spectral
Image Patch Matching},
booktitle = {2019 {IEEE/CVF} International Conference on Computer Vision, {ICCV}
2019, Seoul, Korea (South), October 27 - November 2, 2019},
pages = {3017--3026},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCV.2019.00311},
doi = {10.1109/ICCV.2019.00311},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccv/QuanL0WLHJ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/WangLLQYWJ19,
author = {Shuang Wang and
Yanfeng Li and
Xuefeng Liang and
Dou Quan and
Bowu Yang and
Shaowei Wei and
Licheng Jiao},
title = {Better and Faster: Exponential Loss for Image Patch Matching},
booktitle = {2019 {IEEE/CVF} International Conference on Computer Vision, {ICCV}
2019, Seoul, Korea (South), October 27 - November 2, 2019},
pages = {4811--4820},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCV.2019.00491},
doi = {10.1109/ICCV.2019.00491},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccv/WangLLQYWJ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/DouHQXZ19,
author = {Hong{-}bo Dou and
Yun{-}feng Hua and
An{-}xin Qi and
Jing Xu and
Jin{-}quan Zhao},
editor = {Yong Liu and
Lipo Wang and
Liang Zhao and
Zhengtao Yu},
title = {A Transient Response Domain Time Analysis Method of Transmission Lines},
booktitle = {Advances in Natural Computation, Fuzzy Systems and Knowledge Discovery
- Proceedings of the 15th International Conference on Natural Computation,
Fuzzy Systems and Knowledge Discovery {(ICNC-FSKD} 2019), Kunming,
China, July 20-22, 2019 - Volume 2},
series = {Advances in Intelligent Systems and Computing},
volume = {1075},
pages = {869--873},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-32591-6\_94},
doi = {10.1007/978-3-030-32591-6\_94},
timestamp = {Thu, 23 Jan 2020 15:53:37 +0100},
biburl = {https://dblp.org/rec/conf/icnc/DouHQXZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icton/BaghdasaryanKHM19,
author = {Hovik V. Baghdasaryan and
Tamara M. Knyazyan and
Tamara T. Hovhannisyan and
Marian Marciniak},
title = {Double-Barrier Resonant Tunneling in Nano-Optics and Quantum Mechanics:
Wavelength-Scale Analysis by the Method of Single Expression},
booktitle = {21st International Conference on Transparent Optical Networks, {ICTON}
2019, Angers, France, July 9-13, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICTON.2019.8840538},
doi = {10.1109/ICTON.2019.8840538},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/icton/BaghdasaryanKHM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/0001ZHQZLH19,
author = {Shuang Wang and
Ligang Zhou and
Pei He and
Dou Quan and
Qing Zhao and
Xuefeng Liang and
Biao Hou},
title = {An Improved Fully Convolutional Network for Learning Rich Building
Features},
booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
pages = {6444--6447},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IGARSS.2019.8898460},
doi = {10.1109/IGARSS.2019.8898460},
timestamp = {Thu, 21 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/0001ZHQZLH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/0005LQJLD19,
author = {Tao Sun and
Dongsheng Li and
Zhe Quan and
Hao Jiang and
Shengguo Li and
Yong Dou},
editor = {Sarit Kraus},
title = {Heavy-ball Algorithms Always Escape Saddle Points},
booktitle = {Proceedings of the Twenty-Eighth International Joint Conference on
Artificial Intelligence, {IJCAI} 2019, Macao, China, August 10-16,
2019},
pages = {3520--3526},
publisher = {ijcai.org},
year = {2019},
url = {https://doi.org/10.24963/ijcai.2019/488},
doi = {10.24963/IJCAI.2019/488},
timestamp = {Tue, 15 Oct 2024 16:43:28 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/0005LQJLD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isads/LinZSC19,
author = {Wen{-}xing Lin and
Jin{-}quan Zuo and
Shuai Su and
Chi Chen},
title = {A double-blockchains based Digital Archives Management Framework and
Implementation},
booktitle = {14th {IEEE} International Symposium on Autonomous Decentralized System,
{ISADS} 2019, Utrecht, The Netherlands, April 8-10, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISADS45777.2019.9155628},
doi = {10.1109/ISADS45777.2019.9155628},
timestamp = {Mon, 17 Aug 2020 15:29:15 +0200},
biburl = {https://dblp.org/rec/conf/isads/LinZSC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/DouYJFWZLYAZL19,
author = {Xuejiao Dou and
Hongxiang Yao and
Dan Jin and
Feng Feng and
Pan Wang and
Bo Zhou and
Bing Liu and
Zhengyi Yang and
Ningyu An and
Xi Zhang and
Yong Liu},
title = {Characterizing White Matter Connectivity in Alzheimer's Disease and
Mild Cognitive Impairment: Automated Fiber Quantification},
booktitle = {16th {IEEE} International Symposium on Biomedical Imaging, {ISBI}
2019, Venice, Italy, April 8-11, 2019},
pages = {117--121},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISBI.2019.8759211},
doi = {10.1109/ISBI.2019.8759211},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/DouYJFWZLYAZL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/YinPTRDD19,
author = {Yi Yin and
St{\'{e}}phanie Prigent and
Joan Torrent and
Human Rezaei and
Dirk Drasdo and
Marie Doumic},
title = {Automated Quantification of Amyloid Fibrils Morphological Features
by Image Processing Techniques},
booktitle = {16th {IEEE} International Symposium on Biomedical Imaging, {ISBI}
2019, Venice, Italy, April 8-11, 2019},
pages = {534--537},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISBI.2019.8759597},
doi = {10.1109/ISBI.2019.8759597},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isbi/YinPTRDD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iske/WanDZJZ19,
author = {Wenjun Wan and
Quansheng Dou and
Xiaoling Zhou and
Ping Jiang and
Bin Zhang},
editor = {Li Zou and
Lingling Fang and
Bo Fu and
Panpan Niu},
title = {Natural Language-to-SQL Based on Relationship Extraction},
booktitle = {14th {IEEE} International Conference on Intelligent Systems and Knowledge
Engineering, {ISKE} 2019, Dalian, China, November 14-16, 2019},
pages = {1219--1225},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISKE47853.2019.9170394},
doi = {10.1109/ISKE47853.2019.9170394},
timestamp = {Wed, 26 Aug 2020 15:39:06 +0200},
biburl = {https://dblp.org/rec/conf/iske/WanDZJZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/issre/DiopNFKK19,
author = {Serigne Mouhamadane Diop and
Jema David Ndibwile and
Doudou Fall and
Shigeru Kashihara and
Youki Kadobayashi},
editor = {Katinka Wolter and
Ina Schieferdecker and
Barbara Gallina and
Michel Cukier and
Roberto Natella and
Naghmeh Ramezani Ivaki and
Nuno Laranjeiro},
title = {To Coerce or Not to Coerce? {A} Quantitative Investigation on Cybersecurity
and Cybercrime Legislations Towards Large-Scale Vulnerability Notifications},
booktitle = {{IEEE} International Symposium on Software Reliability Engineering
Workshops, {ISSRE} Workshops 2019, Berlin, Germany, October 27-30,
2019},
pages = {282--287},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISSREW.2019.00085},
doi = {10.1109/ISSREW.2019.00085},
timestamp = {Mon, 28 Dec 2020 11:31:03 +0100},
biburl = {https://dblp.org/rec/conf/issre/DiopNFKK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcsse/VinitnantharatI19,
author = {Napas Vinitnantharat and
Narit Inchan and
Thatthai Sakkumjorn and
Kitsada Doungjitjaroen and
Chukiat Worasucheep},
title = {Quantitative Trading Machine Learning Using Differential Evolution
Algorithm},
booktitle = {16th International Joint Conference on Computer Science and Software
Engineering, {JCSSE} 2019, Chonburi, Thailand, July 10-12, 2019},
pages = {230--235},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/JCSSE.2019.8864226},
doi = {10.1109/JCSSE.2019.8864226},
timestamp = {Wed, 28 Jul 2021 09:09:36 +0200},
biburl = {https://dblp.org/rec/conf/jcsse/VinitnantharatI19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miigp/RettmannSDHKWKN19,
author = {Maryam E. Rettmann and
Atsushi Suzuki and
Amanda J. Deisher and
Stephan Hohmann and
Hiroki Konishi and
Songyun Wang and
Jon J. Kruse and
Laura K. Newman and
Kay D. Parker and
Michael G. Herman and
Douglas L. Packer},
editor = {Baowei Fei and
Cristian A. Linte},
title = {Quantitative assessment of the relationship between myocardial lesion
formation detected by delayed contrast-enhanced magnetic resonance
imaging and proton beam planning dose for treatment of ventricular
tachycardia},
booktitle = {Medical Imaging 2019: Image-Guided Procedures, Robotic Interventions,
and Modeling, San Diego, CA, USA, 16-21 February 2019},
series = {{SPIE} Proceedings},
volume = {10951},
pages = {109510D},
publisher = {{SPIE}},
year = {2019},
url = {https://doi.org/10.1117/12.2513920},
doi = {10.1117/12.2513920},
timestamp = {Tue, 04 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miigp/RettmannSDHKWKN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/YuWH19,
author = {Yue Yu and
Jiaxiang Wu and
Longbo Huang},
editor = {Hanna M. Wallach and
Hugo Larochelle and
Alina Beygelzimer and
Florence d'Alch{\'{e}}{-}Buc and
Emily B. Fox and
Roman Garnett},
title = {Double Quantization for Communication-Efficient Distributed Optimization},
booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference
on Neural Information Processing Systems 2019, NeurIPS 2019, December
8-14, 2019, Vancouver, BC, Canada},
pages = {4440--4451},
year = {2019},
url = {https://proceedings.neurips.cc/paper/2019/hash/ea4eb49329550caaa1d2044105223721-Abstract.html},
timestamp = {Fri, 11 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/YuWH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/Chi19,
author = {Peng Chi},
title = {Dataset for Double-Layer {LSTM} Recognition Method for Early Stage
of 10kV Single-Core Cable Based on Multi-Observable Electrical Quantities},
publisher = {{IEEE} DataPort},
year = {2019},
month = jul,
howpublished = {\url{https://doi.org/10.21227/m1ce-3g87}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.21227/m1ce-3g87},
doi = {10.21227/M1CE-3G87},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/Chi19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-04015,
author = {Peter Kritzer and
Friedrich Pillichshammer and
Leszek Plaskota and
Grzegorz W. Wasilkowski},
title = {On alternative quantization for doubly weighted approximation and
integration over unbounded domains},
journal = {CoRR},
volume = {abs/1907.04015},
year = {2019},
url = {http://arxiv.org/abs/1907.04015},
eprinttype = {arXiv},
eprint = {1907.04015},
timestamp = {Wed, 17 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-04015.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-04649,
author = {Stuart M. Marshall and
Douglas G. Moore and
Alastair R. G. Murray and
Sara Imari Walker and
Leroy Cronin},
title = {Quantifying the pathways to life using assembly spaces},
journal = {CoRR},
volume = {abs/1907.04649},
year = {2019},
url = {http://arxiv.org/abs/1907.04649},
eprinttype = {arXiv},
eprint = {1907.04649},
timestamp = {Wed, 14 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-04649.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-09697,
author = {Tao Sun and
Dongsheng Li and
Zhe Quan and
Hao Jiang and
Shengguo Li and
Yong Dou},
title = {Heavy-ball Algorithms Always Escape Saddle Points},
journal = {CoRR},
volume = {abs/1907.09697},
year = {2019},
url = {http://arxiv.org/abs/1907.09697},
eprinttype = {arXiv},
eprint = {1907.09697},
timestamp = {Sat, 29 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-09697.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-08669,
author = {Xiangjun Quan and
Qinran Hu and
Xiaobo Dou and
Zaijun Wu},
title = {A Novel Synchronous Reference Frame Frequency-Locked Loop},
journal = {CoRR},
volume = {abs/1908.08669},
year = {2019},
url = {http://arxiv.org/abs/1908.08669},
eprinttype = {arXiv},
eprint = {1908.08669},
timestamp = {Mon, 26 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1908-08669.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BrendelF0JS19,
author = {Jacqueline Brendel and
Marc Fischlin and
Felix G{\"{u}}nther and
Christian Janson and
Douglas Stebila},
title = {Challenges in Proving Post-Quantum Key Exchanges Based on Key Encapsulation
Mechanisms},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1356},
year = {2019},
url = {https://eprint.iacr.org/2019/1356},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BrendelF0JS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/CrockettPS19,
author = {Eric Crockett and
Christian Paquin and
Douglas Stebila},
title = {Prototyping post-quantum and hybrid key exchange and authentication
in {TLS} and {SSH}},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {858},
year = {2019},
url = {https://eprint.iacr.org/2019/858},
timestamp = {Thu, 02 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iacr/CrockettPS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/PaquinST19,
author = {Christian Paquin and
Douglas Stebila and
Goutam Tamvada},
title = {Benchmarking Post-Quantum Cryptography in {TLS}},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1447},
year = {2019},
url = {https://eprint.iacr.org/2019/1447},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/PaquinST19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/DouXHSQWX18,
author = {Xiaobo Dou and
Pei Xu and
Qinran Hu and
Wanxing Sheng and
Xiangjun Quan and
Zaijun Wu and
Bin Xu},
title = {A Distributed Voltage Control Strategy for Multi-Microgrid Active
Distribution Networks Considering Economy and Response Speed},
journal = {{IEEE} Access},
volume = {6},
pages = {31259--31268},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2837082},
doi = {10.1109/ACCESS.2018.2837082},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/DouXHSQWX18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/DuLZQ18,
author = {Yi Du and
Wei Lu and
Xiaoyong Zhu and
Li Quan},
title = {Optimal Design and Analysis of Partitioned Stator Hybrid Excitation
Doubly Salient Machine},
journal = {{IEEE} Access},
volume = {6},
pages = {57700--57707},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2872763},
doi = {10.1109/ACCESS.2018.2872763},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/DuLZQ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/XuQXDDZZKNK18,
author = {Weiheng Xu and
Yuanwei Qin and
Xiangming Xiao and
Guangzhi Di and
Russell B. Doughty and
Yuting Zhou and
Zhenhua Zou and
Lei Kong and
Quanfu Niu and
Weili Kou},
title = {Quantifying spatial-temporal changes of tea plantations in complex
landscapes through integrative analyses of optical and microwave imagery},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {73},
pages = {697--711},
year = {2018},
url = {https://doi.org/10.1016/j.jag.2018.08.010},
doi = {10.1016/J.JAG.2018.08.010},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aeog/XuQXDDZZKNK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chinaf/DouXCLY18,
author = {Zhao Dou and
Gang Xu and
Xiu{-}Bo Chen and
Xin Liu and
Yi{-}Xian Yang},
title = {A secure rational quantum state sharing protocol},
journal = {Sci. China Inf. Sci.},
volume = {61},
number = {2},
pages = {022501:1--022501:12},
year = {2018},
url = {https://doi.org/10.1007/s11432-016-9151-x},
doi = {10.1007/S11432-016-9151-X},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chinaf/DouXCLY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cnsns/KieuSW018,
author = {Chanh Kieu and
Taylan Sengul and
Quan Wang and
Dongming Yan},
title = {On the Hopf (double Hopf) bifurcations and transitions of two-layer
western boundary currents},
journal = {Commun. Nonlinear Sci. Numer. Simul.},
volume = {65},
pages = {196--215},
year = {2018},
url = {https://doi.org/10.1016/j.cnsns.2018.05.010},
doi = {10.1016/J.CNSNS.2018.05.010},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cnsns/KieuSW018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/complexity/HanSL18,
author = {Fei Han and
Yu{-}Wen{-}Tian Sun and
Qing{-}Hua Ling},
title = {An Improved Multiobjective Quantum-Behaved Particle Swarm Optimization
Based on Double Search Strategy and Circular Transposon Mechanism},
journal = {Complex.},
volume = {2018},
pages = {8702820:1--8702820:22},
year = {2018},
url = {https://doi.org/10.1155/2018/8702820},
doi = {10.1155/2018/8702820},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/complexity/HanSL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/ZhangDHJ18,
author = {Bo Zhang and
Yuanyuan Dou and
Quan Hong and
Honghu Ji},
title = {Experimental investigation of effect of tooth geometrical parameters
to flow characteristics in slant labyrinth seals},
journal = {Concurr. Comput. Pract. Exp.},
volume = {30},
number = {24},
year = {2018},
url = {https://doi.org/10.1002/cpe.4951},
doi = {10.1002/CPE.4951},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/concurrency/ZhangDHJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/LiuXL18,
author = {Xingbin Liu and
Di Xiao and
Cong Liu},
title = {Double Quantum Image Encryption Based on Arnold Transform and Qubit
Random Rotation},
journal = {Entropy},
volume = {20},
number = {11},
pages = {867},
year = {2018},
url = {https://doi.org/10.3390/e20110867},
doi = {10.3390/E20110867},
timestamp = {Fri, 04 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/entropy/LiuXL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-cds/KashlanEI18,
author = {Rana Y. El Kashlan and
Hamdy Abd Elhamid and
Yehea I. Ismail},
title = {Two-dimensional models for quantum effects on short channel electrostatics
of lightly doped symmetric double-gate MOSFETs},
journal = {{IET} Circuits Devices Syst.},
volume = {12},
number = {4},
pages = {341--346},
year = {2018},
url = {https://doi.org/10.1049/iet-cds.2017.0046},
doi = {10.1049/IET-CDS.2017.0046},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iet-cds/KashlanEI18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/LiPXXF18,
author = {Wentao Li and
Witold Pedrycz and
Xiaoping Xue and
Weihua Xu and
Bingjiao Fan},
title = {Distance-based double-quantitative rough fuzzy sets with logic operations},
journal = {Int. J. Approx. Reason.},
volume = {101},
pages = {206--233},
year = {2018},
url = {https://doi.org/10.1016/j.ijar.2018.07.007},
doi = {10.1016/J.IJAR.2018.07.007},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijar/LiPXXF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/YuZCX18,
author = {Jianhang Yu and
Biao Zhang and
Minghao Chen and
Weihua Xu},
title = {Double-quantitative decision-theoretic approach to multigranulation
approximate space},
journal = {Int. J. Approx. Reason.},
volume = {98},
pages = {236--258},
year = {2018},
url = {https://doi.org/10.1016/j.ijar.2018.05.001},
doi = {10.1016/J.IJAR.2018.05.001},
timestamp = {Thu, 09 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijar/YuZCX18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbc/Spitalsky18,
author = {Vladim{\'{\i}}r Spitalsk{\'{y}}},
title = {Recurrence Quantification Analysis of the Period-Doubling Sequence},
journal = {Int. J. Bifurc. Chaos},
volume = {28},
number = {14},
pages = {1850181:1--1850181:12},
year = {2018},
url = {https://doi.org/10.1142/S021812741850181X},
doi = {10.1142/S021812741850181X},
timestamp = {Wed, 24 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijbc/Spitalsky18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgcms/Amazan-HallCCCD18,
author = {Khaila Amazan{-}Hall and
Jen Jen Chen and
Kathy Chiang and
Amanda L. L. Cullen and
Mark Deppe and
Edgar Dormitorio and
Doug Haynes and
Jessica Kernan and
Kirsten Quanbeck and
Morgan Romine and
Bonnie Ruberg and
Jenny Song and
Judith Stepan{-}Norris and
Constance Steinkuehler and
Aaron Trammell},
title = {Diversity and Inclusion in Esports Programs in Higher Education: Leading
by Example at {UCI}},
journal = {Int. J. Gaming Comput. Mediat. Simulations},
volume = {10},
number = {2},
pages = {71--80},
year = {2018},
url = {https://doi.org/10.4018/IJGCMS.2018040104},
doi = {10.4018/IJGCMS.2018040104},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgcms/Amazan-HallCCCD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/XuSXY18,
author = {Jiangtao Xu and
Xiaolin Shi and
Shuang Xu and
Zhaoyang Yin},
title = {10-bit Single-Slope {ADC} with error quantification and double reset
technique for {CMOS} image sensor},
journal = {Microelectron. J.},
volume = {81},
pages = {154--161},
year = {2018},
url = {https://doi.org/10.1016/j.mejo.2018.10.001},
doi = {10.1016/J.MEJO.2018.10.001},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/XuSXY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ChenTXDCY18,
author = {Xiu{-}Bo Chen and
Xin Tang and
Gang Xu and
Zhao Dou and
Yu{-}Ling Chen and
Yi{-}Xian Yang},
title = {Cryptanalysis of secret sharing with a single \emph{d}-level quantum
system},
journal = {Quantum Inf. Process.},
volume = {17},
number = {9},
pages = {225},
year = {2018},
url = {https://doi.org/10.1007/s11128-018-1988-5},
doi = {10.1007/S11128-018-1988-5},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/ChenTXDCY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/DouXCNY18,
author = {Zhao Dou and
Gang Xu and
Xiu{-}Bo Chen and
Xinxin Niu and
Yi{-}Xian Yang},
title = {Rational protocol of quantum secure multi-party computation},
journal = {Quantum Inf. Process.},
volume = {17},
number = {8},
pages = {199},
year = {2018},
url = {https://doi.org/10.1007/s11128-018-1967-x},
doi = {10.1007/S11128-018-1967-X},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/DouXCNY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/FerraroFM18,
author = {Elena Ferraro and
Marco Fanciulli and
Marco De Michielis},
title = {Semiconducting double-dot exchange-only qubit dynamics in the presence
of magnetic and charge noises},
journal = {Quantum Inf. Process.},
volume = {17},
number = {6},
pages = {130},
year = {2018},
url = {https://doi.org/10.1007/s11128-018-1896-8},
doi = {10.1007/S11128-018-1896-8},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/FerraroFM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/GuLH18,
author = {Jun Gu and
Po{-}hua Lin and
Tzonelih Hwang},
title = {Double {C-NOT} attack and counterattack on 'Three-step semi-quantum
secure direct communication protocol'},
journal = {Quantum Inf. Process.},
volume = {17},
number = {7},
pages = {182},
year = {2018},
url = {https://doi.org/10.1007/s11128-018-1953-3},
doi = {10.1007/S11128-018-1953-3},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/GuLH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/PintoM18,
author = {Douglas F. Pinto and
Jonas Maziero},
title = {Entanglement production by the magnetic dipolar interaction dynamics},
journal = {Quantum Inf. Process.},
volume = {17},
number = {10},
pages = {253},
year = {2018},
url = {https://doi.org/10.1007/s11128-018-2028-1},
doi = {10.1007/S11128-018-2028-1},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/PintoM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ThomsonMBOGPSQS18,
author = {Eleanor R. Thomson and
Yadvinder Malhi and
Harm M. Bartholomeus and
Imma Oliveras and
Agne Gvozdevaite and
Theresa Peprah and
Juha Suomalainen and
John Quansah and
John Seidu and
Christian Adonteng and
Andrew J. Abraham and
Martin Herold and
Stephen Adu{-}Bredu and
Christopher E. Doughty},
title = {Mapping the Leaf Economic Spectrum across West African Tropical Forests
Using UAV-Acquired Hyperspectral Imagery},
journal = {Remote. Sens.},
volume = {10},
number = {10},
pages = {1532},
year = {2018},
url = {https://doi.org/10.3390/rs10101532},
doi = {10.3390/RS10101532},
timestamp = {Mon, 16 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/ThomsonMBOGPSQS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/0001LL0PSZTL18,
author = {Yong He and
Xiaodan Liu and
Yangyang Lv and
Fei Liu and
Jiyu Peng and
Tingting Shen and
Yun Zhao and
Yu Tang and
Shaoming Luo},
title = {Quantitative Analysis of Nutrient Elements in Soil Using Single and
Double-Pulse Laser-Induced Breakdown Spectroscopy},
journal = {Sensors},
volume = {18},
number = {5},
pages = {1526},
year = {2018},
url = {https://doi.org/10.3390/s18051526},
doi = {10.3390/S18051526},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/0001LL0PSZTL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/DalmiaO18,
author = {Nandita Dalmia and
Manish Okade},
title = {Robust first quantization matrix estimation based on filtering of
recompression artifacts for non-aligned double compressed {JPEG} images},
journal = {Signal Process. Image Commun.},
volume = {61},
pages = {9--20},
year = {2018},
url = {https://doi.org/10.1016/j.image.2017.10.011},
doi = {10.1016/J.IMAGE.2017.10.011},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spic/DalmiaO18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/ZhangTWWLHM18,
author = {Wenlong Zhang and
Masayoshi Tomizuka and
Peng Wu and
Yi{-}Hung Wei and
Quan Leng and
Song Han and
Aloysius K. Mok},
title = {A Double Disturbance Observer Design for Compensation of Unknown Time
Delay in a Wireless Motion Control System},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {26},
number = {2},
pages = {675--683},
year = {2018},
url = {https://doi.org/10.1109/TCST.2017.2665967},
doi = {10.1109/TCST.2017.2665967},
timestamp = {Thu, 19 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcst/ZhangTWWLHM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/QuanDWHSH18,
author = {Xiangjun Quan and
Xiaobo Dou and
Zaijun Wu and
Minqiang Hu and
Hui Song and
Alex Q. Huang},
title = {A Novel Dominant Dynamic Elimination Control for Voltage-Controlled
Inverter},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {8},
pages = {6800--6812},
year = {2018},
url = {https://doi.org/10.1109/TIE.2018.2805733},
doi = {10.1109/TIE.2018.2805733},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/QuanDWHSH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/QuanDWHH18,
author = {Xiangjun Quan and
Xiaobo Dou and
Zaijun Wu and
Minqiang Hu and
Alex Q. Huang},
title = {Complex-Coefficient Complex-Variable Filter for Grid Synchronization
Based on Linear Quadratic Regulation},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {14},
number = {5},
pages = {1824--1834},
year = {2018},
url = {https://doi.org/10.1109/TII.2017.2761834},
doi = {10.1109/TII.2017.2761834},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tii/QuanDWHH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/accv/QuanFL0J18,
author = {Dou Quan and
Shuai Fang and
Xuefeng Liang and
Shuang Wang and
Licheng Jiao},
editor = {C. V. Jawahar and
Hongdong Li and
Greg Mori and
Konrad Schindler},
title = {Cross-Spectral Image Patch Matching by Learning Features of the Spatially
Connected Patches in a Shared Space},
booktitle = {Computer Vision - {ACCV} 2018 - 14th Asian Conference on Computer
Vision, Perth, Australia, December 2-6, 2018, Revised Selected Papers,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {11362},
pages = {115--130},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-20890-5\_8},
doi = {10.1007/978-3-030-20890-5\_8},
timestamp = {Fri, 05 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/accv/QuanFL0J18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acomp/Luu18,
author = {H. V. Quang Luu},
editor = {Lam{-}Son L{\^{e}} and
Tran Khanh Dang and
Koichiro Ishibashi and
Tran Ngoc Thinh and
Cuong Pham{-}Quoc and
Quang Tran Minh},
title = {Modeling the Transient Energy Margin for Accessing the Transient Stability
with Double Shot Automatic Line Reclosing in Power System},
booktitle = {2018 International Conference on Advanced Computing and Applications,
{ACOMP} 2018, Ho Chi Minh City, Vietnam, November 27-29, 2018},
pages = {29--34},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ACOMP.2018.00013},
doi = {10.1109/ACOMP.2018.00013},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acomp/Luu18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/PengSJXLS18,
author = {Peng Peng and
Tanfeng Sun and
Xinghao Jiang and
Ke Xu and
Bin Li and
Yunqing Shi},
title = {Detection of Double {JPEG} Compression with the Same Quantization
Matrix Based on Convolutional Neural Networks},
booktitle = {Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} {ASC} 2018, Honolulu, HI, USA, November
12-15, 2018},
pages = {717--721},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.23919/APSIPA.2018.8659763},
doi = {10.23919/APSIPA.2018.8659763},
timestamp = {Thu, 28 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/apsipa/PengSJXLS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/TamaniG18,
author = {Nouredine Tamani and
Yacine Ghamri{-}Doudane},
title = {On Quantitative Interpretation of Fuzzy Quantified Propositions for
User Preference Handling},
booktitle = {2018 {IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE}
2018, Rio de Janeiro, Brazil, July 8-13, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/FUZZ-IEEE.2018.8491661},
doi = {10.1109/FUZZ-IEEE.2018.8491661},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/TamaniG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/DoutsiFAG18,
author = {Effrosyni Doutsi and
Lionel Fillatre and
Marc Antonini and
Julien Gaulmin},
title = {Neuro-Inspired Quantization},
booktitle = {2018 {IEEE} International Conference on Image Processing, {ICIP} 2018,
Athens, Greece, October 7-10, 2018},
pages = {689--693},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICIP.2018.8451793},
doi = {10.1109/ICIP.2018.8451793},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/DoutsiFAG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/HuangWL18,
author = {Xiaosa Huang and
Shilin Wang and
Gongshen Liu},
title = {Detecting Double Jpeg Compression with Same Quantization Matrix Based
on Dense Cnn Feature},
booktitle = {2018 {IEEE} International Conference on Image Processing, {ICIP} 2018,
Athens, Greece, October 7-10, 2018},
pages = {3813--3817},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICIP.2018.8451569},
doi = {10.1109/ICIP.2018.8451569},
timestamp = {Tue, 11 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/HuangWL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/GuoTXC18,
author = {Yanting Guo and
Eric C. C. Tsang and
Weihua Xu and
Degang Chen},
title = {Logical Disjunction Double-Quantitative Fuzzy Rough Sets},
booktitle = {2018 International Conference on Machine Learning and Cybernetics,
{ICMLC} 2018, Chengdu, China, July 15-18, 2018},
pages = {415--421},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICMLC.2018.8527064},
doi = {10.1109/ICMLC.2018.8527064},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmlc/GuoTXC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icycsee/LiuLYRSL18,
author = {Yuan Liu and
Ya Li and
Jian Yang and
Yan Ren and
Guoqiang Sun and
Quansheng Li},
editor = {Qinglei Zhou and
Yong Gan and
Weipeng Jing and
Xianhua Song and
Yan Wang and
Zeguang Lu},
title = {An Improved Apriori Algorithm Based on Matrix and Double Correlation
Profit Constraint},
booktitle = {Data Science - 4th International Conference of Pioneering Computer
Scientists, Engineers and Educators, {ICPCSEE} 2018, Zhengzhou, China,
September 21-23, 2018, Proceedings, Part {I}},
series = {Communications in Computer and Information Science},
volume = {901},
pages = {359--370},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-981-13-2203-7\_27},
doi = {10.1007/978-981-13-2203-7\_27},
timestamp = {Thu, 15 Feb 2024 16:58:31 +0100},
biburl = {https://dblp.org/rec/conf/icycsee/LiuLYRSL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeeiccc/SirrianniLA18,
author = {Joseph Sirrianni and
Xiaoqing Liu and
Douglas Adams},
editor = {Jeffrey Tsai and
Ernesto Damiani and
Xiaoqing (Frank) Liu and
Incheon Paik},
title = {Quantitative Modeling of Polarization in Online Intelligent Argumentation
and Deliberation for Capturing Collective Intelligence},
booktitle = {2018 {IEEE} International Conference on Cognitive Computing, {ICCC}
2018, San Francisco, CA, USA, July 2-7, 2018},
pages = {57--64},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICCC.2018.00015},
doi = {10.1109/ICCC.2018.00015},
timestamp = {Wed, 23 Oct 2024 10:43:39 +0200},
biburl = {https://dblp.org/rec/conf/ieeeiccc/SirrianniLA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/FangQ0ZZ18,
author = {Shuai Fang and
Dou Quan and
Shuang Wang and
Lei Zhang and
Ligang Zhou},
title = {A Two-Branch Network with Semi-Supervised Learning for Hyperspectral
Classification},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {3860--3863},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8517816},
doi = {10.1109/IGARSS.2018.8517816},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/FangQ0ZZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/Quan0LWFHJ18,
author = {Dou Quan and
Shuang Wang and
Xuefeng Liang and
Ruojing Wang and
Shuai Fang and
Biao Hou and
Licheng Jiao},
title = {Deep Generative Matching Network for Optical and {SAR} Image Registration},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {6215--6218},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8518653},
doi = {10.1109/IGARSS.2018.8518653},
timestamp = {Sun, 11 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/Quan0LWFHJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscram/ZhuCCZLLHZ18,
author = {Min Zhu and
Ruxue Chen and
Shi Chen and
Shaobo Zhong and
Cheng Liu and
Tianye Lin and
Quanyi Huang and
Xin Zhai},
editor = {Kees Boersma and
Brian M. Tomaszewski},
title = {A Conceptual Double Scenario Model for Predicting Medical Service
Needs in the International Disaster Relief Action},
booktitle = {Proceedings of the 15th International Conference on Information Systems
for Crisis Response and Management, Rochester, NY, USA, May 20-23,
2018},
publisher = {{ISCRAM} Association},
year = {2018},
url = {http://idl.iscram.org/files/minzhu/2018/1566\_MinZhu\_etal2018.pdf},
timestamp = {Thu, 10 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscram/ZhuCCZLLHZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/provsec/DerlerRS18,
author = {David Derler and
Sebastian Ramacher and
Daniel Slamanig},
editor = {Joonsang Baek and
Willy Susilo and
Jongkil Kim},
title = {Generic Double-Authentication Preventing Signatures and a Post-quantum
Instantiation},
booktitle = {Provable Security - 12th International Conference, ProvSec 2018, Jeju,
South Korea, October 25-28, 2018, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11192},
pages = {258--276},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-01446-9\_15},
doi = {10.1007/978-3-030-01446-9\_15},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/provsec/DerlerRS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssci/SenguptaBP18,
author = {Saptarshi Sengupta and
Sanchita Basak and
Richard Alan Peters},
title = {{QDDS:} {A} Novel Quantum Swarm Algorithm Inspired by a Double Dirac
Delta Potential},
booktitle = {{IEEE} Symposium Series on Computational Intelligence, {SSCI} 2018,
Bangalore, India, November 18-21, 2018},
pages = {704--711},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/SSCI.2018.8628792},
doi = {10.1109/SSCI.2018.8628792},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ssci/SenguptaBP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-05004,
author = {Parinya Ekparinya and
Vincent Gramoli and
Guillaume Jourjon},
title = {Double-Spending Risk Quantification in Private, Consortium and Public
Ethereum Blockchains},
journal = {CoRR},
volume = {abs/1805.05004},
year = {2018},
url = {http://arxiv.org/abs/1805.05004},
eprinttype = {arXiv},
eprint = {1805.05004},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-05004.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1807-02870,
author = {Saptarshi Sengupta and
Sanchita Basak and
Richard Alan Peters II},
title = {{QDDS:} {A} Novel Quantum Swarm Algorithm Inspired by a Double Dirac
Delta Potential},
journal = {CoRR},
volume = {abs/1807.02870},
year = {2018},
url = {http://arxiv.org/abs/1807.02870},
eprinttype = {arXiv},
eprint = {1807.02870},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1807-02870.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-12644,
author = {Nir Douer and
Joachim Meyer},
title = {The Responsibility Quantification (ResQu) Model of Human Interaction
with Automation},
journal = {CoRR},
volume = {abs/1810.12644},
year = {2018},
url = {http://arxiv.org/abs/1810.12644},
eprinttype = {arXiv},
eprint = {1810.12644},
timestamp = {Fri, 11 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-12644.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-01945,
author = {Saptarshi Sengupta and
Sanchita Basak and
Richard Alan Peters II},
title = {Chaotic Quantum Double Delta Swarm Algorithm using Chebyshev Maps:
Theoretical Foundations, Performance Analyses and Convergence Issues},
journal = {CoRR},
volume = {abs/1811.01945},
year = {2018},
url = {http://arxiv.org/abs/1811.01945},
eprinttype = {arXiv},
eprint = {1811.01945},
timestamp = {Thu, 22 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-01945.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-11640,
author = {Christian W{\"{u}}lker and
Gregory S. Chirikjian},
title = {Quantizing Euclidean motions via double-coset decomposition},
journal = {CoRR},
volume = {abs/1811.11640},
year = {2018},
url = {http://arxiv.org/abs/1811.11640},
eprinttype = {arXiv},
eprint = {1811.11640},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-11640.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/DerlerRS18,
author = {David Derler and
Sebastian Ramacher and
Daniel Slamanig},
title = {Generic Double-Authentication Preventing Signatures and a Post-Quantum
Instantiation},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {790},
year = {2018},
url = {https://eprint.iacr.org/2018/790},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/DerlerRS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aiedam/AmaralABW17,
author = {Sergio Amaral and
Douglas L. Allaire and
Elena De La Rosa Blanco and
Karen Willcox},
title = {A decomposition-based uncertainty quantification approach for environmental
impacts of aviation technology and operation},
journal = {Artif. Intell. Eng. Des. Anal. Manuf.},
volume = {31},
number = {3},
pages = {251--264},
year = {2017},
url = {https://doi.org/10.1017/S0890060417000154},
doi = {10.1017/S0890060417000154},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aiedam/AmaralABW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/PuyenbroeckR17,
author = {Tom Van Puyenbroeck and
Nicky Rogge},
title = {Geometric mean quantity index numbers with Benefit-of-the-Doubt weights},
journal = {Eur. J. Oper. Res.},
volume = {256},
number = {3},
pages = {1004--1014},
year = {2017},
url = {https://doi.org/10.1016/j.ejor.2016.07.038},
doi = {10.1016/J.EJOR.2016.07.038},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/PuyenbroeckR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/DufekADB17,
author = {Amanda S. Dufek and
Douglas Adriano Augusto and
Pedro Leite da Silva Dias and
Helio J. C. Barbosa},
title = {Application of evolutionary computation on ensemble forecast of quantitative
precipitation},
journal = {Comput. Geosci.},
volume = {106},
pages = {139--149},
year = {2017},
url = {https://doi.org/10.1016/j.cageo.2017.06.011},
doi = {10.1016/J.CAGEO.2017.06.011},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gandc/DufekADB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbc/PriyankaraBB17,
author = {K. G. D. Sulalitha Priyankara and
Sanjeeva Balasuriya and
Erik M. Bollt},
title = {Quantifying the Role of Folding in Nonautonomous Flows: The Unsteady
Double-Gyre},
journal = {Int. J. Bifurc. Chaos},
volume = {27},
number = {10},
pages = {1750156:1--1750156:19},
year = {2017},
url = {https://doi.org/10.1142/S0218127417501565},
doi = {10.1142/S0218127417501565},
timestamp = {Tue, 25 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbc/PriyankaraBB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/FanTXY17,
author = {Bingjiao Fan and
Eric C. C. Tsang and
Weihua Xu and
Jianhang Yu},
title = {Double-quantitative rough fuzzy set based decisions: {A} logical operations
method},
journal = {Inf. Sci.},
volume = {378},
pages = {264--281},
year = {2017},
url = {https://doi.org/10.1016/j.ins.2016.05.035},
doi = {10.1016/J.INS.2016.05.035},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/FanTXY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/JiangD17,
author = {Ping Jiang and
Quansheng Dou},
title = {Fundus vessel segmentation based on self-adaptive classification strategy},
journal = {J. Intell. Fuzzy Syst.},
volume = {33},
number = {1},
pages = {181--191},
year = {2017},
url = {https://doi.org/10.3233/JIFS-161432},
doi = {10.3233/JIFS-161432},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jifs/JiangD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jql/Pan17,
author = {Fan Pan},
title = {Multi-Dimensional Analysis, 25 years on - {A} tribute to Douglas Biber},
journal = {J. Quant. Linguistics},
volume = {24},
number = {1},
pages = {85--88},
year = {2017},
url = {https://doi.org/10.1080/09296174.2016.1239408},
doi = {10.1080/09296174.2016.1239408},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jql/Pan17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsjkx/ChenSLQ17,
author = {Huafeng Chen and
Yuling Shen and
Jianwu Long and
Xianping Qu},
title = {{\unicode{22522}}{\unicode{20110}}"{\unicode{36923}}{\unicode{36753}}{\unicode{19982}}"{\unicode{31639}}{\unicode{23376}}{\unicode{30340}}{\unicode{21452}}{\unicode{37327}}{\unicode{21270}}{\unicode{22810}}{\unicode{31890}}{\unicode{24230}}{\unicode{31895}}{\unicode{31961}}{\unicode{38598}}{\unicode{27169}}{\unicode{22411}}
(Double Quantitative Multi-granulation Rough Set Model Based on "Logical
Conjunction" Operator)},
journal = {{\unicode{35745}}{\unicode{31639}}{\unicode{26426}}{\unicode{31185}}{\unicode{23398}}},
volume = {44},
number = {{Z11}},
pages = {144--147},
year = {2017},
url = {https://doi.org/10.11896/j.issn.1002-137X.2017.11A.030},
doi = {10.11896/J.ISSN.1002-137X.2017.11A.030},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsjkx/ChenSLQ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimHM17,
author = {Taewook Kim and
Changsok Han and
Nima Maghari},
title = {A 4th-Order Continuous-Time Delta-Sigma Modulator Using 6-bit Double
Noise-Shaped Quantizer},
journal = {{IEEE} J. Solid State Circuits},
volume = {52},
number = {12},
pages = {3248--3261},
year = {2017},
url = {https://doi.org/10.1109/JSSC.2017.2734906},
doi = {10.1109/JSSC.2017.2734906},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimHM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/QinXFH17,
author = {Chuandong Qin and
Zhenxia Xue and
Quanxi Feng and
Xiaoyang Huang},
title = {Selecting Parameters of an Improved Doubly Regularized Support Vector
Machine based on Chaotic Particle Swarm Optimization Algorithm},
journal = {J. Univers. Comput. Sci.},
volume = {23},
number = {7},
pages = {603--618},
year = {2017},
url = {http://www.jucs.org/jucs\_23\_7/selecting\_parameters\_of\_an},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jucs/QinXFH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/MaNZL17,
author = {Yunpeng Ma and
Peifeng Niu and
Xinxin Zhang and
Guoqiang Li},
title = {Research and application of quantum-inspired double parallel feed-forward
neural network},
journal = {Knowl. Based Syst.},
volume = {136},
pages = {140--149},
year = {2017},
url = {https://doi.org/10.1016/j.knosys.2017.09.013},
doi = {10.1016/J.KNOSYS.2017.09.013},
timestamp = {Fri, 19 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/MaNZL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mor/SpeakmanL17,
author = {Emily Speakman and
Jon Lee},
title = {Quantifying Double McCormick},
journal = {Math. Oper. Res.},
volume = {42},
number = {4},
pages = {1230--1253},
year = {2017},
url = {https://doi.org/10.1287/moor.2017.0846},
doi = {10.1287/MOOR.2017.0846},
timestamp = {Tue, 28 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mor/SpeakmanL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RemerCDDDWD17,
author = {Justin Remer and
Elise C. Croteau{-}Chonka and
Douglas C. Dean III and
Sara D'Arpino and
Holly Dirks and
Dannielle Whiley and
Sean C. L. Deoni},
title = {Quantifying cortical development in typically developing toddlers
and young children, 1-6 years of age},
journal = {NeuroImage},
volume = {153},
pages = {246--261},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2017.04.010},
doi = {10.1016/J.NEUROIMAGE.2017.04.010},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/RemerCDDDWD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/MirandaM17,
author = {Mario Miranda and
Douglas F. Mundarain},
title = {Two-way {QKD} with single-photon-added coherent states},
journal = {Quantum Inf. Process.},
volume = {16},
number = {12},
pages = {298},
year = {2017},
url = {https://doi.org/10.1007/s11128-017-1752-2},
doi = {10.1007/S11128-017-1752-2},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/MirandaM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/XueYLLL17,
author = {Fei Xue and
Ziyi Ye and
Wei Lu and
Hongmei Liu and
Bin Li},
title = {{MSE} period based estimation of first quantization step in double
compressed {JPEG} images},
journal = {Signal Process. Image Commun.},
volume = {57},
pages = {76--83},
year = {2017},
url = {https://doi.org/10.1016/j.image.2017.05.008},
doi = {10.1016/J.IMAGE.2017.05.008},
timestamp = {Wed, 30 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spic/XueYLLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/GuoRW17,
author = {Qiang Guo and
Guoqing Ruan and
Jian Wan},
title = {A Sparse Signal Reconstruction Method Based on Improved Double Chains
Quantum Genetic Algorithm},
journal = {Symmetry},
volume = {9},
number = {9},
pages = {178},
year = {2017},
url = {https://doi.org/10.3390/sym9090178},
doi = {10.3390/SYM9090178},
timestamp = {Tue, 14 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/symmetry/GuoRW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgcn/WangZCQY17,
author = {Dexin Wang and
Rongqing Zhang and
Xiang Cheng and
Zhi Quan and
Liuqing Yang},
title = {Joint Power Allocation and Splitting (JoPAS) for {SWIPT} in Doubly
Selective Vehicular Channels},
journal = {{IEEE} Trans. Green Commun. Netw.},
volume = {1},
number = {4},
pages = {494--502},
year = {2017},
url = {https://doi.org/10.1109/TGCN.2017.2743067},
doi = {10.1109/TGCN.2017.2743067},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgcn/WangZCQY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/LuoHHMZ17,
author = {Quanming Luo and
Jian Huang and
Qingqing He and
Kun Ma and
Luowei Zhou},
title = {Analysis and Design of a Single-Stage Isolated {AC-DC} {LED} Driver
With a Voltage Doubler Rectifier},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {64},
number = {7},
pages = {5807--5817},
year = {2017},
url = {https://doi.org/10.1109/TIE.2017.2652369},
doi = {10.1109/TIE.2017.2652369},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/LuoHHMZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/transci/XuHC17,
author = {Su Xiu Xu and
George Q. Huang and
Meng Cheng},
title = {Truthful, Budget-Balanced Bundle Double Auctions for Carrier Collaboration},
journal = {Transp. Sci.},
volume = {51},
number = {4},
pages = {1365--1386},
year = {2017},
url = {https://doi.org/10.1287/trsc.2016.0694},
doi = {10.1287/TRSC.2016.0694},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/transci/XuHC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acm/ZouW17,
author = {Maoyang Zou and
Xi Wu},
editor = {John C. S. Lui and
Xinbing Wang and
Alexander Wolf and
Yunhao Liu and
Chuanping Hu},
title = {Research on quantitative quality evaluation method based on double
cycles},
booktitle = {Proceedings of the {ACM} Turing 50th Celebration Conference - China,
{TUR-C} 2017, Shanghai, China, May 12-14, 2017},
pages = {10:1--10:5},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3063955.3063965},
doi = {10.1145/3063955.3063965},
timestamp = {Thu, 09 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acm/ZouW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/WangLDW17,
author = {Shengbei Wang and
Xu{-}Yang Liu and
Xin Dang and
Jianming Wang},
editor = {Qingli Li and
Lipo Wang and
Mei Zhou and
Li Sun and
Song Qiu and
Hongying Liu},
title = {A robust speech watermarking based on Quantization Index Modulation
and Double Discrete Cosine Transform},
booktitle = {10th International Congress on Image and Signal Processing, BioMedical
Engineering and Informatics, {CISP-BMEI} 2017, Shanghai, China, October
14-16, 2017},
pages = {1--6},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/CISP-BMEI.2017.8302100},
doi = {10.1109/CISP-BMEI.2017.8302100},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/bmei/WangLDW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/MenychtasDTM17,
author = {Andreas Menychtas and
Charalampos Doukas and
Panayiotis Tsanakas and
Ilias Maglogiannis},
editor = {Panagiotis D. Bamidis and
Stathis Th. Konstantinidis and
Pedro Pereira Rodrigues},
title = {A Versatile Architecture for Building IoT Quantified-Self Applications},
booktitle = {30th {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2017, Thessaloniki, Greece, June 22-24, 2017},
pages = {500--505},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/CBMS.2017.80},
doi = {10.1109/CBMS.2017.80},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/MenychtasDTM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clsw/Zhong17,
author = {Hua Zhong},
editor = {Yunfang Wu and
Jia{-}Fei Hong and
Qi Su},
title = {On the Quantification of Events in Dou a( {)} Construction},
booktitle = {Chinese Lexical Semantics - 18th Workshop, {CLSW} 2017, Leshan, China,
May 18-20, 2017, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {10709},
pages = {41--63},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-73573-3\_4},
doi = {10.1007/978-3-319-73573-3\_4},
timestamp = {Thu, 22 Oct 2020 08:33:35 +0200},
biburl = {https://dblp.org/rec/conf/clsw/Zhong17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/KorhonenVK17,
author = {Ivan Vulic and
Douwe Kiela and
Anna Korhonen},
editor = {Mirella Lapata and
Phil Blunsom and
Alexander Koller},
title = {Evaluation by Association: {A} Systematic Study of Quantitative Word
Association Evaluation},
booktitle = {Proceedings of the 15th Conference of the European Chapter of the
Association for Computational Linguistics, {EACL} 2017, Valencia,
Spain, April 3-7, 2017, Volume 1: Long Papers},
pages = {163--175},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/e17-1016},
doi = {10.18653/V1/E17-1016},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eacl/KorhonenVK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/DengXMMZ17,
author = {Han Deng and
Hongtao Xie and
Wei Ma and
Zhendong Mao and
Chuan Zhou},
title = {Double-bit quantization and weighting for nearest neighbor search},
booktitle = {2017 {IEEE} International Conference on Acoustics, Speech and Signal
Processing, {ICASSP} 2017, New Orleans, LA, USA, March 5-9, 2017},
pages = {1717--1721},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICASSP.2017.7952450},
doi = {10.1109/ICASSP.2017.7952450},
timestamp = {Wed, 05 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/DengXMMZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsce/ElrowayatiAMA17,
author = {Ali A. Elrowayati and
Mohammad Faiz Liew Abdullah and
Azizah Abd Manaf and
Abdalrahman S. Alfagi},
title = {Tampering detection of double-compression with the same quantization
parameter in {HEVC} video streams},
booktitle = {7th {IEEE} International Conference on Control System, Computing and
Engineering, {ICCSCE} 2017, Penang, Malaysia, November 24-26, 2017},
pages = {174--179},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICCSCE.2017.8284400},
doi = {10.1109/ICCSCE.2017.8284400},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccsce/ElrowayatiAMA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsai/ShaoMLY17,
author = {Xiuli Shao and
Doudou Ma and
Yiwei Liu and
Quan Yin},
title = {Short-term forecast of stock price of multi-branch {LSTM} based on
K-means},
booktitle = {4th International Conference on Systems and Informatics, {ICSAI} 2017,
Hangzhou, China, November 11-13, 2017},
pages = {1546--1551},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICSAI.2017.8248530},
doi = {10.1109/ICSAI.2017.8248530},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/icsai/ShaoMLY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icton/PostigoPML17,
author = {P. A. Postigo and
Ivan Prieto and
L. E. Munoz{-}Camunez and
J. M. Llorens},
title = {Optical coupling of double {L7} photonic crystal microcavities for
applications in quantum photonics},
booktitle = {2017 19th International Conference on Transparent Optical Networks
(ICTON), Girona, Spain, July 2-6, 2017},
pages = {1--5},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICTON.2017.8024812},
doi = {10.1109/ICTON.2017.8024812},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icton/PostigoPML17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/KimHM17,
author = {Taewook Kim and
Changsok Han and
Nima Maghari},
title = {28.2 An 11.4mW 80.4dB-SNDR 15MHz-BW {CT} delta-sigma modulator using
6b double-noise-shaped quantizer},
booktitle = {2017 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2017, San Francisco, CA, USA, February 5-9, 2017},
pages = {468--469},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISSCC.2017.7870464},
doi = {10.1109/ISSCC.2017.7870464},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/KimHM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memsys/TannuCQ17,
author = {Swamit S. Tannu and
Douglas M. Carmean and
Moinuddin K. Qureshi},
title = {Cryogenic-DRAM based memory system for scalable quantum computers:
a feasibility study},
booktitle = {Proceedings of the International Symposium on Memory Systems, {MEMSYS}
2017, Alexandria, VA, USA, October 02 - 05, 2017},
pages = {189--195},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3132402.3132436},
doi = {10.1145/3132402.3132436},
timestamp = {Fri, 13 Nov 2020 09:24:44 +0100},
biburl = {https://dblp.org/rec/conf/memsys/TannuCQ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/TannuMNCQ17,
author = {Swamit S. Tannu and
Zachary A. Myers and
Prashant J. Nair and
Douglas M. Carmean and
Moinuddin K. Qureshi},
editor = {Hillery C. Hunter and
Jaime Moreno and
Joel S. Emer and
Daniel S{\'{a}}nchez},
title = {Taming the instruction bandwidth of quantum computers via hardware-managed
error correction},
booktitle = {Proceedings of the 50th Annual {IEEE/ACM} International Symposium
on Microarchitecture, {MICRO} 2017, Cambridge, MA, USA, October 14-18,
2017},
pages = {679--691},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3123939.3123940},
doi = {10.1145/3123939.3123940},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micro/TannuMNCQ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nccet/ZhouDFND17,
author = {Hongwei Zhou and
Rangyu Deng and
Quanyou Feng and
Xiaoqiang Ni and
Qiang Dou},
editor = {Weixia Xu and
Liquan Xiao and
Jinwen Li and
Chengyi Zhang and
Zhenzhen Zhu},
title = {Research of Configurable Hybrid Memory Architecture for Big Data Processing},
booktitle = {Computer Engineering and Technology - 21st {CCF} Conference, {NCCET}
2017, Xiamen, China, August 16-18, 2017, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {600},
pages = {116--132},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-981-10-7844-6\_12},
doi = {10.1007/978-981-10-7844-6\_12},
timestamp = {Fri, 29 Jun 2018 13:26:32 +0200},
biburl = {https://dblp.org/rec/conf/nccet/ZhouDFND17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pqcrypto/BindelHMS17,
author = {Nina Bindel and
Udyani Herath and
Matthew McKague and
Douglas Stebila},
editor = {Tanja Lange and
Tsuyoshi Takagi},
title = {Transitioning to a Quantum-Resistant Public Key Infrastructure},
booktitle = {Post-Quantum Cryptography - 8th International Workshop, PQCrypto 2017,
Utrecht, The Netherlands, June 26-28, 2017, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10346},
pages = {384--405},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-59879-6\_22},
doi = {10.1007/978-3-319-59879-6\_22},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pqcrypto/BindelHMS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/syscon/MaillouxSHG17,
author = {Logan O. Mailloux and
Benjamin N. Sargeant and
Douglas D. Hodson and
Michael R. Grimaila},
title = {System-level considerations for modeling space-based quantum key distribution
architectures},
booktitle = {2017 Annual {IEEE} International Systems Conference, SysCon 2017,
Montreal, QC, Canada, April 24-27, 2017},
pages = {1--6},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/SYSCON.2017.7934773},
doi = {10.1109/SYSCON.2017.7934773},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/syscon/MaillouxSHG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/VaidyanathanZA17,
author = {Sundarapandian Vaidyanathan and
Quanmin Zhu and
Ahmad Taher Azar},
editor = {Ahmad Taher Azar and
Sundarapandian Vaidyanathan and
Adel Ouannas},
title = {Adaptive Control of a Novel Nonlinear Double Convection Chaotic System},
booktitle = {Fractional Order Control and Synchronization of Chaotic Systems},
series = {Studies in Computational Intelligence},
volume = {688},
pages = {357--385},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-50249-6\_12},
doi = {10.1007/978-3-319-50249-6\_12},
timestamp = {Sun, 02 Oct 2022 16:18:08 +0200},
biburl = {https://dblp.org/rec/series/sci/VaidyanathanZA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BindelHMS17,
author = {Nina Bindel and
Udyani Herath and
Matthew McKague and
Douglas Stebila},
title = {Transitioning to a Quantum-Resistant Public Key Infrastructure},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {460},
year = {2017},
url = {http://eprint.iacr.org/2017/460},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BindelHMS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/it/Galvan16,
author = {Fausto Galvan},
title = {First Quantization Table Detection in Double Compressed {JPEG} Images},
school = {University of Udine, Italy},
year = {2016},
url = {https://opac.bncf.firenze.sbn.it/bncf-prod/resource?uri=TD16020932},
timestamp = {Sat, 06 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/it/Galvan16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/GaoJHZWY16,
author = {Guangwei Gao and
Xiao{-}Yuan Jing and
Pu Huang and
Quan Zhou and
Songsong Wu and
Dong Yue},
title = {Locality-Constrained Double Low-Rank Representation for Effective
Face Hallucination},
journal = {{IEEE} Access},
volume = {4},
pages = {8775--8786},
year = {2016},
url = {https://doi.org/10.1109/ACCESS.2016.2633281},
doi = {10.1109/ACCESS.2016.2633281},
timestamp = {Wed, 15 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/GaoJHZWY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/crossroads/Devitt16,
author = {Simon J. Devitt},
title = {Programming quantum computers using 3-D puzzles, coffee cups, and
doughnuts},
journal = {{XRDS}},
volume = {23},
number = {1},
pages = {45--50},
year = {2016},
url = {https://doi.org/10.1145/2983545},
doi = {10.1145/2983545},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/crossroads/Devitt16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/crossroads/Ding16,
author = {Dawei Ding},
title = {Quantum computation: double majoring in physics and computer science},
journal = {{XRDS}},
volume = {23},
number = {1},
pages = {7--8},
year = {2016},
url = {https://doi.org/10.1145/2983467},
doi = {10.1145/2983467},
timestamp = {Fri, 03 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/crossroads/Ding16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/BeeversPPP16,
author = {Lindsay Beevers and
Ioana Popescu and
Quan Pan and
Douglas Pender},
title = {Applicability of a coastal morphodynamic model for fluvial environments},
journal = {Environ. Model. Softw.},
volume = {80},
pages = {83--99},
year = {2016},
url = {https://doi.org/10.1016/j.envsoft.2016.02.016},
doi = {10.1016/J.ENVSOFT.2016.02.016},
timestamp = {Mon, 02 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/BeeversPPP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/MizugakiWS16,
author = {Yoshinao Mizugaki and
Tomoki Watanabe and
Hiroshi Shimada},
title = {Superconducting bipolar digital-to-analog converter equipped with
dual double-flux-quantum amplifier},
journal = {{IEICE} Electron. Express},
volume = {13},
number = {10},
pages = {20160242},
year = {2016},
url = {https://doi.org/10.1587/elex.13.20160242},
doi = {10.1587/ELEX.13.20160242},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/MizugakiWS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-com/DuyAVVD16,
author = {Tran Trung Duy and
George C. Alexandropoulos and
Tung Thanh Vu and
Nguyen{-}Son Vo and
Trung Quang Duong},
title = {Outage performance of cognitive cooperative networks with relay selection
over double-Rayleigh fading channels},
journal = {{IET} Commun.},
volume = {10},
number = {1},
pages = {57--64},
year = {2016},
url = {https://doi.org/10.1049/iet-com.2015.0236},
doi = {10.1049/IET-COM.2015.0236},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-com/DuyAVVD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/FangH16,
author = {Bo Wen Fang and
Bao Qing Hu},
title = {Probabilistic graded rough set and double relative quantitative decision-theoretic
rough set},
journal = {Int. J. Approx. Reason.},
volume = {74},
pages = {1--12},
year = {2016},
url = {https://doi.org/10.1016/j.ijar.2016.03.004},
doi = {10.1016/J.IJAR.2016.03.004},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijar/FangH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdcf/MireDMP16,
author = {Archana V. Mire and
Sanjay B. Dhok and
Naresh J. Mistry and
Prakash D. Porey},
title = {Tampering Localization in Double Compressed Images by Investigating
Noise Quantization},
journal = {Int. J. Digit. Crime Forensics},
volume = {8},
number = {3},
pages = {46--62},
year = {2016},
url = {https://doi.org/10.4018/IJDCF.2016070104},
doi = {10.4018/IJDCF.2016070104},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdcf/MireDMP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/ChenYHL16,
author = {Peng Chen and
Lifen Yuan and
Yigang He and
Shuai Luo},
title = {An improved {SVM} classifier based on double chains quantum genetic
algorithm and its application in analogue circuit diagnosis},
journal = {Neurocomputing},
volume = {211},
pages = {202--211},
year = {2016},
url = {https://doi.org/10.1016/j.neucom.2015.12.131},
doi = {10.1016/J.NEUCOM.2015.12.131},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/ChenYHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmiv/TaimoriRBAB16,
author = {Ali Taimori and
Farbod Razzazi and
Alireza Behrad and
Ali Ahmadi and
Massoud Babaie{-}Zadeh},
title = {Quantization-Unaware Double {JPEG} Compression Detection},
journal = {J. Math. Imaging Vis.},
volume = {54},
number = {3},
pages = {269--286},
year = {2016},
url = {https://doi.org/10.1007/s10851-015-0602-z},
doi = {10.1007/S10851-015-0602-Z},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmiv/TaimoriRBAB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jql/Aranovich16,
author = {Ra{\'{u}}l Aranovich},
title = {A Partitioned Chi-square Analysis of Variation in Spanish Clitic Doubling:
The Case of dar 'give'},
journal = {J. Quant. Linguistics},
volume = {23},
number = {3},
pages = {295--313},
year = {2016},
url = {https://doi.org/10.1080/09296174.2016.1169846},
doi = {10.1080/09296174.2016.1169846},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jql/Aranovich16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsjkx/HuX18,
author = {Meng Hu and
Weihua Xu},
title = {{\unicode{24207}}{\unicode{20449}}{\unicode{24687}}{\unicode{31995}}{\unicode{32479}}{\unicode{20013}}{\unicode{22522}}{\unicode{20110}}"{\unicode{36923}}{\unicode{36753}}{\unicode{19988}}"{\unicode{21644}}"{\unicode{36923}}{\unicode{36753}}{\unicode{25110}}"{\unicode{30340}}{\unicode{21452}}{\unicode{37327}}{\unicode{21270}}{\unicode{31895}}{\unicode{31961}}{\unicode{27169}}{\unicode{31946}}{\unicode{38598}}
(Double Quantitative Rough Fuzzy Set Model Based on Logical And Operator
and Logical Disjunct Operator in Ordered Information System)},
journal = {{\unicode{35745}}{\unicode{31639}}{\unicode{26426}}{\unicode{31185}}{\unicode{23398}}},
volume = {43},
number = {1},
pages = {98--102},
year = {2016},
url = {https://doi.org/10.11896/j.issn.1002-137X.2016.01.023},
doi = {10.11896/J.ISSN.1002-137X.2016.01.023},
timestamp = {Fri, 20 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsjkx/HuX18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/juq/BachouchGM16,
author = {Achref Bachouch and
Emmanuel Gobet and
Anis Matoussi},
title = {Empirical Regression Method for Backward Doubly Stochastic Differential
Equations},
journal = {{SIAM/ASA} J. Uncertain. Quantification},
volume = {4},
number = {1},
pages = {358--379},
year = {2016},
url = {https://doi.org/10.1137/15M1022094},
doi = {10.1137/15M1022094},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/juq/BachouchGM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/juq/BaoCMZ16,
author = {Feng Bao and
Yanzhao Cao and
Amnon J. Meir and
Weidong Zhao},
title = {A First Order Scheme for Backward Doubly Stochastic Differential Equations},
journal = {{SIAM/ASA} J. Uncertain. Quantification},
volume = {4},
number = {1},
pages = {413--445},
year = {2016},
url = {https://doi.org/10.1137/14095546X},
doi = {10.1137/14095546X},
timestamp = {Mon, 30 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/juq/BaoCMZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/XuG16,
author = {Weihua Xu and
Yanting Guo},
title = {Generalized multigranulation double-quantitative decision-theoretic
rough set},
journal = {Knowl. Based Syst.},
volume = {105},
pages = {190--205},
year = {2016},
url = {https://doi.org/10.1016/j.knosys.2016.05.021},
doi = {10.1016/J.KNOSYS.2016.05.021},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/XuG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/ZhangM16,
author = {Xianyong Zhang and
Duoqian Miao},
title = {Double-quantitative fusion of accuracy and importance: Systematic
measure mining, benign integration construction, hierarchical attribute
reduction},
journal = {Knowl. Based Syst.},
volume = {91},
pages = {219--240},
year = {2016},
url = {https://doi.org/10.1016/j.knosys.2015.09.001},
doi = {10.1016/J.KNOSYS.2015.09.001},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/ZhangM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/MeduryBB16,
author = {Aditya Sankar Medury and
K. N. Bhat and
Navakanta Bhat},
title = {Impact of carrier quantum confinement on the short channel effects
of double-gate silicon-on-insulator FINFETs},
journal = {Microelectron. J.},
volume = {55},
pages = {143--151},
year = {2016},
url = {https://doi.org/10.1016/j.mejo.2016.07.002},
doi = {10.1016/J.MEJO.2016.07.002},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/MeduryBB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ShuSCHRH16,
author = {Christina Y. Shu and
Basavaraju G. Sanganahalli and
Daniel Coman and
Peter Herman and
Douglas L. Rothman and
Fahmeed Hyder},
title = {Quantitative {\(\beta\)} mapping for calibrated fMRI},
journal = {NeuroImage},
volume = {126},
pages = {219--228},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2015.11.042},
doi = {10.1016/J.NEUROIMAGE.2015.11.042},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ShuSCHRH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/KolokotroniDVKS16,
author = {Eleni A. Kolokotroni and
Dimitra D. Dionysiou and
Christian Veith and
Yoo{-}Jin Kim and
J{\"{o}}rg Sabczynski and
Astrid Franz and
Aleksandar Grgic and
Jan Palm and
Rainer Bohle and
Georgios S. Stamatakos},
title = {In Silico Oncology: Quantification of the In Vivo Antitumor Efficacy
of Cisplatin-Based Doublet Therapy in Non-Small Cell Lung Cancer {(NSCLC)}
through a Multiscale Mechanistic Model},
journal = {PLoS Comput. Biol.},
volume = {12},
number = {9},
year = {2016},
url = {https://doi.org/10.1371/journal.pcbi.1005093},
doi = {10.1371/JOURNAL.PCBI.1005093},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/KolokotroniDVKS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/PrasanphanichWG16,
author = {Adam F. Prasanphanich and
Douglas E. White and
Margaret A. Gran and
Melissa L. Kemp},
title = {Kinetic Modeling of {ABCG2} Transporter Heterogeneity: {A} Quantitative,
Single-Cell Analysis of the Side Population Assay},
journal = {PLoS Comput. Biol.},
volume = {12},
number = {11},
year = {2016},
url = {https://doi.org/10.1371/journal.pcbi.1005188},
doi = {10.1371/JOURNAL.PCBI.1005188},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/PrasanphanichWG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qic/DoustiSP16,
author = {Mohammad Javad Dousti and
Alireza Shafaei and
Massoud Pedram},
title = {Squash 2: a hierarchical scalable quantum mapper considering ancilla
sharing},
journal = {Quantum Inf. Comput.},
volume = {16},
number = {3{\&}4},
pages = {332--356},
year = {2016},
url = {https://doi.org/10.26421/QIC16.3-4-8},
doi = {10.26421/QIC16.3-4-8},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qic/DoustiSP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/AghamalekiB16,
author = {Javad Abbasi Aghamaleki and
Alireza Behrad},
title = {Inter-frame video forgery detection and localization using intrinsic
effects of double compression on quantization errors of video coding},
journal = {Signal Process. Image Commun.},
volume = {47},
pages = {289--302},
year = {2016},
url = {https://doi.org/10.1016/j.image.2016.07.001},
doi = {10.1016/J.IMAGE.2016.07.001},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spic/AghamalekiB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/XiangZQDZF16,
author = {Zixuan Xiang and
Xiaoyong Zhu and
Li Quan and
Yi Du and
Chao Zhang and
Deyang Fan},
title = {Multilevel Design Optimization and Operation of a Brushless Double
Mechanical Port Flux-Switching Permanent-Magnet Motor},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {63},
number = {10},
pages = {6042--6054},
year = {2016},
url = {https://doi.org/10.1109/TIE.2016.2571268},
doi = {10.1109/TIE.2016.2571268},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/XiangZQDZF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bhi/SprintCW16,
author = {Gina Sprint and
Diane J. Cook and
Douglas L. Weeks},
title = {Quantitative assessment of lower limb and cane movement with wearable
inertial sensors},
booktitle = {2016 {IEEE-EMBS} International Conference on Biomedical and Health
Informatics, {BHI} 2016, Las Vegas, NV, USA, February 24-27, 2016},
pages = {418--421},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BHI.2016.7455923},
doi = {10.1109/BHI.2016.7455923},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/bhi/SprintCW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/LuoDPWMLZXYT16,
author = {Huiwen Luo and
Weibei Dou and
Yu Pan and
Yueheng Wang and
Yujia Mu and
Yudu Li and
Xiaojie Zhang and
Quan Xu and
Shuyu Yan and
Yuanyuan Tu},
editor = {Yaoli Wang and
Jiancheng An and
Lipo Wang and
Qingli Li and
Gaowei Van and
Qing Chang},
title = {Joint analysis of multi-level functional brain networks},
booktitle = {9th International Congress on Image and Signal Processing, BioMedical
Engineering and Informatics, {CISP-BMEI} 2016, Datong, China, October
15-17, 2016},
pages = {1521--1526},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/CISP-BMEI.2016.7852956},
doi = {10.1109/CISP-BMEI.2016.7852956},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/bmei/LuoDPWMLZXYT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/YinZFHZ16,
author = {Jianhua Yin and
Jinquan Zhao and
Lina Fan and
Ping Hong and
Hao Zhou},
editor = {Yaoli Wang and
Jiancheng An and
Lipo Wang and
Qingli Li and
Gaowei Van and
Qing Chang},
title = {A double-terminal fault location algorithm based on precise integration
method},
booktitle = {9th International Congress on Image and Signal Processing, BioMedical
Engineering and Informatics, {CISP-BMEI} 2016, Datong, China, October
15-17, 2016},
pages = {979--981},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/CISP-BMEI.2016.7852854},
doi = {10.1109/CISP-BMEI.2016.7852854},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bmei/YinZFHZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccs/BosCDMNNRS16,
author = {Joppe W. Bos and
Craig Costello and
L{\'{e}}o Ducas and
Ilya Mironov and
Michael Naehrig and
Valeria Nikolaenko and
Ananth Raghunathan and
Douglas Stebila},
editor = {Edgar R. Weippl and
Stefan Katzenbeisser and
Christopher Kruegel and
Andrew C. Myers and
Shai Halevi},
title = {Frodo: Take off the Ring! Practical, Quantum-Secure Key Exchange from
{LWE}},
booktitle = {Proceedings of the 2016 {ACM} {SIGSAC} Conference on Computer and
Communications Security, Vienna, Austria, October 24-28, 2016},
pages = {1006--1018},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2976749.2978425},
doi = {10.1145/2976749.2978425},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccs/BosCDMNNRS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/comma/DoutreM16,
author = {Sylvie Doutre and
Jean{-}Guy Mailly},
editor = {Pietro Baroni and
Thomas F. Gordon and
Tatjana Scheffler and
Manfred Stede},
title = {Quantifying the Difference Between Argumentation Semantics},
booktitle = {Computational Models of Argument - Proceedings of {COMMA} 2016, Potsdam,
Germany, 12-16 September, 2016},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {287},
pages = {255--262},
publisher = {{IOS} Press},
year = {2016},
url = {https://doi.org/10.3233/978-1-61499-686-6-255},
doi = {10.3233/978-1-61499-686-6-255},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/comma/DoutreM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dasc/DouLFP16,
author = {Quansheng Dou and
Jinjiang Li and
Hui Fan and
Yuehao Pan},
title = {Noisy Problem on Discrete Linear Consensus Protocol in Networked Multi-agent
Systems},
booktitle = {2016 {IEEE} 14th Intl Conf on Dependable, Autonomic and Secure Computing,
14th Intl Conf on Pervasive Intelligence and Computing, 2nd Intl Conf
on Big Data Intelligence and Computing and Cyber Science and Technology
Congress, DASC/PiCom/DataCom/CyberSciTech 2016, Auckland, New Zealand,
August 8-12, 2016},
pages = {190--195},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/DASC-PICom-DataCom-CyberSciTec.2016.51},
doi = {10.1109/DASC-PICOM-DATACOM-CYBERSCITEC.2016.51},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dasc/DouLFP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/PatelBPMKV16,
author = {Vrajeshri Patel and
Martin K. Burns and
Michael Pourfar and
Alon Mogilner and
Douglas Kondziolka and
Ramana Vinjamuri},
title = {{QAPD:} An integrated system to quantify symptoms of Parkinson's disease},
booktitle = {38th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2016, Orlando, FL, USA, August
16-20, 2016},
pages = {1822--1825},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/EMBC.2016.7591073},
doi = {10.1109/EMBC.2016.7591073},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/PatelBPMKV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ChenJSHW16,
author = {Jieyuan Chen and
Xinghao Jiang and
Tanfeng Sun and
Peisong He and
Shilin Wang},
title = {Detecting double {MPEG} compression with the same quantiser scale
based on {MBM} feature},
booktitle = {2016 {IEEE} International Conference on Acoustics, Speech and Signal
Processing, {ICASSP} 2016, Shanghai, China, March 20-25, 2016},
pages = {2064--2068},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICASSP.2016.7472040},
doi = {10.1109/ICASSP.2016.7472040},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/ChenJSHW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icvgip/DalmiaO16,
author = {Nandita Dalmia and
Manish Okade},
editor = {Dhruv Batra and
Michael Brown and
Vijay Natarajan},
title = {First quantization matrix estimation for double compressed {JPEG}
images utilizing novel {DCT} histogram selection strategy},
booktitle = {Proceedings of the Tenth Indian Conference on Computer Vision, Graphics
and Image Processing, {ICVGIP} 2016, Guwahati, Assam, India, December
18-22, 2016},
pages = {27:1--27:8},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/3009977.3010067},
doi = {10.1145/3009977.3010067},
timestamp = {Tue, 06 Nov 2018 11:06:53 +0100},
biburl = {https://dblp.org/rec/conf/icvgip/DalmiaO16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/NgoRO16,
author = {Binh Quang Van Ngo and
Pedro Rodr{\'{\i}}guez{-}Ayerbe and
Sorin Olaru},
title = {Model Predictive Direct Power Control for doubly fed induction generator
based wind turbines with three-level neutral-point clamped inverter},
booktitle = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
Society, Florence, Italy, October 23-26, 2016},
pages = {3476--3481},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IECON.2016.7794089},
doi = {10.1109/IECON.2016.7794089},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/NgoRO16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/QuanWDHZ16,
author = {Xiangjun Quan and
Zaijun Wu and
Xiaobo Dou and
Minqiang Hu and
Jumou Zhang},
title = {Discrete time optimal design for voltage prefilter in grid synchronization
system from control perspective},
booktitle = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
Society, Florence, Italy, October 23-26, 2016},
pages = {3360--3365},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IECON.2016.7793674},
doi = {10.1109/IECON.2016.7793674},
timestamp = {Mon, 26 Feb 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iecon/QuanWDHZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/DouSP16,
author = {Quansheng Dou and
Zhongzhi Shi and
Yuehao Pan},
editor = {Zhongzhi Shi and
Sunil Vadera and
Gang Li},
title = {Noisy Control About Discrete Liner Consensus Protocol},
booktitle = {Intelligent Information Processing {VIII} - 9th {IFIP} {TC} 12 International
Conference, {IIP} 2016, Melbourne, VIC, Australia, November 18-21,
2016, Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {486},
pages = {235--244},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-48390-0\_24},
doi = {10.1007/978-3-319-48390-0\_24},
timestamp = {Mon, 19 Aug 2024 08:36:42 +0200},
biburl = {https://dblp.org/rec/conf/ifip12/DouSP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/QuanWNXJ16,
author = {Dou Quan and
Shuang Wang and
Mengdan Ning and
Tao Xiong and
Licheng Jiao},
title = {Using deep neural networks for synthetic aperture radar image registration},
booktitle = {2016 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2016, Beijing, China, July 10-15, 2016},
pages = {2799--2802},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IGARSS.2016.7729723},
doi = {10.1109/IGARSS.2016.7729723},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/QuanWNXJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sacrypt/StebilaM16,
author = {Douglas Stebila and
Michele Mosca},
editor = {Roberto Avanzi and
Howard M. Heys},
title = {Post-quantum Key Exchange for the Internet and the Open Quantum Safe
Project},
booktitle = {Selected Areas in Cryptography - {SAC} 2016 - 23rd International Conference,
St. John's, NL, Canada, August 10-12, 2016, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {10532},
pages = {14--37},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-69453-5\_2},
doi = {10.1007/978-3-319-69453-5\_2},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sacrypt/StebilaM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbcci/TrindadeFNSN16,
author = {Alyson Trindade and
Ricardo S. Ferreira and
Jos{\'{e}} Augusto Miranda Nacif and
Douglas Sales and
Omar P. Vilela Neto},
title = {A Placement and routing algorithm for Quantum-dot Cellular Automata},
booktitle = {29th Symposium on Integrated Circuits and Systems Design, {SBCCI}
2016, Belo Horizonte, Brazil, August 29 - September 3, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/SBCCI.2016.7724048},
doi = {10.1109/SBCCI.2016.7724048},
timestamp = {Fri, 04 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbcci/TrindadeFNSN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smartcomp/SprintCW16,
author = {Gina Sprint and
Diane J. Cook and
Douglas L. Weeks},
title = {Designing Wearable Sensor-Based Analytics for Quantitative Mobility
Assessment},
booktitle = {2016 {IEEE} International Conference on Smart Computing, {SMARTCOMP}
2016, St Louis, MO, USA, May 18-20, 2016},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/SMARTCOMP.2016.7501686},
doi = {10.1109/SMARTCOMP.2016.7501686},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/smartcomp/SprintCW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Lang16a,
author = {Guangming Lang},
title = {Double-quantitative {\textdollar}{\(\gamma\)}\{{\textbackslash}ast\}-{\textdollar}fuzzy
coverings approximation operators},
journal = {CoRR},
volume = {abs/1611.08103},
year = {2016},
url = {http://arxiv.org/abs/1611.08103},
eprinttype = {arXiv},
eprint = {1611.08103},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/Lang16a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/RoySJ16,
author = {Ananda Roy and
A. Douglas Stone and
Liang Jiang},
title = {Concurrent Remote Entanglement with Quantum Error Correction},
journal = {CoRR},
volume = {abs/1606.01123},
year = {2016},
url = {http://arxiv.org/abs/1606.01123},
eprinttype = {arXiv},
eprint = {1606.01123},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/RoySJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eccc/LiuPZKA16,
author = {Zi{-}Wen Liu and
Christopher Perry and
Yechao Zhu and
Dax Enshan Koh and
Scott Aaronson},
title = {Doubly infinite separation of quantum information and communication},
journal = {Electron. Colloquium Comput. Complex.},
volume = {{TR16-016}},
year = {2016},
url = {https://eccc.weizmann.ac.il/report/2016/016},
eprinttype = {ECCC},
eprint = {TR16-016},
timestamp = {Tue, 27 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eccc/LiuPZKA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BosCDMNNRS16,
author = {Joppe W. Bos and
Craig Costello and
L{\'{e}}o Ducas and
Ilya Mironov and
Michael Naehrig and
Valeria Nikolaenko and
Ananth Raghunathan and
Douglas Stebila},
title = {Frodo: Take off the ring! Practical, Quantum-Secure Key Exchange from
{LWE}},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {659},
year = {2016},
url = {http://eprint.iacr.org/2016/659},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BosCDMNNRS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/StebilaM16,
author = {Douglas Stebila and
Michele Mosca},
title = {Post-Quantum Key Exchange for the Internet and the Open Quantum Safe
Project},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1017},
year = {2016},
url = {http://eprint.iacr.org/2016/1017},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/StebilaM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/ndltd/Souza15a,
author = {Douglas Delgado de Souza},
title = {Quantum information with squeezed coherent states of the light},
school = {University of Campinas, Brazil},
year = {2015},
url = {http://repositorio.unicamp.br/jspui/handle/REPOSIP/276940},
timestamp = {Sat, 26 Aug 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/ndltd/Souza15a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/MaillouxMGHJCMH15,
author = {Logan O. Mailloux and
Jeffrey D. Morris and
Michael R. Grimaila and
Douglas D. Hodson and
David R. Jacques and
John M. Colombi and
Colin V. McLaughlin and
Jennifer A. Holes},
title = {A Modeling Framework for Studying Quantum Key Distribution System
Implementation Nonidealities},
journal = {{IEEE} Access},
volume = {3},
pages = {110--130},
year = {2015},
url = {https://doi.org/10.1109/ACCESS.2015.2399101},
doi = {10.1109/ACCESS.2015.2399101},
timestamp = {Wed, 04 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/MaillouxMGHJCMH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chinaf/ZhouCHLSDQLW15,
author = {Yangfan Zhou and
Zhongxiang Cao and
Ye Han and
Quanliang Li and
Cong Shi and
Runjiang Dou and
Qi Qin and
Jian Liu and
Nanjian Wu},
title = {A low power global shutter pixel with extended {FD} voltage swing
range for large format high speed {CMOS} image sensor},
journal = {Sci. China Inf. Sci.},
volume = {58},
number = {4},
pages = {1--10},
year = {2015},
url = {https://doi.org/10.1007/s11432-014-5272-8},
doi = {10.1007/S11432-014-5272-8},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/chinaf/ZhouCHLSDQLW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cm/MaillouxGCHEMB15,
author = {Logan O. Mailloux and
Michael R. Grimaila and
John M. Colombi and
Douglas D. Hodson and
Ryan D. L. Engle and
Colin V. McLaughlin and
Gerald Baumgartner},
title = {Quantum key distribution: examination of the decoy state protocol},
journal = {{IEEE} Commun. Mag.},
volume = {53},
number = {10},
pages = {24--31},
year = {2015},
url = {https://doi.org/10.1109/MCOM.2015.7295459},
doi = {10.1109/MCOM.2015.7295459},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cm/MaillouxGCHEMB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/LiDDW15,
author = {Quan{-}Lin Li and
Ye Du and
Guirong Dai and
Meng Wang},
title = {On a doubly dynamically controlled supermarket model with impatient
customers},
journal = {Comput. Oper. Res.},
volume = {55},
pages = {76--87},
year = {2015},
url = {https://doi.org/10.1016/j.cor.2014.10.004},
doi = {10.1016/J.COR.2014.10.004},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/LiDDW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeesp/MaillouxGHBM15,
author = {Logan O. Mailloux and
Michael R. Grimaila and
Douglas D. Hodson and
Gerald Baumgartner and
Colin McLaughlin},
title = {Performance Evaluations of Quantum Key Distribution System Architectures},
journal = {{IEEE} Secur. Priv.},
volume = {13},
number = {1},
pages = {30--40},
year = {2015},
url = {https://doi.org/10.1109/MSP.2015.11},
doi = {10.1109/MSP.2015.11},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieeesp/MaillouxGHBM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/LiX15,
author = {Wentao Li and
Weihua Xu},
title = {Double-quantitative decision-theoretic rough set},
journal = {Inf. Sci.},
volume = {316},
pages = {54--67},
year = {2015},
url = {https://doi.org/10.1016/j.ins.2015.04.020},
doi = {10.1016/J.INS.2015.04.020},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/LiX15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/ZhangM15,
author = {Xianyong Zhang and
Duoqian Miao},
title = {An expanded double-quantitative model regarding probabilities and
grades and its hierarchical double-quantitative attribute reduction},
journal = {Inf. Sci.},
volume = {299},
pages = {312--336},
year = {2015},
url = {https://doi.org/10.1016/j.ins.2014.12.006},
doi = {10.1016/J.INS.2014.12.006},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/ZhangM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgt/MiaoTZ15,
author = {Zhengke Miao and
Wenliang Tang and
Cun{-}Quan Zhang},
title = {Strong Circuit Double Cover of Some Cubic Graphs},
journal = {J. Graph Theory},
volume = {78},
number = {2},
pages = {131--142},
year = {2015},
url = {https://doi.org/10.1002/jgt.21794},
doi = {10.1002/JGT.21794},
timestamp = {Fri, 02 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jgt/MiaoTZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/JiangDH15,
author = {Ping Jiang and
Quansheng Dou and
Xiaoying Hu},
title = {A supervised method for retinal image vessel segmentation by embedded
learning and classification},
journal = {J. Intell. Fuzzy Syst.},
volume = {29},
number = {5},
pages = {2305--2315},
year = {2015},
url = {https://doi.org/10.3233/IFS-151812},
doi = {10.3233/IFS-151812},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jifs/JiangDH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jip/FallOKY15,
author = {Doudou Fall and
Takeshi Okuda and
Youki Kadobayashi and
Suguru Yamaguchi},
title = {Security Risk Quantification Mechanism for Infrastructure as a Service
Cloud Computing Platforms},
journal = {J. Inf. Process.},
volume = {23},
number = {4},
pages = {465--475},
year = {2015},
url = {https://doi.org/10.2197/ipsjjip.23.465},
doi = {10.2197/IPSJJIP.23.465},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jip/FallOKY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocs/MengKPGMT15,
author = {Haiyan Meng and
Rupa Kommineni and
Quan Pham and
Robert W. Gardner and
Tanu Malik and
Douglas Thain},
title = {An invariant framework for conducting reproducible computational science},
journal = {J. Comput. Sci.},
volume = {9},
pages = {137--142},
year = {2015},
url = {https://doi.org/10.1016/j.jocs.2015.04.012},
doi = {10.1016/J.JOCS.2015.04.012},
timestamp = {Thu, 12 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocs/MengKPGMT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jolli/Kuusisto15,
author = {Antti Kuusisto},
title = {A Double Team Semantics for Generalized Quantifiers},
journal = {J. Log. Lang. Inf.},
volume = {24},
number = {2},
pages = {149--191},
year = {2015},
url = {https://doi.org/10.1007/s10849-015-9217-4},
doi = {10.1007/S10849-015-9217-4},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jolli/Kuusisto15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/SardinhaSVVN15,
author = {Luiz H. B. Sardinha and
Douglas S. Silva and
Marcos Augusto M. Vieira and
Luiz Filipe M. Vieira and
Omar P. Vilela Neto},
title = {{TCAM/CAM-QCA:} (Ternary) Content Addressable Memory using Quantum-dot
Cellular Automata},
journal = {Microelectron. J.},
volume = {46},
number = {7},
pages = {563--571},
year = {2015},
url = {https://doi.org/10.1016/j.mejo.2015.03.020},
doi = {10.1016/J.MEJO.2015.03.020},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/SardinhaSVVN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/LiLH15,
author = {Haodong Li and
Weiqi Luo and
Jiwu Huang},
title = {Anti-forensics of double {JPEG} compression with the same quantization
matrix},
journal = {Multim. Tools Appl.},
volume = {74},
number = {17},
pages = {6729--6744},
year = {2015},
url = {https://doi.org/10.1007/s11042-014-1927-0},
doi = {10.1007/S11042-014-1927-0},
timestamp = {Tue, 30 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mta/LiLH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/LiZLLH15,
author = {Chunlei Li and
Aihua Zhang and
Zhoufeng Liu and
Liang Liao and
Di Huang},
title = {Semi-fragile self-recoverable watermarking algorithm based on wavelet
group quantization and double authentication},
journal = {Multim. Tools Appl.},
volume = {74},
number = {23},
pages = {10581--10604},
year = {2015},
url = {https://doi.org/10.1007/s11042-014-2188-7},
doi = {10.1007/S11042-014-2188-7},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/LiZLLH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/FerraroMFP15,
author = {Elena Ferraro and
Marco De Michielis and
Marco Fanciulli and
Enrico Prati},
title = {Effective Hamiltonian for two interacting double-dot exchange-only
qubits and their controlled-NOT operations},
journal = {Quantum Inf. Process.},
volume = {14},
number = {1},
pages = {47--65},
year = {2015},
url = {https://doi.org/10.1007/s11128-014-0864-1},
doi = {10.1007/S11128-014-0864-1},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/FerraroMFP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/KordiGM15,
author = {Zeinab Kordi and
Saeed Ghanbari and
Mohammad Mahmoudi},
title = {Maximal atom-photon entanglement in a double-{\(\Lambda\)} quantum
system},
journal = {Quantum Inf. Process.},
volume = {14},
number = {6},
pages = {1907--1918},
year = {2015},
url = {https://doi.org/10.1007/s11128-015-0969-1},
doi = {10.1007/S11128-015-0969-1},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/KordiGM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/MundarainG15,
author = {Douglas F. Mundarain and
Mar{\'{\i}}a L. Ladr{\'{o}}n de Guevara},
title = {Local available quantum correlations},
journal = {Quantum Inf. Process.},
volume = {14},
number = {12},
pages = {4493--4510},
year = {2015},
url = {https://doi.org/10.1007/s11128-015-1139-1},
doi = {10.1007/S11128-015-1139-1},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/MundarainG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/XuCDYL15,
author = {Gang Xu and
Xiu{-}Bo Chen and
Zhao Dou and
Yixian Yang and
Zongpeng Li},
title = {A novel protocol for multiparty quantum key management},
journal = {Quantum Inf. Process.},
volume = {14},
number = {8},
pages = {2959--2980},
year = {2015},
url = {https://doi.org/10.1007/s11128-015-1021-1},
doi = {10.1007/S11128-015-1021-1},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/XuCDYL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ZhouHGPL15,
author = {Nan{-}Run Zhou and
Tian Xiang Hua and
Lihua Gong and
Dong Ju Pei and
Qing Hong Liao},
title = {Quantum image encryption based on generalized Arnold transform and
double random-phase encoding},
journal = {Quantum Inf. Process.},
volume = {14},
number = {4},
pages = {1193--1213},
year = {2015},
url = {https://doi.org/10.1007/s11128-015-0926-z},
doi = {10.1007/S11128-015-0926-Z},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/ZhouHGPL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ZouF15,
author = {Hong{-}Mei Zou and
MaoFa Fang},
title = {Analytical solution and entanglement swapping of a double Jaynes-Cummings
model in non-Markovian environments},
journal = {Quantum Inf. Process.},
volume = {14},
number = {7},
pages = {2673--2686},
year = {2015},
url = {https://doi.org/10.1007/s11128-015-1006-0},
doi = {10.1007/S11128-015-1006-0},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/ZouF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/LingRDH15,
author = {Ping Ling and
Xiangsheng Rong and
Yongquan Dong and
Guosheng Hao},
title = {Double-phase locality-sensitive hashing of neighborhood development
for multi-relational data},
journal = {Soft Comput.},
volume = {19},
number = {6},
pages = {1553--1565},
year = {2015},
url = {https://doi.org/10.1007/s00500-014-1343-4},
doi = {10.1007/S00500-014-1343-4},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/soco/LingRDH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/BaiZTSZ15,
author = {Jingang Bai and
Ping Zheng and
Chengde Tong and
Zhiyi Song and
Quanbin Zhao},
title = {Characteristic Analysis and Verification of the Magnetic-Field-Modulated
Brushless Double-Rotor Machine},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {62},
number = {7},
pages = {4023--4033},
year = {2015},
url = {https://doi.org/10.1109/TIE.2014.2381159},
doi = {10.1109/TIE.2014.2381159},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/BaiZTSZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/ZiraknejadLR15,
author = {Nima Ziraknejad and
Peter D. Lawrence and
Douglas P. Romilly},
title = {Vehicle Occupant Head Position Quantification Using an Array of Capacitive
Proximity Sensors},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {64},
number = {6},
pages = {2274--2287},
year = {2015},
url = {https://doi.org/10.1109/TVT.2014.2344026},
doi = {10.1109/TVT.2014.2344026},
timestamp = {Thu, 25 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/ZiraknejadLR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/ZhangTWLHM15,
author = {Wenlong Zhang and
Masayoshi Tomizuka and
Yi{-}Hung Wei and
Quan Leng and
Song Han and
Aloysius K. Mok},
title = {Robust time delay compensation in a wireless motion control system
with double disturbance observers},
booktitle = {American Control Conference, {ACC} 2015, Chicago, IL, USA, July 1-3,
2015},
pages = {5294--5299},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ACC.2015.7172166},
doi = {10.1109/ACC.2015.7172166},
timestamp = {Fri, 03 Dec 2021 13:03:59 +0100},
biburl = {https://dblp.org/rec/conf/amcc/ZhangTWLHM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/Paskaranandavadivel15b,
author = {Niranchan Paskaranandavadivel and
Simon H. Bull and
Doug Parsell and
Leo K. Cheng and
Thomas L. Abell},
title = {A system for automated quantification of cutaneous electrogastrograms},
booktitle = {37th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2015, Milan, Italy, August 25-29,
2015},
pages = {6098--6101},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/EMBC.2015.7319783},
doi = {10.1109/EMBC.2015.7319783},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/Paskaranandavadivel15b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/WangLCGCH15,
author = {Qi Wang and
Gubong Lim and
Leonard J. Cimini Jr. and
Larry J. Greenstein and
Douglas S. Chan and
Ahmadreza Hedayat},
title = {Quantifying and Comparing Energy Efficiencies on {SU-MIMO} and {MU-MIMO}
Downlinks},
booktitle = {2015 {IEEE} Global Communications Conference, {GLOBECOM} 2015, San
Diego, CA, USA, December 6-10, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/GLOCOM.2014.7416942},
doi = {10.1109/GLOCOM.2014.7416942},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/WangLCGCH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LeuenbergerM15,
author = {Spencer Leuenberger and
Un{-}Ku Moon},
title = {A single OpAmp 2\({}^{\mbox{nd}}\)-Order {\(\Delta\)}{\(\Sigma\)}
{ADC} with a double integrating quantizer},
booktitle = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2015, Lisbon, Portugal, May 24-27, 2015},
pages = {309--312},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISCAS.2015.7168632},
doi = {10.1109/ISCAS.2015.7168632},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LeuenbergerM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itnac/XiangLBA15,
author = {Ming Xiang and
William Liu and
Quan Bai and
Adnan Al{-}Anbuky},
title = {The double-edged sword: Revealing the critical role of structural
hole in forming trust for securing Wireless sensor networks},
booktitle = {International Telecommunication Networks and Applications Conference,
{ITNAC} 2015, Sydney, Australia, November 18-20, 2015},
pages = {286--291},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/ATNAC.2015.7366827},
doi = {10.1109/ATNAC.2015.7366827},
timestamp = {Thu, 23 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itnac/XiangLBA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwssip/MezliniYBBLSC15,
author = {Houda Mezlini and
Rabaa Youssef and
Hamid Bouhadoun and
Elisa Budyn and
Jean Denis Laredo and
Sylvie Sevestre{-}Ghalila and
Christine Chappard},
title = {High resolution volume quantification of the knee joint space based
on a semi-automatic segmentation of computed tomography images},
booktitle = {International Conference on Systems, Signals and Image Processing,
{IWSSIP} 2015, London, UK, September 10-12, 2015},
pages = {157--161},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IWSSIP.2015.7314201},
doi = {10.1109/IWSSIP.2015.7314201},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/iwssip/MezliniYBBLSC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/JinGY15,
author = {X. B. Jin and
F. M. Guo and
F. Y. Yue},
title = {The charge character in the double-barrier quantum dots in well hybrid
structure},
booktitle = {10th {IEEE} International Conference on Nano/Micro Engineered and
Molecular Systems, {NEMS} 2015, Xi'an, China, April 7-11, 2015},
pages = {40--43},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/NEMS.2015.7147352},
doi = {10.1109/NEMS.2015.7147352},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/nems/JinGY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rss/CaronPN15,
author = {St{\'{e}}phane Caron and
Quang{-}Cuong Pham and
Yoshihiko Nakamura},
editor = {Lydia E. Kavraki and
David Hsu and
Jonas Buchli},
title = {Leveraging Cone Double Description for Multi-contact Stability of
Humanoids with Applications to Statics and Dynamics},
booktitle = {Robotics: Science and Systems XI, Sapienza University of Rome, Rome,
Italy, July 13-17, 2015},
year = {2015},
url = {http://www.roboticsproceedings.org/rss11/p28.html},
doi = {10.15607/RSS.2015.XI.028},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rss/CaronPN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sat/DouglassKR15,
author = {Adam Douglass and
Andrew D. King and
Jack Raymond},
editor = {Marijn Heule and
Sean A. Weaver},
title = {Constructing {SAT} Filters with a Quantum Annealer},
booktitle = {Theory and Applications of Satisfiability Testing - {SAT} 2015 - 18th
International Conference, Austin, TX, USA, September 24-27, 2015,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9340},
pages = {104--120},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-24318-4\_9},
doi = {10.1007/978-3-319-24318-4\_9},
timestamp = {Tue, 21 May 2019 09:04:41 +0200},
biburl = {https://dblp.org/rec/conf/sat/DouglassKR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sp/BosCNS15,
author = {Joppe W. Bos and
Craig Costello and
Michael Naehrig and
Douglas Stebila},
title = {Post-Quantum Key Exchange for the {TLS} Protocol from the Ring Learning
with Errors Problem},
booktitle = {2015 {IEEE} Symposium on Security and Privacy, {SP} 2015, San Jose,
CA, USA, May 17-21, 2015},
pages = {553--570},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/SP.2015.40},
doi = {10.1109/SP.2015.40},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sp/BosCNS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uksim/VermaPJ15,
author = {Neha Verma and
Parveen and
Jyotika Jogi},
editor = {David Al{-}Dabass and
Alessandra Orsoni and
Richard J. Cant and
Zuwairie Ibrahim and
Ismail Saad},
title = {Quantum Simulation of a Double Gate Double Heterostructure in AlAs/InGaAs
{HEMT} to Analyze Temperature Effects},
booktitle = {UKSim-AMSS 17th International Conference on Computer Modelling and
Simulation, UKSim 2015, Cambridge, United Kingdom, March 25-27, 2015},
pages = {582--587},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/UKSim.2015.39},
doi = {10.1109/UKSIM.2015.39},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uksim/VermaPJ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ChanRVKC15,
author = {Kam Wai Clifford Chan and
Mayssaa El Rifai and
Pramode K. Verma and
Subhash C. Kak and
Yuhua Chen},
title = {Multi-Photon Quantum Key Distribution Based on Double-Lock Encryption},
journal = {CoRR},
volume = {abs/1503.05793},
year = {2015},
url = {http://arxiv.org/abs/1503.05793},
eprinttype = {arXiv},
eprint = {1503.05793},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ChanRVKC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DoustiP15,
author = {Mohammad Javad Dousti and
Massoud Pedram},
title = {{LEQA:} Latency Estimation for a Quantum Algorithm Mapped to a Quantum
Circuit Fabric},
journal = {CoRR},
volume = {abs/1501.00742},
year = {2015},
url = {http://arxiv.org/abs/1501.00742},
eprinttype = {arXiv},
eprint = {1501.00742},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DoustiP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DoustiSP15,
author = {Mohammad Javad Dousti and
Alireza Shafaei and
Massoud Pedram},
title = {Squash 2: {A} Hierarchical Scalable Quantum Mapper Considering Ancilla
Sharing},
journal = {CoRR},
volume = {abs/1512.07402},
year = {2015},
url = {http://arxiv.org/abs/1512.07402},
eprinttype = {arXiv},
eprint = {1512.07402},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DoustiSP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/EngleHGMMB15,
author = {Ryan D. L. Engle and
Douglas D. Hodson and
Michael R. Grimaila and
Logan O. Mailloux and
Colin V. McLaughlin and
Gerald Baumgartner},
title = {Modeling Quantum Optical Components, Pulses and Fiber Channels Using
OMNeT++},
journal = {CoRR},
volume = {abs/1509.03091},
year = {2015},
url = {http://arxiv.org/abs/1509.03091},
eprinttype = {arXiv},
eprint = {1509.03091},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/EngleHGMMB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GoudarziDSP15,
author = {Hadi Goudarzi and
Mohammad Javad Dousti and
Alireza Shafaei and
Massoud Pedram},
title = {Design of a Universal Logic Block for Fault-Tolerant Realization of
any Logic Operation in Trapped-Ion Quantum Circuits},
journal = {CoRR},
volume = {abs/1501.02524},
year = {2015},
url = {http://arxiv.org/abs/1501.02524},
eprinttype = {arXiv},
eprint = {1501.02524},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GoudarziDSP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiuPZKA15,
author = {Zi{-}Wen Liu and
Christopher Perry and
Yechao Zhu and
Dax Enshan Koh and
Scott Aaronson},
title = {Doubly infinite separation of quantum information and communication},
journal = {CoRR},
volume = {abs/1507.03546},
year = {2015},
url = {http://arxiv.org/abs/1507.03546},
eprinttype = {arXiv},
eprint = {1507.03546},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/LiuPZKA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/LiuLS14,
author = {Hong{-}Zhun Liu and
Sen Lin and
Xiao{-}Quan Sun},
title = {Comment on: "Double sub-equation method for complexiton solutions
of nonlinear partial differential equations"},
journal = {Appl. Math. Comput.},
volume = {246},
pages = {597--598},
year = {2014},
url = {https://doi.org/10.1016/j.amc.2014.08.024},
doi = {10.1016/J.AMC.2014.08.024},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/amc/LiuLS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/PhanstielBAS14,
author = {Douglas H. Phanstiel and
Alan P. Boyle and
Carlos L. Araya and
Michael P. Snyder},
title = {Sushi.R: flexible, quantitative and integrative genomic visualizations
for publication-quality multi-panel figures},
journal = {Bioinform.},
volume = {30},
number = {19},
pages = {2808--2810},
year = {2014},
url = {https://doi.org/10.1093/bioinformatics/btu379},
doi = {10.1093/BIOINFORMATICS/BTU379},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/PhanstielBAS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/YangJSP14,
author = {Yu{-}Guang Yang and
Xin Jia and
Si{-}Jia Sun and
Qing{-}Xiang Pan},
title = {Quantum cryptographic algorithm for color images using quantum Fourier
transform and double random-phase encoding},
journal = {Inf. Sci.},
volume = {277},
pages = {445--457},
year = {2014},
url = {https://doi.org/10.1016/j.ins.2014.02.124},
doi = {10.1016/J.INS.2014.02.124},
timestamp = {Mon, 09 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/YangJSP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/ZhangM14,
author = {Xianyong Zhang and
Duoqian Miao},
title = {Quantitative information architecture, granular computing and rough
set models in the double-quantitative approximation space of precision
and grade},
journal = {Inf. Sci.},
volume = {268},
pages = {147--168},
year = {2014},
url = {https://doi.org/10.1016/j.ins.2013.09.020},
doi = {10.1016/J.INS.2013.09.020},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/ZhangM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jaciii/LiD0014,
author = {Mu Li and
LiHua Dou and
Jie Chen and
Jian Sun},
title = {Stabilization of Optimal Dynamic Quantized System with Packet Loss},
journal = {J. Adv. Comput. Intell. Intell. Informatics},
volume = {18},
number = {2},
pages = {128--134},
year = {2014},
url = {https://doi.org/10.20965/jaciii.2014.p0128},
doi = {10.20965/JACIII.2014.P0128},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jaciii/LiD0014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jdi/HuhdanpaaZKDECEWS14,
author = {Hannu Huhdanpaa and
Peng Zhang and
Venkataramu N. Krishnamurthy and
Chris Douville and
Binu Enchakolody and
Chris Chou and
Sampathkumar Ethiraj and
Stewart C. Wang and
Grace L. Su},
title = {Quantitative Detection of Cirrhosis: Towards the Development of Computer-Assisted
Detection Method},
journal = {J. Digit. Imaging},
volume = {27},
number = {5},
pages = {601--609},
year = {2014},
url = {https://doi.org/10.1007/s10278-014-9696-x},
doi = {10.1007/S10278-014-9696-X},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jdi/HuhdanpaaZKDECEWS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jetc/RahmanDH14,
author = {Md. Mazder Rahman and
Gerhard W. Dueck and
Joseph D. Horton},
title = {An Algorithm for Quantum Template Matching},
journal = {{ACM} J. Emerg. Technol. Comput. Syst.},
volume = {11},
number = {3},
pages = {31:1--31:20},
year = {2014},
url = {https://doi.org/10.1145/2629537},
doi = {10.1145/2629537},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jetc/RahmanDH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mbec/EvansLWHLW14,
author = {Katherine R. Evans and
Edmond Lou and
Chris Woloschuk and
Doug L. Hill and
Meng Li and
Man{-}Sang Wong},
title = {Quantitative measurement of hip protector use and compliance},
journal = {Medical Biol. Eng. Comput.},
volume = {52},
number = {1},
pages = {9--15},
year = {2014},
url = {https://doi.org/10.1007/s11517-013-1116-8},
doi = {10.1007/S11517-013-1116-8},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mbec/EvansLWHLW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/HoltijGKI14,
author = {Thomas Holtij and
Michael Graef and
Alexander Kloes and
Benjam{\'{\i}}n I{\~{n}}{\'{\i}}guez},
title = {Modeling and performance study of nanoscale double gate junctionless
and inversion mode MOSFETs including carrier quantization effects},
journal = {Microelectron. J.},
volume = {45},
number = {9},
pages = {1220--1225},
year = {2014},
url = {https://doi.org/10.1016/j.mejo.2014.04.029},
doi = {10.1016/J.MEJO.2014.04.029},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/HoltijGKI14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/LaydonMSGSDKDPBA14,
author = {Daniel J. Laydon and
Anat Melamed and
Aaron Sim and
Nicolas A. Gillet and
Kathleen Sim and
Sam Darko and
J. Simon Kroll and
Daniel C. Douek and
David A. Price and
Charles R. M. Bangham and
Becca Asquith},
title = {Quantification of {HTLV-1} Clonality and {TCR} Diversity},
journal = {PLoS Comput. Biol.},
volume = {10},
number = {6},
year = {2014},
url = {https://doi.org/10.1371/journal.pcbi.1003646},
doi = {10.1371/JOURNAL.PCBI.1003646},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/LaydonMSGSDKDPBA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qic/GoncalvesGL14,
author = {Douglas Soares Gon{\c{c}}alves and
M{\'{a}}rcia A. Gomes{-}Ruggiero and
Carlile Lavor},
title = {Global convergence of diluted iterations in maximum-likelihood quantum
tomography},
journal = {Quantum Inf. Comput.},
volume = {14},
number = {11-12},
pages = {966--980},
year = {2014},
url = {https://doi.org/10.26421/QIC14.11-12-5},
doi = {10.26421/QIC14.11-12-5},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qic/GoncalvesGL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ChenDXWY14,
author = {Xiubo Chen and
Zhao Dou and
Gang Xu and
Cong Wang and
Yixian Yang},
title = {A class of protocols for quantum private comparison based on the symmetry
of states},
journal = {Quantum Inf. Process.},
volume = {13},
number = {1},
pages = {85--100},
year = {2014},
url = {https://doi.org/10.1007/s11128-013-0669-7},
doi = {10.1007/S11128-013-0669-7},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/ChenDXWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/ChengGWZ14,
author = {Liu{-}Yong Cheng and
Qi Guo and
Hong{-}Fu Wang and
Shou Zhang},
title = {Quantum state manipulation of dipole emitters with a plasmonic double-bar
resonator},
journal = {Quantum Inf. Process.},
volume = {13},
number = {11},
pages = {2513--2523},
year = {2014},
url = {https://doi.org/10.1007/s11128-014-0807-x},
doi = {10.1007/S11128-014-0807-X},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/ChengGWZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/FerraroMMFP14,
author = {Elena Ferraro and
Marco De Michielis and
Giovanni Mazzeo and
Marco Fanciulli and
Enrico Prati},
title = {Effective Hamiltonian for the hybrid double quantum dot qubit},
journal = {Quantum Inf. Process.},
volume = {13},
number = {5},
pages = {1155--1173},
year = {2014},
url = {https://doi.org/10.1007/s11128-013-0718-2},
doi = {10.1007/S11128-013-0718-2},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/FerraroMMFP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/GoudarziDSP14,
author = {Hadi Goudarzi and
Mohammad Javad Dousti and
Alireza Shafaei and
Massoud Pedram},
title = {Design of a universal logic block for fault-tolerant realization of
any logic operation in trapped-ion quantum circuits},
journal = {Quantum Inf. Process.},
volume = {13},
number = {5},
pages = {1267--1299},
year = {2014},
url = {https://doi.org/10.1007/s11128-013-0725-3},
doi = {10.1007/S11128-013-0725-3},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/GoudarziDSP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SongN14,
author = {Xianhua Song and
Xiamu Niu},
title = {Comment on: Novel image encryption/decryption based on quantum fourier
transform and double phase encoding},
journal = {Quantum Inf. Process.},
volume = {13},
number = {6},
pages = {1301--1304},
year = {2014},
url = {https://doi.org/10.1007/s11128-014-0738-6},
doi = {10.1007/S11128-014-0738-6},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/SongN14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ScottPMM14,
author = {Douglas Scott and
George P. Petropoulos and
Janet Moxley and
Heath Malcolm},
title = {Quantifying the Physical Composition of Urban Morphology throughout
Wales Based on the Time Series {(1989-2011)} Analysis of Landsat {TM/ETM+}
Images and Supporting {GIS} Data},
journal = {Remote. Sens.},
volume = {6},
number = {12},
pages = {11731--11752},
year = {2014},
url = {https://doi.org/10.3390/rs61211731},
doi = {10.3390/RS61211731},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/ScottPMM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/AllaireNWC14,
author = {Douglas L. Allaire and
George Noel and
Karen Willcox and
Rebecca Cointin},
title = {Uncertainty quantification of an Aviation Environmental Toolsuite},
journal = {Reliab. Eng. Syst. Saf.},
volume = {126},
pages = {14--24},
year = {2014},
url = {https://doi.org/10.1016/j.ress.2014.01.002},
doi = {10.1016/J.RESS.2014.01.002},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ress/AllaireNWC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/TongZWBZ14,
author = {Chengde Tong and
Ping Zheng and
Qian Wu and
Jingang Bai and
Quanbin Zhao},
title = {A Brushless Claw-Pole Double-Rotor Machine for Power-Split Hybrid
Electric Vehicles},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {61},
number = {8},
pages = {4295--4305},
year = {2014},
url = {https://doi.org/10.1109/TIE.2013.2281169},
doi = {10.1109/TIE.2013.2281169},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/TongZWBZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/GalvanPBB14,
author = {Fausto Galvan and
Giovanni Puglisi and
Arcangelo Ranieri Bruna and
Sebastiano Battiato},
title = {First Quantization Matrix Estimation From Double Compressed {JPEG}
Images},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {8},
pages = {1299--1310},
year = {2014},
url = {https://doi.org/10.1109/TIFS.2014.2330312},
doi = {10.1109/TIFS.2014.2330312},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/GalvanPBB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/YangXZKS14,
author = {Jianquan Yang and
Jin Xie and
Guopu Zhu and
Sam Kwong and
Yun{-}Qing Shi},
title = {An Effective Method for Detecting Double {JPEG} Compression With the
Same Quantization Matrix},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {11},
pages = {1933--1942},
year = {2014},
url = {https://doi.org/10.1109/TIFS.2014.2359368},
doi = {10.1109/TIFS.2014.2359368},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tifs/YangXZKS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wcl/WangFCGCH14,
author = {Qi Wang and
Hao Feng and
Leonard J. Cimini Jr. and
Larry J. Greenstein and
Douglas S. Chan and
Ahmadreza Hedayat},
title = {Comparison of Quantization Techniques for Downlink Multi-User {MIMO}
Channels with Limited Feedback},
journal = {{IEEE} Wirel. Commun. Lett.},
volume = {3},
number = {2},
pages = {165--168},
year = {2014},
url = {https://doi.org/10.1109/WCL.2013.122213.130692},
doi = {10.1109/WCL.2013.122213.130692},
timestamp = {Mon, 23 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wcl/WangFCGCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/LantosBDGLF14a,
author = {Cec{\'{\i}}lia Lantos and
Rafik Borji and
St{\'{e}}phane Douady and
Karolos M. Grigoriadis and
Kirill V. Larin and
Matthew A. Franchek},
editor = {Guy Plantier and
Tanja Schultz and
Ana L. N. Fred and
Hugo Gamboa},
title = {Model Based Quantification of Tissue Structural Properties Using Optical
Coherence Tomography},
booktitle = {Biomedical Engineering Systems and Technologies - 7th International
Joint Conference, {BIOSTEC} 2014, Angers, France, March 3-6, 2014,
Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {511},
pages = {113--134},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-26129-4\_8},
doi = {10.1007/978-3-319-26129-4\_8},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biostec/LantosBDGLF14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/ZhengDLCZ14,
author = {Tao Zheng and
Yan Dou and
Xin Li and
Wei Chen and
Quanyou Zhang},
editor = {Dong Xie and
Ron Yang and
Jinguang Sun and
Lipo Wang and
Xiaowei Hui and
Ying Chen},
title = {Hierarchical energy strategy of islanding microgrid based on lexicographic
hierarchical method},
booktitle = {7th International Conference on Biomedical Engineering and Informatics,
{BMEI} 2014, Dalian, China, October 14-16, 2014},
pages = {873--878},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/BMEI.2014.7002895},
doi = {10.1109/BMEI.2014.7002895},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/bmei/ZhengDLCZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bracis/StrachanKDVP14,
author = {Guilherme Ces{\'{a}}rio Strachan and
Adriano S. Koshiyama and
Douglas Mota Dias and
Marley Maria Bernardes Rebuzzi Vellasco and
Marco Aur{\'{e}}lio Cavalcanti Pacheco},
title = {Quantum-Inspired Multi-gene Linear Genetic Programming Model for Regression
Problems},
booktitle = {2014 Brazilian Conference on Intelligent Systems, {BRACIS} 2014, Sao
Paulo, Brazil, October 18-22, 2014},
pages = {152--157},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/BRACIS.2014.37},
doi = {10.1109/BRACIS.2014.37},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bracis/StrachanKDVP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/SolomonDJH14,
author = {Jeffrey M. Solomon and
Deborah Douglas and
Reed Johnson and
Dima A. Hammoud},
title = {New Image Analysis Technique for Quantitative Longitudinal Assessment
of Lung Pathology on {CT} in Infected Rhesus Macaques},
booktitle = {2014 {IEEE} 27th International Symposium on Computer-Based Medical
Systems, New York, NY, USA, May 27-29, 2014},
pages = {169--172},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/CBMS.2014.59},
doi = {10.1109/CBMS.2014.59},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/SolomonDJH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cimsivp/Zhu14,
author = {Hao Zhu},
title = {K-means based double-bit quantization for hashing},
booktitle = {2014 {IEEE} Symposium on Computational Intelligence for Multimedia,
Signal and Vision Processing, {CIMSIVP} 2014, Orlando, FL, USA, December
9-12, 2014},
pages = {195--199},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CIMSIVP.2014.7013292},
doi = {10.1109/CIMSIVP.2014.7013292},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/cimsivp/Zhu14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/StrachanKDVP14,
author = {Guilherme Ces{\'{a}}rio Strachan and
Adriano Soares Koshiyama and
Douglas Mota Dias and
Marley Maria Bernardes Rebuzzi Vellasco and
Marco Aur{\'{e}}lio Cavalcanti Pacheco},
editor = {Dirk V. Arnold and
Enrique Alba},
title = {Towards a quantum-inspired multi-gene linear genetic programming model},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} '14, Vancouver,
BC, Canada, July 12-16, 2014, Companion Material Proceedings},
pages = {149--150},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2598394.2598476},
doi = {10.1145/2598394.2598476},
timestamp = {Wed, 13 Jul 2022 16:15:15 +0200},
biburl = {https://dblp.org/rec/conf/gecco/StrachanKDVP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/glvlsi/DoustiSP14,
author = {Mohammad Javad Dousti and
Alireza Shafaei and
Massoud Pedram},
editor = {Joseph R. Cavallaro and
Tong Zhang and
Alex K. Jones and
Hai (Helen) Li},
title = {Squash: a scalable quantum mapper considering ancilla sharing},
booktitle = {Great Lakes Symposium on {VLSI} 2014, {GLSVLSI} '14, Houston, TX,
{USA} - May 21 - 23, 2014},
pages = {117--122},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2591513.2591523},
doi = {10.1145/2591513.2591523},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/glvlsi/DoustiSP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icca/Li0DZ14,
author = {Mu Li and
Jian Sun and
LiHua Dou and
Jia Zhang},
title = {Stability analysis of dynamic quantized systems with data dropout
and communication delay},
booktitle = {11th {IEEE} International Conference on Control {\&} Automation,
{ICCA} 2014, Taichung, Taiwan, June 18-20, 2014},
pages = {1198--1203},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICCA.2014.6871092},
doi = {10.1109/ICCA.2014.6871092},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icca/Li0DZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/JiangD14,
author = {Ping Jiang and
Quansheng Dou},
editor = {Zhongzhi Shi and
Zhaohui Wu and
David B. Leake and
Uli Sattler},
title = {Automated Localization and Accurate Segmentation of Optic Disc Based
on Intensity within a Minimum Enclosing Circle},
booktitle = {Intelligent Information Processing {VII} - 8th {IFIP} {TC} 12 International
Conference, {IIP} 2014, Hangzhou, China, October 17-20, 2014, Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {432},
pages = {216--220},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-662-44980-6\_24},
doi = {10.1007/978-3-662-44980-6\_24},
timestamp = {Tue, 01 Feb 2022 13:00:44 +0100},
biburl = {https://dblp.org/rec/conf/ifip12/JiangD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/med/ZhangT14,
author = {Xinlei Zhang and
Danielle C. Tarraf},
title = {On synchronizing sampling and quantization for stabilizing the double
integrator under binary sensing},
booktitle = {22nd Mediterranean Conference on Control and Automation, Palermo,
Italy, June 16-19, 2014},
pages = {531--538},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/MED.2014.6961427},
doi = {10.1109/MED.2014.6961427},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/med/ZhangT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/YangDZYZN14,
author = {Yalong Yang and
Ning Dou and
Shuai Zhao and
Zhichao Yang and
Kang Zhang and
Quang Vinh Nguyen},
editor = {Yookun Cho and
Sung Y. Shin and
Sang{-}Wook Kim and
Chih{-}Cheng Hung and
Jiman Hong},
title = {Visualizing large hierarchies with drawer trees},
booktitle = {Symposium on Applied Computing, {SAC} 2014, Gyeongju, Republic of
Korea - March 24 - 28, 2014},
pages = {951--956},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2554850.2554870},
doi = {10.1145/2554850.2554870},
timestamp = {Tue, 31 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sac/YangDZYZN14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbcci/FazzionFNNFS14,
author = {Elverton C. Fazzion and
Osvaldo L. H. M. Fonseca and
Jos{\'{e}} Augusto Miranda Nacif and
Omar P. Vilela Neto and
Ant{\^{o}}nio Ot{\'{a}}vio Fernandes and
Douglas S. Silva},
editor = {Edward David Moreno Ordonez and
Rodolfo Jardim de Azevedo and
Peter R. Kinget},
title = {A Quantum-Dot Cellular Automata Processor Design},
booktitle = {Proceedings of the 27th Symposium on Integrated Circuits and Systems
Design, Aracaju, Brazil, September 1-5, 2014},
pages = {29:1--29:7},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2660540.2660997},
doi = {10.1145/2660540.2660997},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sbcci/FazzionFNNFS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14,
author = {David E. Shaw and
J. P. Grossman and
Joseph A. Bank and
Brannon Batson and
J. Adam Butts and
Jack C. Chao and
Martin M. Deneroff and
Ron O. Dror and
Amos Even and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Brian Greskamp and
C. Richard Ho and
Douglas J. Ierardi and
Lev Iserovich and
Jeffrey Kuskin and
Richard H. Larson and
Timothy Layman and
Li{-}Siang Lee and
Adam K. Lerer and
Chester Li and
Daniel Killebrew and
Kenneth M. Mackenzie and
Shark Yeuk{-}Hai Mok and
Mark A. Moraes and
Rolf Mueller and
Lawrence J. Nociolo and
Jon L. Peticolas and
Terry Quan and
Daniel Ramot and
John K. Salmon and
Daniele Paolo Scarpazza and
U. Ben Schafer and
Naseer Siddique and
Christopher W. Snyder and
Jochen Spengler and
Ping Tak Peter Tang and
Michael Theobald and
Horia Toma and
Brian Towles and
Benjamin Vitale and
Stanley C. Wang and
Cliff Young},
editor = {Trish Damkroger and
Jack J. Dongarra},
title = {Anton 2: Raising the Bar for Performance and Programmability in a
Special-Purpose Molecular Dynamics Supercomputer},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, {SC} 2014, New Orleans, LA, USA, November 16-21,
2014},
pages = {41--53},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/SC.2014.9},
doi = {10.1109/SC.2014.9},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/whispers/RozelCDQ14,
author = {Antoine Rozel and
Harold Clenet and
Sylvain Dout{\'{e}} and
Cathy Quantin},
title = {Mineralogical characterization using neural networks: Composition
of mafic minerals in martian meteorites from their spectra},
booktitle = {6th Workshop on Hyperspectral Image and Signal Processing: Evolution
in Remote Sensing, {WHISPERS} 2014, Lausanne, Switzerland, June 24-27,
2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/WHISPERS.2014.8077539},
doi = {10.1109/WHISPERS.2014.8077539},
timestamp = {Mon, 04 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/whispers/RozelCDQ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DoustiP14,
author = {Mohammad Javad Dousti and
Massoud Pedram},
title = {Minimizing the Latency of Quantum Circuits during Mapping to the Ion-Trap
Circuit Fabric},
journal = {CoRR},
volume = {abs/1412.8003},
year = {2014},
url = {http://arxiv.org/abs/1412.8003},
eprinttype = {arXiv},
eprint = {1412.8003},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DoustiP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DoustiSP14,
author = {Mohammad Javad Dousti and
Alireza Shafaei and
Massoud Pedram},
title = {Squash: {A} Scalable Quantum Mapper Considering Ancilla Sharing},
journal = {CoRR},
volume = {abs/1412.8004},
year = {2014},
url = {http://arxiv.org/abs/1412.8004},
eprinttype = {arXiv},
eprint = {1412.8004},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DoustiSP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Hasegawa14,
author = {Hideo Hasegawa},
title = {Quantum tunneling and orthogonality time in an exactly solvable coupled
double-well system},
journal = {CoRR},
volume = {abs/1403.0543},
year = {2014},
url = {http://arxiv.org/abs/1403.0543},
eprinttype = {arXiv},
eprint = {1403.0543},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/Hasegawa14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BosCNS14,
author = {Joppe W. Bos and
Craig Costello and
Michael Naehrig and
Douglas Stebila},
title = {Post-quantum key exchange for the {TLS} protocol from the ring learning
with errors problem},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {599},
year = {2014},
url = {http://eprint.iacr.org/2014/599},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BosCNS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/ndltd/Goncalves13,
author = {Douglas Soares Gon{\c{c}}alves},
title = {Mathematical methods in quantum state tomography},
school = {University of Campinas, Brazil},
year = {2013},
url = {http://repositorio.unicamp.br/jspui/handle/REPOSIP/305944},
timestamp = {Mon, 05 Feb 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/phd/ndltd/Goncalves13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/DiasP13,
author = {Douglas Mota Dias and
Marco Aur{\'{e}}lio Cavalcanti Pacheco},
title = {Quantum-Inspired Linear Genetic Programming as a Knowledge Management
System},
journal = {Comput. J.},
volume = {56},
number = {9},
pages = {1043--1062},
year = {2013},
url = {https://doi.org/10.1093/comjnl/bxs108},
doi = {10.1093/COMJNL/BXS108},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/DiasP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cstat/ChenG13,
author = {Cathy W. S. Chen and
Richard Gerlach},
title = {Semi-parametric quantile estimation for double threshold autoregressive
models with heteroskedasticity},
journal = {Comput. Stat.},
volume = {28},
number = {3},
pages = {1103--1131},
year = {2013},
url = {https://doi.org/10.1007/s00180-012-0346-9},
doi = {10.1007/S00180-012-0346-9},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cstat/ChenG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/MiaoYZ13,
author = {Zhengke Miao and
Dong Ye and
Cun{-}Quan Zhang},
title = {Circuit extension and circuit double cover of graphs},
journal = {Discret. Math.},
volume = {313},
number = {20},
pages = {2055--2060},
year = {2013},
url = {https://doi.org/10.1016/j.disc.2013.06.019},
doi = {10.1016/J.DISC.2013.06.019},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/MiaoYZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/ZhangM13,
author = {Xianyong Zhang and
Duoqian Miao},
title = {Two basic double-quantitative rough set models of precision and grade
and their investigation using granular computing},
journal = {Int. J. Approx. Reason.},
volume = {54},
number = {8},
pages = {1130--1148},
year = {2013},
url = {https://doi.org/10.1016/j.ijar.2013.02.005},
doi = {10.1016/J.IJAR.2013.02.005},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijar/ZhangM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jam/OzarslanA13,
author = {Mehmet Ali {\"{O}}zarslan and
H{\"{u}}seyin Aktuglu},
title = {Quantitative Global Estimates for Generalized Double Szasz-Mirakjan
Operators},
journal = {J. Appl. Math.},
volume = {2013},
pages = {613258:1--613258:8},
year = {2013},
url = {https://doi.org/10.1155/2013/613258},
doi = {10.1155/2013/613258},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jam/OzarslanA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jim/GuCXCTN13,
author = {Nong Gu and
Zhiqiang Cao and
Liangjun Xie and
Douglas C. Creighton and
Min Tan and
Saeid Nahavandi},
title = {Identification of concurrent control chart patterns with singular
spectrum analysis and learning vector quantization},
journal = {J. Intell. Manuf.},
volume = {24},
number = {6},
pages = {1241--1252},
year = {2013},
url = {https://doi.org/10.1007/s10845-012-0659-0},
doi = {10.1007/S10845-012-0659-0},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jim/GuCXCTN13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SantiagoPM13,
author = {Douglas F. G. Santiago and
Renato Portugal and
Nolmar Melo},
title = {Non-Pauli observables for {CWS} codes},
journal = {Quantum Inf. Process.},
volume = {12},
number = {5},
pages = {1871--1884},
year = {2013},
url = {https://doi.org/10.1007/s11128-012-0501-9},
doi = {10.1007/S11128-012-0501-9},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/SantiagoPM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/YangXJZ13a,
author = {Yu{-}Guang Yang and
Juan Xia and
Xin Jia and
Hua Zhang},
title = {Novel image encryption/decryption based on quantum Fourier transform
and double phase encoding},
journal = {Quantum Inf. Process.},
volume = {12},
number = {11},
pages = {3477--3493},
year = {2013},
url = {https://doi.org/10.1007/s11128-013-0612-y},
doi = {10.1007/S11128-013-0612-Y},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/YangXJZ13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigbed/WeiLHMZTLML13,
author = {Yi{-}Hung Wei and
Quan Leng and
Song Han and
Aloysius K. Mok and
Wenlong Zhang and
Masayoshi Tomizuka and
Tianji Li and
David Malone and
Douglas J. Leith},
title = {RT-WiFi: real-time high speed communication protocol for wireless
control systems},
journal = {{SIGBED} Rev.},
volume = {10},
number = {2},
pages = {28},
year = {2013},
url = {https://doi.org/10.1145/2518148.2518166},
doi = {10.1145/2518148.2518166},
timestamp = {Thu, 19 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigbed/WeiLHMZTLML13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/YoonQD13,
author = {Byung{-}Jun Yoon and
Xiaoning Qian and
Edward R. Dougherty},
title = {Quantifying the Objective Cost of Uncertainty in Complex Dynamical
Systems},
journal = {{IEEE} Trans. Signal Process.},
volume = {61},
number = {9},
pages = {2256--2266},
year = {2013},
url = {https://doi.org/10.1109/TSP.2013.2251336},
doi = {10.1109/TSP.2013.2251336},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tsp/YoonQD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ascc/LiDS013,
author = {Mu Li and
Lihua Dou and
Haoyuan Sun and
Jian Sun},
title = {Stability analysis of dynamic quantized systems With time-varying
delay},
booktitle = {9th Asian Control Conference, {ASCC} 2013, Istanbul, Turkey, June
23-26, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ASCC.2013.6606006},
doi = {10.1109/ASCC.2013.6606006},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/ascc/LiDS013.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ciasg/QuanSKNC13,
author = {Hao Quan and
Dipti Srinivasan and
Abbas Khosravi and
Saeid Nahavandi and
Douglas C. Creighton},
title = {Construction of neural network-based prediction intervals for short-term
electrical load forecasting},
booktitle = {{IEEE} Symposium on Computational Intelligence Applications in Smart
Grid, {CIASG} 2013, Singapore, April 16-19, 2013},
pages = {66--72},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CIASG.2013.6611500},
doi = {10.1109/CIASG.2013.6611500},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ciasg/QuanSKNC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/closer/FallOCKY13,
author = {Doudou Fall and
Takeshi Okuda and
Noppawat Chaisamran and
Youki Kadobayashi and
Suguru Yamaguchi},
editor = {Fr{\'{e}}d{\'{e}}ric Desprez and
Donald Ferguson and
Ethan Hadar and
Frank Leymann and
Matthias Jarke and
Markus Helfert},
title = {Security Quantification of Complex Attacks in Infrastructure as a
Service Cloud Computing},
booktitle = {{CLOSER} 2013 - Proceedings of the 3rd International Conference on
Cloud Computing and Services Science, Aachen, Germany, 8-10 May, 2013},
pages = {145--148},
publisher = {SciTePress},
year = {2013},
timestamp = {Wed, 29 Mar 2017 16:45:24 +0200},
biburl = {https://dblp.org/rec/conf/closer/FallOCKY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/HamerD13,
author = {Aaron Hamer and
Leonidas A. A. Doumas},
editor = {Markus Knauff and
Michael Pauen and
Natalie Sebanz and
Ipke Wachsmuth},
title = {Discovering Quantification and Number in a Role-Filler Model},
booktitle = {Proceedings of the 35th Annual Meeting of the Cognitive Science Society,
CogSci 2013, Berlin, Germany, July 31 - August 3, 2013},
publisher = {cognitivesciencesociety.org},
year = {2013},
url = {https://escholarship.org/uc/item/4t0236ws},
timestamp = {Tue, 30 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/HamerD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/crypto/BroadbentGS13,
author = {Anne Broadbent and
Gus Gutoski and
Douglas Stebila},
editor = {Ran Canetti and
Juan A. Garay},
title = {Quantum One-Time Programs - (Extended Abstract)},
booktitle = {Advances in Cryptology - {CRYPTO} 2013 - 33rd Annual Cryptology Conference,
Santa Barbara, CA, USA, August 18-22, 2013. Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {8043},
pages = {344--360},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40084-1\_20},
doi = {10.1007/978-3-642-40084-1\_20},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/crypto/BroadbentGS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/DoustiP13,
author = {Mohammad Javad Dousti and
Massoud Pedram},
title = {{LEQA:} latency estimation for a quantum algorithm mapped to a quantum
circuit fabric},
booktitle = {The 50th Annual Design Automation Conference 2013, {DAC} '13, Austin,
TX, USA, May 29 - June 07, 2013},
pages = {42:1--42:7},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2463209.2488786},
doi = {10.1145/2463209.2488786},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/DoustiP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpec/BaldwinWT13,
author = {A. Taylor Baldwin and
Jeffrey Will and
Douglas Tougaw},
title = {An improved eigensolver for quantum-dot cellular automata simulations},
booktitle = {{IEEE} High Performance Extreme Computing Conference, {HPEC} 2013,
Waltham, MA, USA, September 10-12, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/HPEC.2013.6670316},
doi = {10.1109/HPEC.2013.6670316},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/hpec/BaldwinWT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iciap/GalvanPBB13,
author = {Fausto Galvan and
Giovanni Puglisi and
Arcangelo Bruna and
Sebastiano Battiato},
editor = {Alfredo Petrosino},
title = {First Quantization Coefficient Extraction from Double Compressed {JPEG}
Images},
booktitle = {Image Analysis and Processing - {ICIAP} 2013 - 17th International
Conference, Naples, Italy, September 9-13, 2013. Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {8156},
pages = {783--792},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-41181-6\_79},
doi = {10.1007/978-3-642-41181-6\_79},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/iciap/GalvanPBB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icicdt/ChienSVK13,
author = {Nguyen Dang Chien and
Chun{-}Hsing Shih and
Luu The Vinh and
Nguyen Van Kien},
title = {Quantum confinement effect in strained-Si1-xGex double-gate tunnel
field-effect transistors},
booktitle = {Proceedings of 2013 International Conference on {IC} Design {\&}
Technology, {ICICDT} 2013, Pavia, Italy, May 29-31, 2013},
pages = {73--76},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICICDT.2013.6563306},
doi = {10.1109/ICICDT.2013.6563306},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icicdt/ChienSVK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/TagliasacchiSDT13,
author = {Marco Tagliasacchi and
Marco Visentini Scarzanella and
Pier Luigi Dragotti and
Stefano Tubaro},
title = {Transform coder identification with double quantized data},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2013,
Melbourne, Australia, September 15-18, 2013},
pages = {1660--1664},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICIP.2013.6738342},
doi = {10.1109/ICIP.2013.6738342},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/TagliasacchiSDT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ZhanZYHH13,
author = {Xin Zhan and
Rong Zhang and
Dong Yin and
Anzhou Hu and
Wenlong Hu},
title = {Remote sensing image compression based on double-sparsity dictionary
learning and universal trellis coded quantization},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2013,
Melbourne, Australia, September 15-18, 2013},
pages = {1665--1669},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICIP.2013.6738343},
doi = {10.1109/ICIP.2013.6738343},
timestamp = {Tue, 09 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/ZhanZYHH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsh/DouJLTWQZLLSGLW13,
author = {Xiangfeng Dou and
Yi Jiang and
Changying Lin and
Lili Tian and
Xiaoli Wang and
Kaikun Qian and
Xiuchun Zhang and
Xinyu Li and
Yanning Lyu and
Yulan Sun and
Zengzhi Guan and
Shuang Li and
Quanyi Wang},
editor = {Daniel Zeng and
Christopher C. Yang and
Vincent S. Tseng and
Chunxiao Xing and
Hsinchun Chen and
Fei{-}Yue Wang and
Xiaolong Zheng},
title = {Spatial, Temporal, and Space-Time Clusters of Hemorrhagic Fever with
Renal Syndrome in Beijing, China},
booktitle = {Smart Health - International Conference, {ICSH} 2013, Beijing, China,
August 3-4, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8040},
pages = {33--40},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39844-5\_6},
doi = {10.1007/978-3-642-39844-5\_6},
timestamp = {Mon, 15 May 2023 16:24:40 +0200},
biburl = {https://dblp.org/rec/conf/icsh/DouJLTWQZLLSGLW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/OuZQLHYYCFZLJZY13,
author = {Peng Ou and
Jiajie Zhang and
Heng Quan and
Yi Li and
Maofei He and
Zheng Yu and
Xueqiu Yu and
Shile Cui and
Jie Feng and
Shikai Zhu and
Jie Lin and
Ming{-}e Jing and
Xiaoyang Zeng and
Zhiyi Yu},
title = {A 65nm 39GOPS/W 24-core processor with 11Tb/s/W packet-controlled
circuit-switched double-layer network-on-chip and heterogeneous execution
array},
booktitle = {2013 {IEEE} International Solid-State Circuits Conference - Digest
of Technical Papers, {ISSCC} 2013, San Francisco, CA, USA, February
17-21, 2013},
pages = {56--57},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISSCC.2013.6487635},
doi = {10.1109/ISSCC.2013.6487635},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/OuZQLHYYCFZLJZY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/milcom/WangFCGCH13,
author = {Qi Wang and
Hao Feng and
Leonard J. Cimini Jr. and
Larry J. Greenstein and
Douglas S. Chan and
Ahmadreza Hedayat},
editor = {Joe Senftle and
Mike Beltrani and
Kari Karwedsky},
title = {Sparse Coding Quantization for Downlink {MU-MIMO} with Limited {CSI}
Feedback},
booktitle = {32th {IEEE} Military Communications Conference, {MILCOM} 2013, San
Diego, CA, USA, November 18-20, 2013},
pages = {1268--1272},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/MILCOM.2013.216},
doi = {10.1109/MILCOM.2013.216},
timestamp = {Mon, 23 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/milcom/WangFCGCH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pqcrypto/MoscaSU13,
author = {Michele Mosca and
Douglas Stebila and
Berkant Ustaoglu},
editor = {Philippe Gaborit},
title = {Quantum Key Distribution in the Classical Authenticated Key Exchange
Framework},
booktitle = {Post-Quantum Cryptography - 5th International Workshop, PQCrypto 2013,
Limoges, France, June 4-7, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7932},
pages = {136--154},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38616-9\_9},
doi = {10.1007/978-3-642-38616-9\_9},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pqcrypto/MoscaSU13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sblp/VizzottoCP13,
author = {Juliana Kaizer Vizzotto and
Bruno Crestani Calegaro and
Eduardo Kessler Piveta},
editor = {Andr{\'{e}} Rauber Du Bois and
Phil Trinder},
title = {A Double Effect {\(\lambda\)}-calculus for Quantum Computation},
booktitle = {Programming Languages - 17th Brazilian Symposium, {SBLP} 2013, Bras{\'{\i}}lia,
Brazil, October 3 - 4, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8129},
pages = {61--74},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40922-6\_5},
doi = {10.1007/978-3-642-40922-6\_5},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sblp/VizzottoCP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uksim/HassanHNC13,
author = {Marwa Hassan and
Mohammed Hossny and
Saeid Nahavandi and
Douglas C. Creighton},
editor = {David Al{-}Dabass and
Alessandra Orsoni and
Jasmy Yunus and
Richard J. Cant and
Zuwairie Ibrahim},
title = {Quantifying Heteroskedasticity Using Slope of Local Variances Index},
booktitle = {15th International Conference on Computer Modelling and Simulation,
UKSim 2013, Cambridge, United Kingdom, April 10-12, 2013},
pages = {107--111},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/UKSim.2013.75},
doi = {10.1109/UKSIM.2013.75},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/uksim/HassanHNC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uksim/HassanHNC13a,
author = {Marwa Hassan and
Mohammed Hossny and
Saeid Nahavandi and
Douglas C. Creighton},
editor = {David Al{-}Dabass and
Alessandra Orsoni and
Jasmy Yunus and
Richard J. Cant and
Zuwairie Ibrahim},
title = {Quantifying Heteroskedasticity via Binary Decomposition},
booktitle = {15th International Conference on Computer Modelling and Simulation,
UKSim 2013, Cambridge, United Kingdom, April 10-12, 2013},
pages = {112--116},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/UKSim.2013.76},
doi = {10.1109/UKSIM.2013.76},
timestamp = {Mon, 05 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uksim/HassanHNC13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Kuusisto13,
author = {Antti Kuusisto},
title = {A Double Team Semantics for Generalized Quantifiers},
journal = {CoRR},
volume = {abs/1310.3032},
year = {2013},
url = {http://arxiv.org/abs/1310.3032},
eprinttype = {arXiv},
eprint = {1310.3032},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/Kuusisto13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BroadbentGS13,
author = {Anne Broadbent and
Gus Gutoski and
Douglas Stebila},
title = {Quantum one-time programs},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {343},
year = {2013},
url = {http://eprint.iacr.org/2013/343},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BroadbentGS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/DoustiJ13,
author = {Mohammad Sadeq Dousti and
Rasool Jalili},
title = {Efficient Statistical Zero-Knowledge Authentication Protocols for
Smart Cards Secure Against Active {\&} Concurrent Quantum Attacks},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {709},
year = {2013},
url = {http://eprint.iacr.org/2013/709},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/DoustiJ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ObergM12,
author = {Ann L. Oberg and
Douglas W. Mahoney},
title = {Statistical methods for quantitative mass spectrometry proteomic experiments
with labeling},
journal = {{BMC} Bioinform.},
volume = {13},
number = {{S-16}},
pages = {S7},
year = {2012},
url = {https://doi.org/10.1186/1471-2105-13-S16-S7},
doi = {10.1186/1471-2105-13-S16-S7},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/ObergM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/QuanWDXG12,
author = {Xiaojun Quan and
Liu Wenyin and
Wenyu Dou and
Hui Xiong and
Yong Ge},
title = {Link Graph Analysis for Business Site Selection},
journal = {Computer},
volume = {45},
number = {3},
pages = {64--69},
year = {2012},
url = {https://doi.org/10.1109/MC.2011.260},
doi = {10.1109/MC.2011.260},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/QuanWDXG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csda/LinHP12,
author = {Guixian Lin and
Xuming He and
Stephen Portnoy},
title = {Quantile regression with doubly censored data},
journal = {Comput. Stat. Data Anal.},
volume = {56},
number = {4},
pages = {797--812},
year = {2012},
url = {https://doi.org/10.1016/j.csda.2011.03.009},
doi = {10.1016/J.CSDA.2011.03.009},
timestamp = {Wed, 23 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csda/LinHP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/ZhangZ12,
author = {Xiao{-}Dong Zhang and
Cun{-}Quan Zhang},
title = {Kotzig frames and circuit double covers},
journal = {Discret. Math.},
volume = {312},
number = {1},
pages = {174--180},
year = {2012},
url = {https://doi.org/10.1016/j.disc.2011.07.025},
doi = {10.1016/J.DISC.2011.07.025},
timestamp = {Thu, 21 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dm/ZhangZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejc/YeZ12,
author = {Dong Ye and
Cun{-}Quan Zhang},
title = {Cycle double covers and the semi-Kotzig frame},
journal = {Eur. J. Comb.},
volume = {33},
number = {4},
pages = {624--631},
year = {2012},
url = {https://doi.org/10.1016/j.ejc.2011.12.001},
doi = {10.1016/J.EJC.2011.12.001},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejc/YeZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/FengLD12,
author = {Quanyou Feng and
Huanzhong Li and
Wenhua Dou},
title = {A Hybrid Photonic Burst-Switched Interconnection Network for Large-Scale
Manycore System},
journal = {{IEICE} Trans. Inf. Syst.},
volume = {95-D},
number = {12},
pages = {2908--2918},
year = {2012},
url = {https://doi.org/10.1587/transinf.E95.D.2908},
doi = {10.1587/TRANSINF.E95.D.2908},
timestamp = {Sat, 11 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/FengLD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/KogaMFSMSS12,
author = {Takaaki Koga and
Toru Matsuura and
S{\'{e}}bastien Faniel and
Satofumi Souma and
Shunsuke Mineshige and
Yoshiaki Sekine and
Hiroki Sugiyama},
title = {Beating Analysis of Shubnikov de Haas Oscillation in In\({}_{\mbox{0.53}}\)Ga\({}_{\mbox{0.47}}\)As
Double Quantum Well toward Spin Filter Applications},
journal = {{IEICE} Trans. Electron.},
volume = {95-C},
number = {5},
pages = {770--776},
year = {2012},
url = {https://doi.org/10.1587/transele.E95.C.770},
doi = {10.1587/TRANSELE.E95.C.770},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/KogaMFSMSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcns/SunRZC12,
author = {Yi Sun and
Aaditya V. Rangan and
Douglas Zhou and
David Cai},
title = {Coarse-grained event tree analysis for quantifying Hodgkin-Huxley
neuronal network dynamics},
journal = {J. Comput. Neurosci.},
volume = {32},
number = {1},
pages = {55--72},
year = {2012},
url = {https://doi.org/10.1007/s10827-011-0339-7},
doi = {10.1007/S10827-011-0339-7},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcns/SunRZC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mscs/Hasegawa12,
author = {Masahito Hasegawa},
title = {A quantum double construction in Rel},
journal = {Math. Struct. Comput. Sci.},
volume = {22},
number = {4},
pages = {618--650},
year = {2012},
url = {https://doi.org/10.1017/S0960129511000703},
doi = {10.1017/S0960129511000703},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mscs/Hasegawa12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/MauneBHLDHKARSS12,
author = {Brett M. Maune and
Matthew G. Borselli and
Biqin Huang and
Thaddeus D. Ladd and
Peter W. Deelman and
Kevin S. Holabird and
Andrey A. Kiselev and
Ivan Alvarado{-}Rodriguez and
Richard S. Ross and
Adele E. Schmitz and
Marko Sokolich and
Christopher A. Watson and
Mark F. Gyure and
Andrew T. Hunter},
title = {Coherent singlet-triplet oscillations in a silicon-based double quantum
dot},
journal = {Nat.},
volume = {481},
number = {7381},
pages = {344--347},
year = {2012},
url = {https://doi.org/10.1038/nature10707},
doi = {10.1038/NATURE10707},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/MauneBHLDHKARSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HyderR12,
author = {Fahmeed Hyder and
Douglas L. Rothman},
title = {Quantitative fMRI and oxidative neuroenergetics},
journal = {NeuroImage},
volume = {62},
number = {2},
pages = {985--994},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.04.027},
doi = {10.1016/J.NEUROIMAGE.2012.04.027},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/HyderR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/WinklerSYFGKNBG12,
author = {Anderson M. Winkler and
Mert R. Sabuncu and
B. T. Thomas Yeo and
Bruce Fischl and
Douglas N. Greve and
Peter V. Kochunov and
Thomas E. Nichols and
John Blangero and
David C. Glahn},
title = {Measuring and comparing brain cortical surface area and other areal
quantities},
journal = {NeuroImage},
volume = {61},
number = {4},
pages = {1428--1443},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.03.026},
doi = {10.1016/J.NEUROIMAGE.2012.03.026},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/WinklerSYFGKNBG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qic/GoncalvesGLFR12,
author = {Douglas Soares Gon{\c{c}}alves and
M{\'{a}}rcia A. Gomes{-}Ruggiero and
Carlile Lavor and
Osvaldo Jim{\'{e}}nez Farias and
P. H. Souto Ribeiro},
title = {Local solutions of maximum likelihood estimation in quantum state
tomography},
journal = {Quantum Inf. Comput.},
volume = {12},
number = {9-10},
pages = {775--790},
year = {2012},
url = {https://doi.org/10.26421/QIC12.9-10-4},
doi = {10.26421/QIC12.9-10-4},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qic/GoncalvesGLFR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/speech/DjamahO12,
author = {Mouloud Djamah and
Douglas D. O'Shaughnessy},
title = {Fine granularity scalable speech coding using embedded tree-structured
vector quantization},
journal = {Speech Commun.},
volume = {54},
number = {1},
pages = {23--39},
year = {2012},
url = {https://doi.org/10.1016/j.specom.2011.06.002},
doi = {10.1016/J.SPECOM.2011.06.002},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/speech/DjamahO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/synthese/DouvenU12,
author = {Igor Douven and
Jos Uffink},
title = {Quantum probabilities and the conjunction principle},
journal = {Synth.},
volume = {184},
number = {1},
pages = {109--114},
year = {2012},
url = {https://doi.org/10.1007/s11229-009-9693-7},
doi = {10.1007/S11229-009-9693-7},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/synthese/DouvenU12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ZhangCXH12,
author = {Xiu Yin Zhang and
Chi Hou Chan and
Quan Xue and
Bin{-}Jie Hu},
title = {{RF} Tunable Bandstop Filters With Constant Bandwidth Based on a Doublet
Configuration},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {59},
number = {2},
pages = {1257--1265},
year = {2012},
url = {https://doi.org/10.1109/TIE.2011.2158038},
doi = {10.1109/TIE.2011.2158038},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/ZhangCXH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEcit/WangLFD12,
author = {Junhui Wang and
Baoliang Li and
Quanyou Feng and
Wenhua Dou},
title = {A Highly Scalable Butterfly-Based Photonic Network-on-Chip},
booktitle = {12th {IEEE} International Conference on Computer and Information Technology,
{CIT} 2012, Chengdu, Sichuan, China, October 27-29, 2012},
pages = {33--37},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/CIT.2012.31},
doi = {10.1109/CIT.2012.31},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEcit/WangLFD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/KongL12,
author = {Weihao Kong and
Wu{-}Jun Li},
editor = {J{\"{o}}rg Hoffmann and
Bart Selman},
title = {Double-Bit Quantization for Hashing},
booktitle = {Proceedings of the Twenty-Sixth {AAAI} Conference on Artificial Intelligence,
July 22-26, 2012, Toronto, Ontario, Canada},
pages = {634--640},
publisher = {{AAAI} Press},
year = {2012},
url = {https://doi.org/10.1609/aaai.v26i1.8208},
doi = {10.1609/AAAI.V26I1.8208},
timestamp = {Mon, 04 Sep 2023 15:56:47 +0200},
biburl = {https://dblp.org/rec/conf/aaai/KongL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/DiasP12,
author = {Douglas Mota Dias and
Marco Aur{\'{e}}lio Cavalcanti Pacheco},
title = {Describing Quantum-Inspired Linear Genetic Programming from symbolic
regression problems},
booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
2012, Brisbane, Australia, June 10-15, 2012},
pages = {1--8},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/CEC.2012.6256634},
doi = {10.1109/CEC.2012.6256634},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cec/DiasP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/DoustiP12,
author = {Mohammad Javad Dousti and
Massoud Pedram},
editor = {Wolfgang Rosenstiel and
Lothar Thiele},
title = {Minimizing the latency of quantum circuits during mapping to the ion-trap
circuit fabric},
booktitle = {2012 Design, Automation {\&} Test in Europe Conference {\&}
Exhibition, {DATE} 2012, Dresden, Germany, March 12-16, 2012},
pages = {840--843},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/DATE.2012.6176612},
doi = {10.1109/DATE.2012.6176612},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/DoustiP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/WangLYLC12,
author = {Yong Wang and
Yun Li and
Xiaolong Yang and
Chao Liao and
Quan Chen},
title = {Double auction-based optimal relay assignment for many-to-many cooperative
wireless networks},
booktitle = {2012 {IEEE} Global Communications Conference, {GLOBECOM} 2012, Anaheim,
CA, USA, December 3-7, 2012},
pages = {1635--1640},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/GLOCOM.2012.6503348},
doi = {10.1109/GLOCOM.2012.6503348},
timestamp = {Tue, 12 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/WangLYLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcc/FengCQD12,
author = {Quanyou Feng and
Jiannong Cao and
Yue Qian and
Wenhua Dou},
editor = {Geyong Min and
Jia Hu and
Lei (Chris) Liu and
Laurence Tianruo Yang and
Seetharami Seelam and
Laurent Lef{\`{e}}vre},
title = {An Analytical Approach to Modeling and Evaluation of Optical Chip-scale
Network using Stochastic Network Calculus},
booktitle = {14th {IEEE} International Conference on High Performance Computing
and Communication {\&} 9th {IEEE} International Conference on
Embedded Software and Systems, {HPCC-ICESS} 2012, Liverpool, United
Kingdom, June 25-27, 2012},
pages = {1039--1046},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HPCC.2012.152},
doi = {10.1109/HPCC.2012.152},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpcc/FengCQD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/PanD12,
author = {Guanyu Pan and
Quansheng Dou},
title = {Load forecasting model based on multi-agents cooperation},
booktitle = {Eighth International Conference on Natural Computation, {ICNC} 2012,
29-31 May 2012, Chongqing, China},
pages = {1197--1202},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICNC.2012.6234721},
doi = {10.1109/ICNC.2012.6234721},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/icnc/PanD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iftc/YangZ12,
author = {Shuang Yang and
Fang Zhen},
editor = {Wenjun Zhang and
Xiaokang Yang and
Zhixiang Xu and
Ping An and
Qizhen Liu and
Yue Lu},
title = {Primary Quality Factor Estimation in Double Compressed {JPEG} Images
Using Quantization Error},
booktitle = {Advances on Digital Television and Wireless Multimedia Communications
- 9th International Forum on Digital {TV} and Wireless Multimedia
Communication, {IFTC} 2012, Shanghai, China, November 9-10, 2012.
Proceedings},
series = {Communications in Computer and Information Science},
volume = {331},
pages = {133--139},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-34595-1\_19},
doi = {10.1007/978-3-642-34595-1\_19},
timestamp = {Thu, 19 Jul 2018 11:18:54 +0200},
biburl = {https://dblp.org/rec/conf/iftc/YangZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/KhosraviNCN12,
author = {Abbas Khosravi and
Saeid Nahavandi and
Douglas C. Creighton and
Reihaneh Naghavizadeh},
title = {Uncertainty quantification for wind farm power generation},
booktitle = {The 2012 International Joint Conference on Neural Networks (IJCNN),
Brisbane, Australia, June 10-15, 2012},
pages = {1--6},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IJCNN.2012.6252405},
doi = {10.1109/IJCNN.2012.6252405},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/KhosraviNCN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/RettmannGHPR12,
author = {Maryam E. Rettmann and
Mia S. Gunawan and
David R. Holmes III and
Douglas L. Packer and
Richard A. Robb},
title = {Quantification of pulmonary vein morphology using centerline tracking},
booktitle = {9th {IEEE} International Symposium on Biomedical Imaging: From Nano
to Macro, {ISBI} 2012, May 2-5, 2012, Barcelona, Spain, Proceedings},
pages = {816--819},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISBI.2012.6235673},
doi = {10.1109/ISBI.2012.6235673},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/isbi/RettmannGHPR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uksim/VermaJGG12,
author = {Neha Verma and
Jyotika Jogi and
Mridula Gupta and
R. S. Gupta},
editor = {David Al{-}Dabass and
Alessandra Orsoni and
Richard J. Cant},
title = {Simulation of Enhanced Gate Control in a Double Gate Quantum Domain
InAlAs/InGaAs/InP {HEMT}},
booktitle = {14th International Conference on Computer Modelling and Simulation,
2012 UKSim, Cambridge, United Kingdom, March 28-30, 2012},
pages = {660--664},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/UKSim.2012.101},
doi = {10.1109/UKSIM.2012.101},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uksim/VermaJGG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/DonlonVBGCRNPMFR12,
author = {Ben Donlon and
Douglas Veale and
Patrick C. Brennan and
Robert Gibney and
Hamish A. Carr and
Louise Rainford and
ChinTeck Ng and
Eliza Pontifex and
Jonathan P. McNulty and
Oliver FitzGerald and
John Ryan},
editor = {Lars Linsen and
Hans Hagen and
Bernd Hamann and
Hans{-}Christian Hege},
title = {MRI-Based Visualisation and Quantification of Rheumatoid and Psoriatic
Arthritis of the Knee},
booktitle = {Visualization in Medicine and Life Sciences {II} - Progress and New
Challenges},
series = {Mathematics and visualization},
pages = {45--59},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-21608-4\_3},
doi = {10.1007/978-3-642-21608-4\_3},
timestamp = {Thu, 14 Oct 2021 08:45:49 +0200},
biburl = {https://dblp.org/rec/books/daglib/p/DonlonVBGCRNPMFR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1204-2218,
author = {Nolmar Melo and
Douglas F. G. Santiago and
Renato Portugal},
title = {Decoder for Nonbinary {CWS} Quantum Codes},
journal = {CoRR},
volume = {abs/1204.2218},
year = {2012},
url = {http://arxiv.org/abs/1204.2218},
eprinttype = {arXiv},
eprint = {1204.2218},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1204-2218.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1210-1550,
author = {Hari Krovi and
Alexander Russell},
title = {Quantum Fourier Transforms and the Complexity of Link Invariants for
Quantum Doubles of Finite Groups},
journal = {CoRR},
volume = {abs/1210.1550},
year = {2012},
url = {http://arxiv.org/abs/1210.1550},
eprinttype = {arXiv},
eprint = {1210.1550},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1210-1550.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1211-1080,
author = {Anne Broadbent and
Gus Gutoski and
Douglas Stebila},
title = {Quantum one-time programs},
journal = {CoRR},
volume = {abs/1211.1080},
year = {2012},
url = {http://arxiv.org/abs/1211.1080},
eprinttype = {arXiv},
eprint = {1211.1080},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1211-1080.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/MoscaSU12,
author = {Michele Mosca and
Douglas Stebila and
Berkant Ustaoglu},
title = {Quantum Key Distribution in the Classical Authenticated Key Exchange
Framework},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {361},
year = {2012},
url = {http://eprint.iacr.org/2012/361},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/MoscaSU12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aes/LiSS11,
author = {P. C. Li and
K. P. Song and
F. H. Shang},
title = {Double chains quantum genetic algorithm with application to neuro-fuzzy
controller design},
journal = {Adv. Eng. Softw.},
volume = {42},
number = {10},
pages = {875--886},
year = {2011},
url = {https://doi.org/10.1016/j.advengsoft.2011.06.006},
doi = {10.1016/J.ADVENGSOFT.2011.06.006},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aes/LiSS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/WangXC11,
author = {Hong Wang and
Da{-}Quan Xian and
Han{-}lin Chen},
title = {Homoclinic breather-wave solutions and doubly periodic wave solutions
for coupled KdV equations},
journal = {Appl. Math. Comput.},
volume = {218},
number = {2},
pages = {610--615},
year = {2011},
url = {https://doi.org/10.1016/j.amc.2011.05.112},
doi = {10.1016/J.AMC.2011.05.112},
timestamp = {Tue, 21 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/amc/WangXC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/HyderHSCBR11,
author = {Fahmeed Hyder and
Peter Herman and
Basavaraju G. Sanganahalli and
Daniel Coman and
Hal Blumenfeld and
Douglas L. Rothman},
title = {Role of Ongoing, Intrinsic Activity of Neuronal Populations for Quantitative
Neuroimaging of Functional Magnetic Resonance Imaging-Based Networks},
journal = {Brain Connect.},
volume = {1},
number = {3},
pages = {185--193},
year = {2011},
url = {https://doi.org/10.1089/brain.2011.0032},
doi = {10.1089/BRAIN.2011.0032},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/brain/HyderHSCBR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cars/LiuGS11,
author = {Sheena Xin Liu and
Luis F. Guti{\'{e}}rrez and
Douglas Stanton},
title = {Quantitative evaluation for accumulative calibration error and video-CT
registration errors in electromagnetic-tracked endoscopy},
journal = {Int. J. Comput. Assist. Radiol. Surg.},
volume = {6},
number = {3},
pages = {407--419},
year = {2011},
url = {https://doi.org/10.1007/s11548-010-0518-4},
doi = {10.1007/S11548-010-0518-4},
timestamp = {Thu, 11 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cars/LiuGS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cphysics/TangTG11,
author = {Chi{-}Shung Tang and
Kristinn Torfason and
Vidar Gudmundsson},
title = {Magnetotransport in a time-modulated double quantum point contact
system},
journal = {Comput. Phys. Commun.},
volume = {182},
number = {1},
pages = {65--67},
year = {2011},
url = {https://doi.org/10.1016/j.cpc.2010.06.023},
doi = {10.1016/J.CPC.2010.06.023},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cphysics/TangTG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/GroveJ11,
author = {Clayton Grove and
Dougal A. Jerram},
title = {jPOR: An ImageJ macro to quantify total optical porosity from blue-stained
thin sections},
journal = {Comput. Geosci.},
volume = {37},
number = {11},
pages = {1850--1859},
year = {2011},
url = {https://doi.org/10.1016/j.cageo.2011.03.002},
doi = {10.1016/J.CAGEO.2011.03.002},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/gandc/GroveJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcse/WangLFZ11,
author = {Xiaoyan Wang and
Quan Liu and
Qi{-}ming Fu and
Le Zhang},
title = {Double elite co-evolutionary genetic algorithm},
journal = {Int. J. Comput. Sci. Eng.},
volume = {6},
number = {1/2},
pages = {67--75},
year = {2011},
url = {https://doi.org/10.1504/IJCSE.2011.041214},
doi = {10.1504/IJCSE.2011.041214},
timestamp = {Fri, 22 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcse/WangLFZ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/ValkenhoefTBP11,
author = {Gert van Valkenhoef and
Tommi Tervonen and
Bert de Brock and
Douwe Postmus},
title = {Quantitative release planning in extreme programming},
journal = {Inf. Softw. Technol.},
volume = {53},
number = {11},
pages = {1227--1235},
year = {2011},
url = {https://doi.org/10.1016/j.infsof.2011.05.007},
doi = {10.1016/J.INFSOF.2011.05.007},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/infsof/ValkenhoefTBP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/Kwon11,
author = {Jae{-}Hoon Kwon},
title = {Crystal bases of modified quantized enveloping algebras and a double
{RSK} correspondence},
journal = {J. Comb. Theory {A}},
volume = {118},
number = {7},
pages = {2131--2156},
year = {2011},
url = {https://doi.org/10.1016/j.jcta.2011.04.006},
doi = {10.1016/J.JCTA.2011.04.006},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/Kwon11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/NguyenTRN11,
author = {Hong{-}Quang Nguyen and
David Taniar and
J. Wenny Rahayu and
Kinh Nguyen},
title = {Double-layered schema integration of heterogeneous {XML} sources},
journal = {J. Syst. Softw.},
volume = {84},
number = {1},
pages = {63--76},
year = {2011},
url = {https://doi.org/10.1016/j.jss.2010.07.055},
doi = {10.1016/J.JSS.2010.07.055},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jss/NguyenTRN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/MajkusiakBMG11,
author = {Bogdan Majkusiak and
Romuald B. Beck and
Andrzej Mazurak and
J. Grabowski},
title = {Investigation of double barrier {MOS} tunnel diodes with {PECVD} silicon
quantum well},
journal = {Microelectron. Reliab.},
volume = {51},
number = {7},
pages = {1172--1177},
year = {2011},
url = {https://doi.org/10.1016/j.microrel.2011.03.018},
doi = {10.1016/J.MICROREL.2011.03.018},
timestamp = {Fri, 16 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mr/MajkusiakBMG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/JegouDS11,
author = {Herv{\'{e}} J{\'{e}}gou and
Matthijs Douze and
Cordelia Schmid},
title = {Product Quantization for Nearest Neighbor Search},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {33},
number = {1},
pages = {117--128},
year = {2011},
url = {https://doi.org/10.1109/TPAMI.2010.57},
doi = {10.1109/TPAMI.2010.57},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pami/JegouDS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/MorrisSCSL11,
author = {Melody K. Morris and
Julio Saez{-}Rodriguez and
David C. Clarke and
Peter K. Sorger and
Douglas A. Lauffenburger},
title = {Training Signaling Pathway Maps to Biochemical Data with Constrained
Fuzzy Logic: Quantitative Analysis of Liver Cell Responses to Inflammatory
Stimuli},
journal = {PLoS Comput. Biol.},
volume = {7},
number = {3},
year = {2011},
url = {https://doi.org/10.1371/journal.pcbi.1001099},
doi = {10.1371/JOURNAL.PCBI.1001099},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ploscb/MorrisSCSL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asicon/WangJS11,
author = {Luo Wang and
Huihui Ji and
Quan Sun},
title = {A sigma-delta modulator with a novel chopper correlated double sampled
integrator},
booktitle = {2011 {IEEE} 9th International Conference on ASIC, {ASICON} 2011, Xiamen,
China, October 25-28, 2011},
pages = {449--452},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ASICON.2011.6157218},
doi = {10.1109/ASICON.2011.6157218},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/asicon/WangJS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/DiasPN11,
author = {Douglas Mota Dias and
Mauricio Pamplona Pires and
Omar Paranaiba Vilela Neto},
title = {Self-assembly quantum dots growth prediction by quantum-inspired linear
genetic programming},
booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
2011, New Orleans, LA, USA, 5-8 June, 2011},
pages = {2075--2082},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/CEC.2011.5949871},
doi = {10.1109/CEC.2011.5949871},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cec/DiasPN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chinacom/DouZJSZSM11,
author = {Zhibin Dou and
Zenghua Zhao and
Quan Jin and
Gaotao Shi and
Lianfang Zhang and
Yantai Shu and
Maode Ma},
title = {Understanding link-level characterization of long-distance 802.11g
semi-urban links},
booktitle = {6th International {ICST} Conference on Communications and Networking
in China, {CHINACOM} 2011, Harbin, China, August 17-19, 2011},
pages = {459--464},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ChinaCom.2011.6158198},
doi = {10.1109/CHINACOM.2011.6158198},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/chinacom/DouZJSZSM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/McMillanRCCG11,
author = {Corey McMillan and
Neville Ryant and
Danielle Coleman and
Robin Clark and
Murray Grossman},
editor = {Laura A. Carlson and
Christoph H{\"{o}}lscher and
Thomas F. Shipley},
title = {Strategic Resources Support the Interpretation of Doubly-Quantified
Sentences},
booktitle = {Proceedings of the 33th Annual Meeting of the Cognitive Science Society,
CogSci 2011, Boston, Massachusetts, USA, July 20-23, 2011},
publisher = {cognitivesciencesociety.org},
year = {2011},
url = {https://mindmodeling.org/cogsci2011/papers/0577/index.html},
timestamp = {Wed, 17 Apr 2024 12:44:29 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/McMillanRCCG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/CupertinoSDPB11,
author = {Leandro F. Cupertino and
Cleomar Pereira da Silva and
Douglas Mota Dias and
Marco Aur{\'{e}}lio Cavalcanti Pacheco and
Cristiana Bentes},
editor = {Natalio Krasnogor and
Pier Luca Lanzi},
title = {Evolving {CUDA} {PTX} programs by quantum inspired linear genetic
programming},
booktitle = {13th Annual Genetic and Evolutionary Computation Conference, {GECCO}
2011, Companion Material Proceedings, Dublin, Ireland, July 12-16,
2011},
pages = {399--406},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2001858.2002026},
doi = {10.1145/2001858.2002026},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/CupertinoSDPB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/QuanWD11,
author = {Xiaojun Quan and
Liu Wenyin and
Wenyu Dou},
editor = {Myra Spiliopoulou and
Haixun Wang and
Diane J. Cook and
Jian Pei and
Wei Wang and
Osmar R. Za{\"{\i}}ane and
Xindong Wu},
title = {Longitudinal Sales Responses with Online Reviews},
booktitle = {Data Mining Workshops (ICDMW), 2011 {IEEE} 11th International Conference
on, Vancouver, BC, Canada, December 11, 2011},
pages = {103--108},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICDMW.2011.115},
doi = {10.1109/ICDMW.2011.115},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/QuanWD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeecmc/BanFHYJD11,
author = {Dongsong Ban and
Quanyou Feng and
Gang Han and
Wei Yang and
Jie Jiang and
Wenhua Dou},
editor = {Dongfeng Yuan and
Maoyong Cao and
Cheng{-}Xiang Wang and
Hua Huang},
title = {Distributed Scheduling Algorithm for Barrier Coverage in Wireless
Sensor Networks},
booktitle = {Third International Conference on Communications and Mobile Computing,
{CMC} 2011, Qingdao, China, 18-20 April 2011},
pages = {481--484},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/CMC.2011.14},
doi = {10.1109/CMC.2011.14},
timestamp = {Mon, 19 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ieeecmc/BanFHYJD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/Bagher-EbadianNABMJNE11,
author = {Hassan Bagher{-}Ebadian and
Siamak P. Nejad{-}Davarani and
Meser M. Ali and
Stephen Brown and
Malek Makki and
Quan Jiang and
Douglas C. Noll and
James R. Ewing},
title = {Magnetic resonance imaging estimation of longitudinal relaxation rate
change ({\(\Delta\)}R1) in dual gradient echo sequences using an adaptive
model},
booktitle = {The 2011 International Joint Conference on Neural Networks, {IJCNN}
2011, San Jose, California, USA, July 31 - August 5, 2011},
pages = {2501--2506},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IJCNN.2011.6033544},
doi = {10.1109/IJCNN.2011.6033544},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/Bagher-EbadianNABMJNE11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mediaforensics/LiaoYLLH11,
author = {Dandan Liao and
Rui Yang and
Hongmei Liu and
Jian Li and
Jiwu Huang},
editor = {Nasir D. Memon and
Jana Dittmann and
Adnan M. Alattar and
Edward J. Delp III},
title = {Double {H.264/AVC} compression detection using quantized nonzero {AC}
coefficients},
booktitle = {Media Forensics and Security III, San Francisco Airport, CA, USA,
January 24-26, 2011, Proceedings},
series = {{SPIE} Proceedings},
volume = {7880},
pages = {78800Q},
publisher = {{SPIE}},
year = {2011},
url = {https://doi.org/10.1117/12.876566},
doi = {10.1117/12.876566},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mediaforensics/LiaoYLLH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/re/HeavenL11,
author = {William Heaven and
Emmanuel Letier},
title = {Simulating and optimising design decisions in quantitative goal models},
booktitle = {{RE} 2011, 19th {IEEE} International Requirements Engineering Conference,
Trento, Italy, August 29 2011 - September 2, 2011},
pages = {79--88},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/RE.2011.6051653},
doi = {10.1109/RE.2011.6051653},
timestamp = {Thu, 25 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/re/HeavenL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/PatraJM11,
author = {Jagdish Chandra Patra and
Lian Lian Jiang and
Douglas L. Maskell},
title = {Estimation of external quantum efficiency for multi-junction solar
cells under influence of charged particles using artificial neural
networks},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man
and Cybernetics, Anchorage, Alaska, USA, October 9-12, 2011},
pages = {465--470},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICSMC.2011.6083709},
doi = {10.1109/ICSMC.2011.6083709},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/smc/PatraJM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socpros/RajSD11,
author = {Balwinder Raj and
Ashok K. Saxena and
Sudeb Dasgupta},
editor = {Kusum Deep and
Atulya Nagar and
Millie Pant and
Jagdish Chand Bansal},
title = {Quantum Mechanical Analytical Drain Current Modeling and Simulation
for Double Gate FinFET Device Using Quasi Fermi Potential Approach},
booktitle = {Proceedings of the International Conference on Soft Computing for
Problem Solving (SocProS 2011) December 20-22, 2011 - Volume 2},
series = {Advances in Intelligent and Soft Computing},
volume = {131},
pages = {365--375},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-81-322-0491-6\_35},
doi = {10.1007/978-81-322-0491-6\_35},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/socpros/RajSD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1110-3649,
author = {Doug M. Boyer and
Yaron Lipman and
Elizabeth St. Clair and
Jes{\'{u}}s Puente and
Thomas A. Funkhouser and
Biren A. Patel and
Jukka Jernvall and
Ingrid Daubechies},
title = {Algorithms to automatically quantify the geometric similarity of anatomical
surfaces},
journal = {CoRR},
volume = {abs/1110.3649},
year = {2011},
url = {http://arxiv.org/abs/1110.3649},
eprinttype = {arXiv},
eprint = {1110.3649},
timestamp = {Thu, 14 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1110-3649.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1111-0046,
author = {Jonathan Bredin and
Quang Duong and
David C. Parkes},
title = {Chain: {A} Dynamic Double Auction Framework for Matching Patient Agents},
journal = {CoRR},
volume = {abs/1111.0046},
year = {2011},
url = {http://arxiv.org/abs/1111.0046},
eprinttype = {arXiv},
eprint = {1111.0046},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1111-0046.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijact-aicit/ZhuDJ10,
author = {Haiyan Zhu and
Quansheng Dou and
Ping Jiang},
title = {Further Results on Fault Classes in Boolean Specifications},
journal = {Int. J. Adv. Comp. Techn.},
volume = {2},
number = {5},
pages = {75--79},
year = {2010},
url = {http://www.aicit.org/ijact/ppl/08\_IJACT3-197018.pdf},
timestamp = {Fri, 13 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijact-aicit/ZhuDJ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infor/JiaC10,
author = {Peng Jia and
Peter E. Caines},
title = {Analysis of Quantized Double Auctions with Application to Competitive
Electricity Markets},
journal = {{INFOR} Inf. Syst. Oper. Res.},
volume = {48},
number = {4},
pages = {239--250},
year = {2010},
url = {https://doi.org/10.3138/infor.48.4.239},
doi = {10.3138/INFOR.48.4.239},
timestamp = {Fri, 04 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/infor/JiaC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/WangZSLCLHPDW10,
author = {Xiaoli Wang and
Daniel Zeng and
Holly Seale and
Su Li and
He Cheng and
Rongsheng Luan and
Xiong He and
Xinghuo Pang and
Xiangfeng Dou and
Quanyi Wang},
title = {Comparing early outbreak detection algorithms based on their optimized
parameter values},
journal = {J. Biomed. Informatics},
volume = {43},
number = {1},
pages = {97--103},
year = {2010},
url = {https://doi.org/10.1016/j.jbi.2009.08.003},
doi = {10.1016/J.JBI.2009.08.003},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jbi/WangZSLCLHPDW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/WangLSLT10,
author = {Wei Wang and
Huaxin Lu and
Jooyoung Song and
Shih{-}Hsien Lo and
Yuan Taur},
title = {Compact modeling of quantum effects in symmetric double-gate MOSFETs},
journal = {Microelectron. J.},
volume = {41},
number = {10},
pages = {688--692},
year = {2010},
url = {https://doi.org/10.1016/j.mejo.2010.05.007},
doi = {10.1016/J.MEJO.2010.05.007},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/WangLSLT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/WenS10,
author = {Tiw Pei Wen and
Ajay Kumar Singh},
title = {A comprehensive analytical study of an undoped symmetrical double-gate
{MOSFET} after considering quantum confinement parameter},
journal = {Microelectron. J.},
volume = {41},
number = {2-3},
pages = {162--170},
year = {2010},
url = {https://doi.org/10.1016/j.mejo.2010.01.014},
doi = {10.1016/J.MEJO.2010.01.014},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/WenS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/DerakhshanCGNMFAC10,
author = {Mishkin Derakhshan and
Zografos Caramanos and
Paul S. Giacomini and
Sridar Narayanan and
Josefina Maranzano and
Simon J. Francis and
Douglas L. Arnold and
D. Louis Collins},
title = {Evaluation of automated techniques for the quantification of grey
matter atrophy in patients with multiple sclerosis},
journal = {NeuroImage},
volume = {52},
number = {4},
pages = {1261--1267},
year = {2010},
url = {https://doi.org/10.1016/j.neuroimage.2010.05.029},
doi = {10.1016/J.NEUROIMAGE.2010.05.029},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/DerakhshanCGNMFAC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/TziortziDSBSLRJG10,
author = {Andri C. Tziortzi and
Gwena{\"{e}}lle Douaud and
Paul Shotbolt and
Courtney A. Bishop and
Graham E. Searle and
Marc Laruelle and
Eugenii A. Rabiner and
Mark Jenkinson and
Roger N. Gunn},
title = {A combined diffusion tensor imaging {(DTI)} and {[11C]-(+)-PHNO} positron
emission tomography {(PET)} study to quantify dopamine {D3/D2} receptors
in pallidum},
journal = {NeuroImage},
volume = {52},
number = {Supplement-1},
pages = {S23},
year = {2010},
url = {https://doi.org/10.1016/j.neuroimage.2010.04.207},
doi = {10.1016/J.NEUROIMAGE.2010.04.207},
timestamp = {Thu, 08 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/TziortziDSBSLRJG10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qic/Konig10,
author = {Robert K{\"{o}}nig},
title = {Simplifying quantum double Hamiltonians using perturbative gadgets},
journal = {Quantum Inf. Comput.},
volume = {10},
number = {3{\&}4},
pages = {292--324},
year = {2010},
url = {https://doi.org/10.26421/QIC10.3-4-9},
doi = {10.26421/QIC10.3-4-9},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qic/Konig10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/HuangHS10a,
author = {Fangjun Huang and
Jiwu Huang and
Yun{-}Qing Shi},
title = {Detecting Double {JPEG} Compression With the Same Quantization Matrix},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {5},
number = {4},
pages = {848--856},
year = {2010},
url = {https://doi.org/10.1109/TIFS.2010.2072921},
doi = {10.1109/TIFS.2010.2072921},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/HuangHS10a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/TienGBGA10,
author = {Iris Tien and
Steven D. Glaser and
Ruzena Bajcsy and
Douglas S. Goodin and
Michael J. Aminoff},
title = {Results of using a wireless inertial measurirlg system to quantify
gait motions in control subjects},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {14},
number = {4},
pages = {904--915},
year = {2010},
url = {https://doi.org/10.1109/TITB.2009.2021650},
doi = {10.1109/TITB.2009.2021650},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/TienGBGA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/JiaC10,
author = {Peng Jia and
Peter E. Caines},
title = {Analysis of decentralized decision processes in competitive markets:
Quantized single and double-sided auctions},
booktitle = {Proceedings of the 49th {IEEE} Conference on Decision and Control,
{CDC} 2010, December 15-17, 2010, Atlanta, Georgia, {USA}},
pages = {237--243},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/CDC.2010.5717534},
doi = {10.1109/CDC.2010.5717534},
timestamp = {Fri, 04 Mar 2022 13:28:01 +0100},
biburl = {https://dblp.org/rec/conf/cdc/JiaC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/ChaeLATHHT10,
author = {Jeongseok Chae and
Sanghyeon Lee and
Mitsuru Aniya and
Seiji Takeuchi and
Koichi Hamashita and
Pavan Kumar Hanumolu and
Gabor C. Temes},
editor = {Jacqueline Snyder and
Rakesh Patel and
Tom Andre},
title = {A 63 dB 16 mW 20 MHz {BW} double-sampled {\(\Delta\)}{\(\Sigma\)}s
analog-to-digital converter with an embedded-adder quantizer},
booktitle = {{IEEE} Custom Integrated Circuits Conference, {CICC} 2010, San Jose,
California, USA, 19-22 September, 2010, Proceedings},
pages = {1--4},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/CICC.2010.5617594},
doi = {10.1109/CICC.2010.5617594},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cicc/ChaeLATHHT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ems/RajSD10,
author = {Balwinder Raj and
Ashok K. Saxena and
Sudeb Dasgupta},
title = {Quantum Inversion Charge and Drain Current Analysis for Double Gate
FinFET Device: Analytical Modeling and {TCAD} Simulation Approach},
booktitle = {Fourth UKSim European Symposium on Computer Modeling and Simulation,
{EMS} 2010, Pisa, Italy, November 17-19, 2010},
pages = {526--530},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/EMS.2010.93},
doi = {10.1109/EMS.2010.93},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ems/RajSD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/HanD10,
author = {Liquan Han and
Quansheng Dou},
editor = {Maozhen Li and
Qilian Liang and
Lipo Wang and
Yibin Song},
title = {Visual model of heterogeneous data sources based on service-ontology},
booktitle = {Seventh International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2010, 10-12 August 2010, Yantai, Shandong, China},
pages = {2945--2949},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/FSKD.2010.5569076},
doi = {10.1109/FSKD.2010.5569076},
timestamp = {Sat, 25 Jun 2022 17:37:25 +0200},
biburl = {https://dblp.org/rec/conf/fskd/HanD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iasam/GantiS10,
author = {Vijay Chand Ganti and
Bhim Singh},
title = {Quantitative Analysis and Rating Considerations of a Doubly Fed Induction
Generator for Wind Energy Conversion Systems},
booktitle = {Annual Meeting of the {IEEE} Industry Applications Society, {IAS}
2010, Houston, TX, USA, 3-7 October, 2010, Proceedings},
pages = {1--7},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/IAS.2010.5614694},
doi = {10.1109/IAS.2010.5614694},
timestamp = {Mon, 12 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iasam/GantiS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/DjamahO10,
author = {Mouloud Djamah and
Douglas D. O'Shaughnessy},
title = {An efficient tree-structured codebook design for embedded vector quantization},
booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
and Signal Processing, {ICASSP} 2010, 14-19 March 2010, Sheraton Dallas
Hotel, Dallas, Texas, {USA}},
pages = {4686--4689},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICASSP.2010.5495190},
doi = {10.1109/ICASSP.2010.5495190},
timestamp = {Fri, 19 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/DjamahO10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/AnZZQC10,
author = {Wen{-}dou An and
Quan Zhou and
Xin Zhang and
Yuzhong Qin and
Weigen Chen},
title = {An immune genetic algorithm based approach for distribution system
reconfiguration},
booktitle = {Sixth International Conference on Natural Computation, {ICNC} 2010,
Yantai, Shandong, China, 10-12 August 2010},
pages = {92--95},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICNC.2010.5583359},
doi = {10.1109/ICNC.2010.5583359},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/icnc/AnZZQC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/PanYDL10,
author = {Guanyu Pan and
Hui Yan and
Quansheng Dou and
Haijun Li},
title = {Outlier data forecasting of power load based on neural {PSO}},
booktitle = {Sixth International Conference on Natural Computation, {ICNC} 2010,
Yantai, Shandong, China, 10-12 August 2010},
pages = {1140--1142},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICNC.2010.5583678},
doi = {10.1109/ICNC.2010.5583678},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icnc/PanYDL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/XuHGD10,
author = {Zhongyu Xu and
Fen Hu and
Hongcheng Guo and
Quansheng Dou},
title = {Support vector machine image segmentation algorithm applied to angiogenesis
quantification},
booktitle = {Sixth International Conference on Natural Computation, {ICNC} 2010,
Yantai, Shandong, China, 10-12 August 2010},
pages = {928--931},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICNC.2010.5583924},
doi = {10.1109/ICNC.2010.5583924},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icnc/XuHGD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/DouFZJS10,
author = {Quansheng Dou and
Kailei Fu and
Haiyan Zhu and
Ping Jiang and
Zhongzhi Shi},
editor = {Zhongzhi Shi and
Sunil Vadera and
Agnar Aamodt and
David B. Leake},
title = {Associated Clustering and Classification Method for Electric Power
Load Forecasting},
booktitle = {Intelligent Information Processing {V} - 6th {IFIP} {TC} 12 International
Conference, {IIP} 2010, Manchester, UK, October 13-16, 2010. Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {340},
pages = {112--121},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16327-2\_16},
doi = {10.1007/978-3-642-16327-2\_16},
timestamp = {Tue, 26 Jun 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip12/DouFZJS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/DouLJZS10,
author = {Quansheng Dou and
Shasha Liu and
Ping Jiang and
Xiuhua Zhou and
Zhongzhi Shi},
editor = {Zhongzhi Shi and
Sunil Vadera and
Agnar Aamodt and
David B. Leake},
title = {Two Improvement Strategies for {PSO}},
booktitle = {Intelligent Information Processing {V} - 6th {IFIP} {TC} 12 International
Conference, {IIP} 2010, Manchester, UK, October 13-16, 2010. Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {340},
pages = {122--129},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16327-2\_17},
doi = {10.1007/978-3-642-16327-2\_17},
timestamp = {Tue, 26 Jun 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip12/DouLJZS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/NiuDHYS10,
author = {Wenjia Niu and
Quansheng Dou and
Xu Han and
Xinghua Yang and
Zhongzhi Shi},
editor = {Zhongzhi Shi and
Sunil Vadera and
Agnar Aamodt and
David B. Leake},
title = {Multi-agent and Workflow-Based Web Service Management Model},
booktitle = {Intelligent Information Processing {V} - 6th {IFIP} {TC} 12 International
Conference, {IIP} 2010, Manchester, UK, October 13-16, 2010. Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {340},
pages = {26--34},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16327-2\_7},
doi = {10.1007/978-3-642-16327-2\_7},
timestamp = {Tue, 26 Jun 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip12/NiuDHYS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/WuSWJ10,
author = {Quan Wu and
Li Sun and
Fei Wang and
Shaorong Jia},
editor = {Daoliang Li and
Yande Liu and
Yingyi Chen},
title = {Theory of Double Sampling Applied to Main Crops Acreage Monitoring
at National Scale Based on 3S in China - {CT316}},
booktitle = {Computer and Computing Technologies in Agriculture {IV} - 4th {IFIP}
{TC} 12 Conference, {CCTA} 2010, Nanchang, China, October 22-25, 2010,
Selected Papers, Part {III}},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {346},
pages = {198--211},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-18354-6\_26},
doi = {10.1007/978-3-642-18354-6\_26},
timestamp = {Tue, 26 Jun 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip12/WuSWJ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/WangDD10,
author = {Xiaoqing Wang and
Aixia Dou and
Xiang Ding},
title = {Study on quantitative earthquake damage of Dujiangyan city, caused
by 2008 MS=8.0 Wenchuan, China earthquake based on aerial imagery},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2010, July 25-30, 2010, Honolulu, Hawaii, USA, Proceedings},
pages = {2743--2746},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/IGARSS.2010.5653233},
doi = {10.1109/IGARSS.2010.5653233},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/WangDD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/MaghariM10a,
author = {Nima Maghari and
Un{-}Ku Moon},
title = {A double-sampled path-coupled single-loop {\(\Sigma\)}{\(\Delta\)}
modulator using noise-shaped integrating quantizer},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2010), May
30 - June 2, 2010, Paris, France},
pages = {4005--4008},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISCAS.2010.5537654},
doi = {10.1109/ISCAS.2010.5537654},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/MaghariM10a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lsms/DouXZZS10,
author = {Jianhong Dou and
Ling Xia and
Yunliang Zang and
Yu Zhang and
Guofa Shou},
editor = {Kang Li and
Li Jia and
Xin Sun and
Minrui Fei and
George W. Irwin},
title = {Relation of Infarct Location and Size to Extent of Infarct Expansion
After Acute Myocardial Infarction: {A} Quantitative Study Based on
a Canine Model},
booktitle = {Life System Modeling and Intelligent Computing - International Conference
on Life System Modeling and Simulation, {LSMS} 2010, and International
Conference on Intelligent Computing for Sustainable Energy and Environment,
{ICSEE} 2010, Wuxi, China, September 17-20, 2010. Proceedings, Part
{III}},
series = {Lecture Notes in Computer Science},
volume = {6330},
pages = {316--324},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15615-1\_38},
doi = {10.1007/978-3-642-15615-1\_38},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lsms/DouXZZS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1008-3788,
author = {Quan{-}Lin Li},
title = {Doubly Exponential Solution for Randomized Load Balancing Models with
General Service Times},
journal = {CoRR},
volume = {abs/1008.3788},
year = {2010},
url = {http://arxiv.org/abs/1008.3788},
eprinttype = {arXiv},
eprint = {1008.3788},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1008-3788.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1009-4970,
author = {Quan{-}Lin Li},
title = {Doubly Exponential Solution for Randomized Load Balancing Models with
Markovian Arrival Processes and {PH} Service Times},
journal = {CoRR},
volume = {abs/1009.4970},
year = {2010},
url = {http://arxiv.org/abs/1009.4970},
eprinttype = {arXiv},
eprint = {1009.4970},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1009-4970.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/Stebila09,
author = {Douglas Stebila},
title = {Classical Authenticated Key Exchange and Quantum Cryptography},
school = {University of Waterloo, Ontario, Canada},
year = {2009},
url = {https://hdl.handle.net/10012/4295},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/basesearch/Stebila09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asy/FarajMN09,
author = {Ali Faraj and
Andrea Mantile and
Francis Nier},
title = {Double scale analysis of a Schr{\"{o}}dinger-Poisson system with
quantum wells and macroscopic nonlinearities in dimension 2 and 3},
journal = {Asymptot. Anal.},
volume = {62},
number = {3-4},
pages = {163--205},
year = {2009},
url = {https://doi.org/10.3233/ASY-2009-0919},
doi = {10.3233/ASY-2009-0919},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asy/FarajMN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbsn/ByunRMDNSLLLAB09,
author = {Sookeun Byun and
Celestino Ruffini and
Juline E. Mills and
Alecia Douglas and
Mamadou Niang and
Svetlana Stepchenkova and
Seul Ki Lee and
Jihad Loutfi and
JungKook Lee and
Mikhail J. Atallah and
Marina Blanton},
title = {Internet Addiction: Metasynthesis of 1996-2006 Quantitative Research},
journal = {Cyberpsychology Behav. Soc. Netw.},
volume = {12},
number = {2},
pages = {203--207},
year = {2009},
url = {https://doi.org/10.1089/cpb.2008.0102},
doi = {10.1089/CPB.2008.0102},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbsn/ByunRMDNSLLLAB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cstat/ShimHS09,
author = {Jooyong Shim and
Changha Hwang and
Kyung Ha Seok},
title = {Non-crossing quantile regression via doubly penalized kernel machine},
journal = {Comput. Stat.},
volume = {24},
number = {1},
pages = {83--94},
year = {2009},
url = {https://doi.org/10.1007/s00180-008-0123-y},
doi = {10.1007/S00180-008-0123-Y},
timestamp = {Fri, 10 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cstat/ShimHS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/XieZ09,
author = {Dezheng Xie and
Cun{-}Quan Zhang},
title = {Flows, flow-pair covers and cycle double covers},
journal = {Discret. Math.},
volume = {309},
number = {14},
pages = {4682--4689},
year = {2009},
url = {https://doi.org/10.1016/j.disc.2008.05.056},
doi = {10.1016/J.DISC.2008.05.056},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/XieZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/AkimotoCNMTHI09,
author = {Ryoichi Akimoto and
Guangwei Cong and
Masanori Nagase and
Teruo Mozume and
Hidemi Tsuchida and
Toshifumi Hasama and
Hiroshi Ishikawa},
title = {All-Optical Demultiplexing from 160 to 40/80 Gb/s Using Mach-Zehnder
Switches Based on Intersubband Transition of InGaAs/AlAsSb Coupled
Double Quantum Wells},
journal = {{IEICE} Trans. Electron.},
volume = {92-C},
number = {2},
pages = {187--193},
year = {2009},
url = {https://doi.org/10.1587/transele.E92.C.187},
doi = {10.1587/TRANSELE.E92.C.187},
timestamp = {Sat, 11 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/AkimotoCNMTHI09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/CarneiroJ09,
author = {Gustavo Carneiro and
Allan D. Jepson},
title = {The quantitative characterization of the distinctiveness and robustness
of local image descriptors},
journal = {Image Vis. Comput.},
volume = {27},
number = {8},
pages = {1143--1156},
year = {2009},
url = {https://doi.org/10.1016/j.imavis.2008.10.015},
doi = {10.1016/J.IMAVIS.2008.10.015},
timestamp = {Tue, 18 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ivc/CarneiroJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/TitO09,
author = {Nacir Tit and
Ihab M. Obaidat},
title = {Transition behaviors from coupled-to-uncoupled CdTe-ZnTe symmetric
versus asymmetric double quantum wells},
journal = {Microelectron. J.},
volume = {40},
number = {3},
pages = {523--526},
year = {2009},
url = {https://doi.org/10.1016/j.mejo.2008.06.022},
doi = {10.1016/J.MEJO.2008.06.022},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/TitO09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/YakimovBND09,
author = {A. I. Yakimov and
A. A. Bloshkin and
A. I. Nikiforov and
A. V. Dvurechenskii},
title = {Hole states in vertically coupled double Ge/Si quantum dots},
journal = {Microelectron. J.},
volume = {40},
number = {4-5},
pages = {785--787},
year = {2009},
url = {https://doi.org/10.1016/j.mejo.2008.11.015},
doi = {10.1016/J.MEJO.2008.11.015},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/YakimovBND09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/VoineskosOLMANMPKWS09,
author = {Aristotle N. Voineskos and
Lauren J. O'Donnell and
Nancy J. Lobaugh and
Douglas Markant and
Stephanie Ameis and
Marc Niethammer and
Benoit H. Mulsant and
Bruce G. Pollock and
James L. Kennedy and
Carl{-}Fredrik Westin and
Martha Elizabeth Shenton},
title = {Quantitative examination of a novel clustering method using magnetic
resonance diffusion tensor tractography},
journal = {NeuroImage},
volume = {45},
number = {2},
pages = {370--376},
year = {2009},
url = {https://doi.org/10.1016/j.neuroimage.2008.12.028},
doi = {10.1016/J.NEUROIMAGE.2008.12.028},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/VoineskosOLMANMPKWS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qic/Watrous09,
author = {John Watrous},
title = {Mixing doubly stochastic quantum channels with the completely depolarizing
channel},
journal = {Quantum Inf. Comput.},
volume = {9},
number = {5{\&}6},
pages = {406--413},
year = {2009},
url = {https://doi.org/10.26421/QIC9.5-6-4},
doi = {10.26421/QIC9.5-6-4},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qic/Watrous09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/BennettLPCAL09,
author = {Douglas A. Bennett and
Luigi Longobardi and
Vijay Patel and
Wei Chen and
Dmitri V. Averin and
James E. Lukens},
title = {Decoherence in rf {SQUID} qubits},
journal = {Quantum Inf. Process.},
volume = {8},
number = {2-3},
pages = {217--243},
year = {2009},
url = {https://doi.org/10.1007/s11128-009-0099-8},
doi = {10.1007/S11128-009-0099-8},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/BennettLPCAL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACISicis/XingyunQYQW09,
author = {Xingyun Qi and
Quanyou Feng and
Yongran Chen and
Qiang Dou and
Wenhua Dou},
editor = {Huaikou Miao and
Gongzhu Hu},
title = {A Fault Tolerant Bufferless Optical Interconnection Network},
booktitle = {8th {IEEE/ACIS} International Conference on Computer and Information
Science, {IEEE/ACIS} {ICIS} 2009, June 1-3, 2009, Shanghai, China},
pages = {249--254},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICIS.2009.136},
doi = {10.1109/ICIS.2009.136},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ACISicis/XingyunQYQW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aiccsa/QiYCDFD09,
author = {Xingyun Qi and
Wei Yang and
Yongran Chen and
Qiang Dou and
Quanyou Feng and
Wenhua Dou},
editor = {El Mostapha Aboulhamid and
Jos{\'{e}} Luis Sevillano},
title = {{BOIN:} {A} novel Bufferless Optical Interconnection Network for high
performance computer},
booktitle = {The 7th {IEEE/ACS} International Conference on Computer Systems and
Applications, {AICCSA} 2009, Rabat, Morocco, May 10-13, 2009},
pages = {117--123},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/AICCSA.2009.5069313},
doi = {10.1109/AICCSA.2009.5069313},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aiccsa/QiYCDFD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccece/DjamahO09,
author = {Mouloud Djamah and
Douglas D. O'Shaughnessy},
title = {Low-complexity encoding of speech lsf parameters using multistage
tree-structured vector quantization: Application to the {MELP} coder},
booktitle = {Proceedings of the 22nd Canadian Conference on Electrical and Computer
Engineering, {CCECE} 2009, 3-6 May 2009, Delta St. John's Hotel and
Conference Centre, St. John's, Newfoundland, Canada},
pages = {376--380},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/CCECE.2009.5090158},
doi = {10.1109/CCECE.2009.5090158},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/ccece/DjamahO09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/DiasP09,
author = {Douglas Mota Dias and
Marco Aur{\'{e}}lio Cavalcanti Pacheco},
title = {Toward a Quantum-Inspired Linear Genetic Programming model},
booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
2009, Trondheim, Norway, 18-21 May, 2009},
pages = {1691--1698},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/CEC.2009.4983145},
doi = {10.1109/CEC.2009.4983145},
timestamp = {Thu, 16 Dec 2021 14:01:55 +0100},
biburl = {https://dblp.org/rec/conf/cec/DiasP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gensips/PalDD09,
author = {Ranadip Pal and
Aniruddha Datta and
Edward R. Dougherty},
title = {Quantification of data extraction noise in probabilistic Boolean Network
modeling},
booktitle = {2009 {IEEE} International Workshop on Genomic Signal Processing and
Statistics, GENSiPS 2009, Minneapolis, MN, USA, May 17-21, 2009},
pages = {1--4},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/GENSIPS.2009.5174324},
doi = {10.1109/GENSIPS.2009.5174324},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gensips/PalDD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/SarkarM09,
author = {Anindya Sarkar and
Bangalore S. Manjunath},
title = {Double embedding in the quantization index modulation framework},
booktitle = {Proceedings of the International Conference on Image Processing, {ICIP}
2009, 7-10 November 2009, Cairo, Egypt},
pages = {3653--3656},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ICIP.2009.5414263},
doi = {10.1109/ICIP.2009.5414263},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/SarkarM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/DjamahO09,
author = {Mouloud Djamah and
Douglas D. O'Shaughnessy},
title = {Fine-granular scalable {MELP} coder based on embedded vector quantization},
booktitle = {10th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009},
pages = {2603--2606},
publisher = {{ISCA}},
year = {2009},
url = {https://doi.org/10.21437/Interspeech.2009-685},
doi = {10.21437/INTERSPEECH.2009-685},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/DjamahO09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscid/DouSYL09,
author = {Quansheng Dou and
Zhongzhi Shi and
Bin Yang and
Zhongyao Liu},
editor = {Yongchuan Tang and
Jonathan Lawry},
title = {Power Load Forecasting Model Based on Knowledge Discovery for Heilongjiang
Province},
booktitle = {2009 Second International Symposium on Computational Intelligence
and Design, {ISCID} 2009, Changsha, Hunan, China, 12-14 December 2009,
2 Volumes},
pages = {42--45},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ISCID.2009.159},
doi = {10.1109/ISCID.2009.159},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscid/DouSYL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmsec/WangF09,
author = {Weihong Wang and
Hany Farid},
editor = {Edward W. Felten and
Jana Dittmann and
Jessica J. Fridrich and
Scott Craver},
title = {Exposing digital forgeries in video by detecting double quantization},
booktitle = {Multimedia and Security Workshop, MM{\&}Sec 2009, Princeton, NJ,
USA, September 07 - 08, 2009},
pages = {39--48},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1597817.1597826},
doi = {10.1145/1597817.1597826},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mmsec/WangF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmsp/ChenH09,
author = {Yi{-}Lei Chen and
Chiou{-}Ting Hsu},
title = {Detecting doubly compressed images based on quantization noise model
and image restoration},
booktitle = {2009 {IEEE} International Workshop on Multimedia Signal Processing,
{MMSP} '09, Rio de Janeiro, Brazil, October 5-7, 2009},
pages = {1--6},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/MMSP.2009.5293280},
doi = {10.1109/MMSP.2009.5293280},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/mmsp/ChenH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/quantumcomm/StebilaML09,
author = {Douglas Stebila and
Michele Mosca and
Norbert L{\"{u}}tkenhaus},
editor = {Alexander V. Sergienko and
Saverio Pascazio and
Paolo Villoresi},
title = {The Case for Quantum Key Distribution},
booktitle = {Quantum Communication and Quantum Networking, First International
Conference, QuantumComm 2009, Naples, Italy, October 26-30, 2009,
Revised Selected Papers},
series = {Lecture Notes of the Institute for Computer Sciences, Social Informatics
and Telecommunications Engineering},
volume = {36},
pages = {283--296},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-11731-2\_35},
doi = {10.1007/978-3-642-11731-2\_35},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/quantumcomm/StebilaML09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ZhaoQPW09,
author = {Xiaochuan Zhao and
Qingyi Quan and
Tao Peng and
Wenbo Wang},
title = {On the Cram{\'{e}}r-Rao lower bound for spatial correlation matrices
of doubly selective fading channels for {MIMO} {OFDM} systems},
booktitle = {2009 {IEEE} Wireless Communications and Networking Conference, {WCNC}
2009, Proceedings, Budapest, Hungary, 5-8 April 2009},
pages = {1120--1125},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/WCNC.2009.4917851},
doi = {10.1109/WCNC.2009.4917851},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/ZhaoQPW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/09/Jaeger09,
author = {Gregg S. Jaeger},
editor = {Daniel M. Greenberger and
Klaus Hentschel and
Friedel Weinert},
title = {Double-Slit Experiment (or Two-Slit Experiment)},
booktitle = {Compendium of Quantum Physics},
pages = {174--178},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-540-70626-7\_56},
doi = {10.1007/978-3-540-70626-7\_56},
timestamp = {Thu, 17 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/09/Jaeger09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/StebilaML09,
author = {Douglas Stebila and
Michele Mosca and
Norbert L{\"{u}}tkenhaus},
title = {The Case for Quantum Key Distribution},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {82},
year = {2009},
url = {http://eprint.iacr.org/2009/082},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/StebilaML09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/LiCVWSOWOPGOK08,
author = {Peter Li and
Juan I. Castrillo and
Giles Velarde and
Ingo Wassink and
Stian Soiland{-}Reyes and
Stuart Owen and
David Withers and
Tom Oinn and
Matthew R. Pocock and
Carole A. Goble and
Stephen G. Oliver and
Douglas B. Kell},
title = {Performing statistical analyses on quantitative data in Taverna workflows:
An example using {R} and maxdBrowse to identify differentially-expressed
genes from microarray data},
journal = {{BMC} Bioinform.},
volume = {9},
year = {2008},
url = {https://doi.org/10.1186/1471-2105-9-334},
doi = {10.1186/1471-2105-9-334},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/LiCVWSOWOPGOK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/BasakMH08,
author = {Subhash C. Basak and
Denise R. Mills and
Douglas M. Hawkins},
title = {Predicting allergic contact dermatitis: a hierarchical structure-activity
relationship {(SAR)} approach to chemical classification using topological
and quantum chemical descriptors},
journal = {J. Comput. Aided Mol. Des.},
volume = {22},
number = {6-7},
pages = {339--343},
year = {2008},
url = {https://doi.org/10.1007/s10822-008-9202-y},
doi = {10.1007/S10822-008-9202-Y},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/BasakMH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/CamargoG08,
author = {Manuel Camargo and
Rafael M. Guti{\'{e}}rrez},
title = {Quasi-analytical study of the energy levels in double quantum wells},
journal = {Microelectron. J.},
volume = {39},
number = {11},
pages = {1276--1278},
year = {2008},
url = {https://doi.org/10.1016/j.mejo.2008.01.015},
doi = {10.1016/J.MEJO.2008.01.015},
timestamp = {Tue, 17 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/CamargoG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/CulchacPGL08,
author = {F. J. Culchac and
N. Porras{-}Montenegro and
J. C. Granada and
A. Latg{\'{e}}},
title = {Energy spectrum in a concentric double quantum ring of GaAs-(Ga, Al)As
under applied magnetic fields},
journal = {Microelectron. J.},
volume = {39},
number = {3-4},
pages = {402--406},
year = {2008},
url = {https://doi.org/10.1016/j.mejo.2007.07.063},
doi = {10.1016/J.MEJO.2007.07.063},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/CulchacPGL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/GuevaraLO08,
author = {Mar{\'{\i}}a L. Ladr{\'{o}}n de Guevara and
G. A. Lara and
Pedro C. Orellana},
title = {Electronic transport through two double quantum dot molecules embedded
in an Aharonov-Bohm ring},
journal = {Microelectron. J.},
volume = {39},
number = {11},
pages = {1304--1305},
year = {2008},
url = {https://doi.org/10.1016/j.mejo.2008.01.020},
doi = {10.1016/J.MEJO.2008.01.020},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/GuevaraLO08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/OliveiraDD08,
author = {Luiz Eduardo Oliveira and
M. de Dios{-}Leyva and
Carlos Alberto Duque},
title = {Direct and indirect exciton states in GaAs-(Ga, Al)As double quantum
wells under crossed electric and magnetic fields},
journal = {Microelectron. J.},
volume = {39},
number = {3-4},
pages = {398--401},
year = {2008},
url = {https://doi.org/10.1016/j.mejo.2007.07.064},
doi = {10.1016/J.MEJO.2007.07.064},
timestamp = {Tue, 16 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/OliveiraDD08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/Rodriguez-VargasMD08,
author = {Isaac Rodr{\'{\i}}guez{-}Vargas and
Miguel Eduardo Mora{-}Ramos and
Carlos Alberto Duque},
title = {Influence of the hydrostatic pressure onto the electronic and transport
properties of n-type double delta-doped GaAs quantum wells},
journal = {Microelectron. J.},
volume = {39},
number = {3-4},
pages = {438--441},
year = {2008},
url = {https://doi.org/10.1016/j.mejo.2007.07.022},
doi = {10.1016/J.MEJO.2007.07.022},
timestamp = {Sat, 27 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/Rodriguez-VargasMD08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ChenSHX08,
author = {Qiang Chen and
Quan{-}Sen Sun and
Pheng{-}Ann Heng and
De{-}Shen Xia},
title = {A double-threshold image binarization method based on edge detector},
journal = {Pattern Recognit.},
volume = {41},
number = {4},
pages = {1254--1267},
year = {2008},
url = {https://doi.org/10.1016/j.patcog.2007.09.007},
doi = {10.1016/J.PATCOG.2007.09.007},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/ChenSHX08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/OsterWDL08,
author = {Matthias Oster and
Yingxue Wang and
Rodney J. Douglas and
Shih{-}Chii Liu},
title = {Quantification of a Spike-Based Winner-Take-All {VLSI} Network},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {55-I},
number = {10},
pages = {3160--3169},
year = {2008},
url = {https://doi.org/10.1109/TCSI.2008.923430},
doi = {10.1109/TCSI.2008.923430},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/OsterWDL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/DoukasMC08,
author = {Charalampos N. Doukas and
Ilias Maglogiannis and
Aristotle A. Chatziioannou},
title = {Computer-Supported Angiogenesis Quantification Using Image Analysis
and Statistical Averaging},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {12},
number = {5},
pages = {650--657},
year = {2008},
url = {https://doi.org/10.1109/TITB.2008.926463},
doi = {10.1109/TITB.2008.926463},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/titb/DoukasMC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/GuKSK08,
author = {Jie Gu and
John Keane and
Sachin S. Sapatnekar and
Chris H. Kim},
title = {Statistical Leakage Estimation of Double Gate FinFET Devices Considering
the Width Quantization Property},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {16},
number = {2},
pages = {206--209},
year = {2008},
url = {https://doi.org/10.1109/TVLSI.2007.909809},
doi = {10.1109/TVLSI.2007.909809},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/GuKSK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vlsisp/WangGCBBC08,
author = {Yu{-}Ping Wang and
Maheswar Gunampally and
Jie Chen and
Douglas Bittel and
Merlin G. Butler and
Wei{-}Wen Cai},
title = {A Comparison of Fuzzy Clustering Approaches for Quantification of
Microarray Gene Expression},
journal = {J. Signal Process. Syst.},
volume = {50},
number = {3},
pages = {305--320},
year = {2008},
url = {https://doi.org/10.1007/s11265-007-0123-0},
doi = {10.1007/S11265-007-0123-0},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/vlsisp/WangGCBBC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/WangTJLW08,
author = {Hui Wang and
Tianyu Tang and
Yun Jiao and
Zuhong Lu and
Renhua Wu},
title = {Brain gamma-Aminobutyric Acid Detection with Improved Selectivity
by Double Quantum Filter Technique},
booktitle = {Proceedings of the 2008 International Conference on BioMedical Engineering
and Informatics, {BMEI} 2008, May 28-30, 2008, Sanya, Hainan, China
- Volume 2},
pages = {363--366},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/BMEI.2008.193},
doi = {10.1109/BMEI.2008.193},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bmei/WangTJLW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cis/DouJYS08,
author = {Quansheng Dou and
Ping Jiang and
Zhijun Yu and
Zhongzhi Shi},
title = {Convergence Property Analysis for {PSO} Based on Cluster-Degree},
booktitle = {2008 International Conference on Computational Intelligence and Security,
{CIS} 2008, 13-17 December 2008, Suzhou, China, Volume 2, Workshop
Papers},
pages = {48--51},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/CIS.2008.83},
doi = {10.1109/CIS.2008.83},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cis/DouJYS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ciss/SunCCG08,
author = {Xiantao Sun and
Leonard J. Cimini Jr. and
Douglas S. Chan and
Larry J. Greenstein},
title = {Enhanced {IEEE} 802.11n quantized feedback beamforming with power
allocation},
booktitle = {42nd Annual Conference on Information Sciences and Systems, {CISS}
2008, Princeton, NJ, USA, 19-21 March 2008},
pages = {908--912},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/CISS.2008.4558648},
doi = {10.1109/CISS.2008.4558648},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ciss/SunCCG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/SejdinovicPDI08,
author = {Dino Sejdinovic and
Robert J. Piechocki and
Angela Doufexi and
Mohamed Ismail},
title = {Rate Adaptive Binary Erasure Quantization with Dual Fountain Codes},
booktitle = {Proceedings of the Global Communications Conference, 2008. {GLOBECOM}
2008, New Orleans, LA, USA, 30 November - 4 December 2008},
pages = {1203--1207},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/GLOCOM.2008.ECP.238},
doi = {10.1109/GLOCOM.2008.ECP.238},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/globecom/SejdinovicPDI08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/LuLLA08,
author = {Chong Lu and
Wanquan Liu and
Xiaodong Liu and
Senjian An},
editor = {De{-}Shuang Huang and
Donald C. Wunsch II and
Daniel S. Levine and
Kang{-}Hyun Jo},
title = {Double Sides 2DPCA for Face Recognition},
booktitle = {Advanced Intelligent Computing Theories and Applications. With Aspects
of Theoretical and Methodological Issues, 4th International Conference
on Intelligent Computing, {ICIC} 2008, Shanghai, China, September
15-18, 2008, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5226},
pages = {446--459},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-87442-3\_56},
doi = {10.1007/978-3-540-87442-3\_56},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icic/LuLLA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isica/DouYSYZ08,
author = {Quansheng Dou and
Zhijun Yu and
Zhongzhi Shi and
Erkeng Yu and
Yongzhi Zheng},
editor = {Lishan Kang and
Zhihua Cai and
Xuesong Yan and
Yong Liu},
title = {Cluster-Degree Analysis and Velocity Compensation Strategy of {PSO}},
booktitle = {Advances in Computation and Intelligence, Third International Symposium,
{ISICA} 2008, Wuhan, China, December 19-21, 2008 Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5370},
pages = {98--106},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-92137-0\_11},
doi = {10.1007/978-3-540-92137-0\_11},
timestamp = {Mon, 09 Mar 2020 14:52:47 +0100},
biburl = {https://dblp.org/rec/conf/isica/DouYSYZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isip/Wang08,
author = {Chuanxu Wang},
editor = {Fei Yu and
Qi Luo},
title = {Quantitative Analysis on the Bullwhip Effect in a Supply Chain Using
Double Moving Average and Double Exponential Smoothing Forecasts},
booktitle = {International Symposium on Information Processing, {ISIP} 2008 / International
Pacific Workshop on Web Mining, and Web-Based Application, {WMWA}
2008, Moscow, Russia, 23-25 May 2008},
pages = {114--118},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ISIP.2008.32},
doi = {10.1109/ISIP.2008.32},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isip/Wang08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/prdc/MaLZS08,
author = {Dianfu Ma and
Min Liu and
Yongwang Zhao and
Dou Sun},
title = {Reliability Quantification of the Tree Structure Based Distributed
System},
booktitle = {14th {IEEE} Pacific Rim International Symposium on Dependable Computing,
{PRDC} 2008, 15-17 December 2008, Taipei, Taiwan},
pages = {351--352},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/PRDC.2008.55},
doi = {10.1109/PRDC.2008.55},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/prdc/MaLZS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sswmc/PevnyF08,
author = {Tom{\'{a}}s Pevn{\'{y}} and
Jessica J. Fridrich},
editor = {Edward J. Delp III and
Ping Wah Wong and
Jana Dittmann and
Nasir D. Memon},
title = {Estimation of primary quantization matrix for steganalysis of double-compressed
{JPEG} images},
booktitle = {Security, Forensics, Steganography, and Watermarking of Multimedia
Contents X, San Jose, CA, USA, January 27, 2008},
series = {{SPIE} Proceedings},
volume = {6819},
pages = {681911},
publisher = {{SPIE}},
year = {2008},
url = {https://doi.org/10.1117/12.759155},
doi = {10.1117/12.759155},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sswmc/PevnyF08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/08/CarrRJFVGB08,
author = {Hamish A. Carr and
John Ryan and
Maria Joyce and
Oliver FitzGerald and
Douglas Veale and
Robin Gibney and
Patrick C. Brennan},
editor = {Lars Linsen and
Hans Hagen and
Bernd Hamann},
title = {A Topological Approach to Quantitation of Rheumatoid Arthritis},
booktitle = {Visualization in Medicine and Life Sciences},
series = {Mathematics and Visualization},
pages = {27--37},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-72630-2\_2},
doi = {10.1007/978-3-540-72630-2\_2},
timestamp = {Wed, 08 Feb 2023 10:32:17 +0100},
biburl = {https://dblp.org/rec/books/sp/08/CarrRJFVGB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cse/BelloniCB07,
author = {Mario Belloni and
Wolfgang Christian and
Douglas Brown},
title = {Open Source Physics Curricular Material for Quantum Mechanics},
journal = {Comput. Sci. Eng.},
volume = {9},
number = {4},
pages = {24--31},
year = {2007},
url = {https://doi.org/10.1109/MCSE.2007.80},
doi = {10.1109/MCSE.2007.80},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cse/BelloniCB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejbsb/XiaoHD07,
author = {Yufei Xiao and
Jianping Hua and
Edward R. Dougherty},
title = {Quantification of the Impact of Feature Selection on the Variance
of Cross-Validation Error Estimation},
journal = {{EURASIP} J. Bioinform. Syst. Biol.},
volume = {2007},
year = {2007},
url = {https://doi.org/10.1155/2007/16354},
doi = {10.1155/2007/16354},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejbsb/XiaoHD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/SimonLCV07,
author = {Geoffroy Simon and
John Aldo Lee and
Marie Cottrell and
Michel Verleysen},
title = {Forecasting the {CATS} benchmark with the Double Vector Quantization
method},
journal = {Neurocomputing},
volume = {70},
number = {13-15},
pages = {2400--2409},
year = {2007},
url = {https://doi.org/10.1016/j.neucom.2005.12.137},
doi = {10.1016/J.NEUCOM.2005.12.137},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijon/SimonLCV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/interfaces/CoxPC07,
author = {Louis Anthony Cox Jr. and
Douglas A. Popken and
Richard Carnevale},
title = {Quantifying Human Health Risks from Animal Antimicrobials},
journal = {Interfaces},
volume = {37},
number = {1},
pages = {22--38},
year = {2007},
url = {https://doi.org/10.1287/inte.1060.0275},
doi = {10.1287/INTE.1060.0275},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/interfaces/CoxPC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jair/BredinPD07,
author = {Jonathan Bredin and
David C. Parkes and
Quang Duong},
title = {Chain: {A} Dynamic Double Auction Framework for Matching Patient Agents},
journal = {J. Artif. Intell. Res.},
volume = {30},
pages = {133--179},
year = {2007},
url = {https://doi.org/10.1613/jair.2303},
doi = {10.1613/JAIR.2303},
timestamp = {Mon, 21 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jair/BredinPD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/ChiangABHL07,
author = {Tsung{-}Han Chiang and
Mehmet Serkan Apaydin and
Douglas L. Brutlag and
David Hsu and
Jean{-}Claude Latombe},
title = {Using Stochastic Roadmap Simulation to Predict Experimental Quantities
in Protein Folding Kinetics: Folding Rates and Phi-Values},
journal = {J. Comput. Biol.},
volume = {14},
number = {5},
pages = {578--593},
year = {2007},
url = {https://doi.org/10.1089/cmb.2007.R004},
doi = {10.1089/CMB.2007.R004},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/ChiangABHL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/ZhaoSZZX07,
author = {D. W. Zhao and
S. F. Song and
S. L. Zhao and
F. J. Zhang and
Z. Xu},
title = {Comparison of photoexcited energy transfer in the organic double-layer
and multilayer quantum well structures},
journal = {Microelectron. J.},
volume = {38},
number = {3},
pages = {422--425},
year = {2007},
url = {https://doi.org/10.1016/j.mejo.2007.01.013},
doi = {10.1016/J.MEJO.2007.01.013},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/ZhaoSZZX07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ChenKJCAFOAG07,
author = {J. T. Chen and
T. Kuhlmann and
G. H. Jansen and
D. Louis Collins and
H. L. Atkins and
M. S. Freedman and
P. W. O'Connor and
Douglas L. Arnold and
Canadian MS/BMT Study Group},
title = {Voxel-based analysis of the evolution of magnetization transfer ratio
to quantify remyelination and demyelination with histopathological
validation in a multiple sclerosis lesion},
journal = {NeuroImage},
volume = {36},
number = {4},
pages = {1152--1158},
year = {2007},
url = {https://doi.org/10.1016/j.neuroimage.2007.03.073},
doi = {10.1016/J.NEUROIMAGE.2007.03.073},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ChenKJCAFOAG07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/AjembaDHR07,
author = {Peter O. Ajemba and
Nelson G. Durdle and
Doug L. Hill and
V. James Raso},
title = {A Torso-Imaging System to Quantify the Deformity Associated With Scoliosis},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {56},
number = {5},
pages = {1520--1526},
year = {2007},
url = {https://doi.org/10.1109/TIM.2007.903592},
doi = {10.1109/TIM.2007.903592},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/AjembaDHR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/GaubatzH07a,
author = {Matthew Gaubatz and
Sheila S. Hemami},
title = {Efficient Entropy Estimation Based on Doubly Stochastic Models for
Quantized Wavelet Image Data},
journal = {{IEEE} Trans. Image Process.},
volume = {16},
number = {4},
pages = {967--981},
year = {2007},
url = {https://doi.org/10.1109/TIP.2007.891784},
doi = {10.1109/TIP.2007.891784},
timestamp = {Sun, 10 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tip/GaubatzH07a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/NelsonM07,
author = {Douglas L. Nelson and
Cathy McEvoy},
title = {Entangled Associative Structures and Context},
booktitle = {Quantum Interaction, Papers from the 2007 {AAAI} Spring Symposium,
Technical Report SS-07-08, Stanford, California, USA, March 26-28,
2007},
pages = {98--105},
publisher = {{AAAI}},
year = {2007},
url = {http://www.aaai.org/Library/Symposia/Spring/2007/ss07-08-015.php},
timestamp = {Wed, 29 Mar 2017 16:45:25 +0200},
biburl = {https://dblp.org/rec/conf/aaaiss/NelsonM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ciss/SunCGCD07,
author = {Xiantao Sun and
Leonard J. Cimini Jr. and
Larry J. Greenstein and
Douglas S. Chan and
Brett Douglas},
title = {Performance Evaluation of Quantized Feedback Beamforming in {IEEE}
802.11n Wireless Networks},
booktitle = {Proceedings of the 41st Annual Conference on Information Sciences
and Systems, {CISS} 2007, 14-16 March 2007, Johns Hopkins University,
Department of Electrical Engineering, Baltimore, MD, {USA}},
pages = {884--888},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/CISS.2007.4298435},
doi = {10.1109/CISS.2007.4298435},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ciss/SunCGCD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icannga/VelezO07,
author = {Mario V{\'{e}}lez and
Juan Ospina},
editor = {Bartlomiej Beliczynski and
Andrzej Dzielinski and
Marcin Iwanowski and
Bernardete Ribeiro},
title = {Universal Quantum Gates Via Yang-Baxterization of Dihedral Quantum
Double},
booktitle = {Adaptive and Natural Computing Algorithms, 8th International Conference,
{ICANNGA} 2007, Warsaw, Poland, April 11-14, 2007, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {4431},
pages = {120--127},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-71618-1\_14},
doi = {10.1007/978-3-540-71618-1\_14},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/icannga/VelezO07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/QuanZD07,
author = {Xiaomei Quan and
Hongbin Zhang and
Hongchen Dou},
editor = {De{-}Shuang Huang and
Laurent Heutte and
Marco Loog},
title = {Steganalysis for {JPEG} Images Based on Statistical Features of Stego
and Cover Images},
booktitle = {Advanced Intelligent Computing Theories and Applications. With Aspects
of Theoretical and Methodological Issues, Third International Conference
on Intelligent Computing, {ICIC} 2007, Qingdao, China, August 21-24,
2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4681},
pages = {970--977},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-74171-8\_98},
doi = {10.1007/978-3-540-74171-8\_98},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/icic/QuanZD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/OsterDL07,
author = {Matthias Oster and
Rodney J. Douglas and
Shih{-}Chii Liu},
title = {Quantifying Input and Output Spike Statistics of a Winner-Take-All
Network in a Vision System},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2007), 27-20
May 2007, New Orleans, Louisiana, {USA}},
pages = {853--856},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ISCAS.2007.378040},
doi = {10.1109/ISCAS.2007.378040},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/OsterDL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/TadicD07,
author = {Vladislav Z. B. Tadic and
Arnaud Doucet},
title = {A Monte Carlo Algorithm for Optimal Quantization in Hidden Markov
Models},
booktitle = {{IEEE} International Symposium on Information Theory, {ISIT} 2007,
Nice, France, June 24-29, 2007},
pages = {1121--1125},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ISIT.2007.4557374},
doi = {10.1109/ISIT.2007.4557374},
timestamp = {Thu, 11 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isit/TadicD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miigp/ShenSKS07,
author = {Eric Shen and
Guy Shechter and
Jochen Kruecker and
Douglas Stanton},
editor = {Kevin R. Cleary and
Michael I. Miga},
title = {Quantification of {AC} electromagnetic tracking system accuracy in
a {CT} scanner environment},
booktitle = {Medical Imaging 2007: Visualization and Image-Guided Procedures, San
Diego, CA, United States, 17-22 February 2007},
series = {{SPIE} Proceedings},
volume = {6509},
pages = {65090L},
publisher = {{SPIE}},
year = {2007},
url = {https://doi.org/10.1117/12.710836},
doi = {10.1117/12.710836},
timestamp = {Wed, 23 May 2018 15:10:40 +0200},
biburl = {https://dblp.org/rec/conf/miigp/ShenSKS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cars/HoyosSMDOMD06,
author = {Marcela Hern{\'{a}}ndez Hoyos and
Jean{-}Michel Serfaty and
Albinka Maghiar and
Catherine Desbleds{-}Mansard and
Maciej Orkisz and
Isabelle E. Magnin and
Philippe Douek},
title = {Evaluation of semi-automatic arterial stenosis quantification},
journal = {Int. J. Comput. Assist. Radiol. Surg.},
volume = {1},
number = {3},
pages = {167--175},
year = {2006},
url = {https://doi.org/10.1007/s11548-006-0049-1},
doi = {10.1007/S11548-006-0049-1},
timestamp = {Thu, 11 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cars/HoyosSMDOMD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/FreimerTT06,
author = {Michael Freimer and
Douglas J. Thomas and
John G. Tyworth},
title = {The value of setup cost reduction and process improvement for the
economic production quantity model with defects},
journal = {Eur. J. Oper. Res.},
volume = {173},
number = {1},
pages = {241--251},
year = {2006},
url = {https://doi.org/10.1016/j.ejor.2004.11.024},
doi = {10.1016/J.EJOR.2004.11.024},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/FreimerTT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/BasakNMHK06,
author = {Subhash C. Basak and
Ramanathan Natarajan and
Denise R. Mills and
Douglas M. Hawkins and
Jessica J. Kraker},
title = {Quantitative Structure-Activity Relationship Modeling of Juvenile
Hormone Mimetic Compounds for \emph{Culex }\emph{P}\emph{ipiens} Larvae,
with a Discussion of Descriptor-Thinning Methods},
journal = {J. Chem. Inf. Model.},
volume = {46},
number = {1},
pages = {65--77},
year = {2006},
url = {https://doi.org/10.1021/ci050215y},
doi = {10.1021/CI050215Y},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/BasakNMHK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/HawkinsBKGW06,
author = {Douglas M. Hawkins and
Subhash C. Basak and
Jessica J. Kraker and
Kevin T. Geiss and
Frank A. Witzmann},
title = {Combining Chemodescriptors and Biodescriptors in Quantitative Structure-Activity
Relationship Modeling},
journal = {J. Chem. Inf. Model.},
volume = {46},
number = {1},
pages = {9--16},
year = {2006},
url = {https://doi.org/10.1021/ci050252p},
doi = {10.1021/CI050252P},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/HawkinsBKGW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/TetkoSAYDFHFJLV06,
author = {Igor V. Tetko and
Vitaly P. Solov'ev and
Alexey V. Antonov and
Xiaojun Yao and
Jean{-}Pierre Doucet and
Bo Tao Fan and
Frank Hoonakker and
Denis Fourches and
Piere Jost and
Nicolas Lachiche and
Alexandre Varnek},
title = {Benchmarking of Linear and Nonlinear Approaches for Quantitative Structure-Property
Relationship Studies of Metal Complexation with Ionophores},
journal = {J. Chem. Inf. Model.},
volume = {46},
number = {2},
pages = {808--819},
year = {2006},
url = {https://doi.org/10.1021/ci0504216},
doi = {10.1021/CI0504216},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/TetkoSAYDFHFJLV06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/SchummKHLWGBAS06,
author = {Thorsten Schumm and
Peter Kr{\"{u}}ger and
Sebastian Hofferberth and
Igor Lesanovsky and
Stefan Wildermuth and
Steffen Groth and
I. Bar{-}Joseph and
L. Mauritz Andersson and
J{\"{o}}rg Schmiedmayer},
title = {A Double Well Interferometer on an Atom Chip},
journal = {Quantum Inf. Process.},
volume = {5},
number = {6},
pages = {537--558},
year = {2006},
url = {https://doi.org/10.1007/s11128-006-0033-2},
doi = {10.1007/S11128-006-0033-2},
timestamp = {Fri, 10 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/qip/SchummKHLWGBAS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/synthese/DouvenM06,
author = {Igor Douven and
Wouter Meijs},
title = {Bootstrap Confirmation Made Quantitative},
journal = {Synth.},
volume = {149},
number = {1},
pages = {97--132},
year = {2006},
url = {https://doi.org/10.1007/s11229-004-6250-2},
doi = {10.1007/S11229-004-6250-2},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/synthese/DouvenM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/LahoutiFSK06,
author = {Farshad Lahouti and
Ahmad R. Fazel and
A. H. Safavi{-}Naeini and
Amir K. Khandani},
title = {Single and double frame coding of speech {LPC} parameters using a
lattice-based quantization scheme},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {14},
number = {5},
pages = {1624--1632},
year = {2006},
url = {https://doi.org/10.1109/TSA.2005.858560},
doi = {10.1109/TSA.2005.858560},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/LahoutiFSK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/CaoLFCGM06,
author = {Hanqing Cao and
Douglas E. Lake and
James E. Ferguson II and
Christian A. Chisholm and
M. Pamela Griffin and
J. Randall Moorman},
title = {Toward quantitative fetal heart rate monitoring},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {53},
number = {1},
pages = {111--118},
year = {2006},
url = {https://doi.org/10.1109/TBME.2005.859807},
doi = {10.1109/TBME.2005.859807},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/CaoLFCGM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/DoukasMCP06,
author = {Charalampos N. Doukas and
Ilias Maglogiannis and
Aristotelis A. Chatziioannou and
Andreas Papapetropoulos},
title = {Automated Angiogenesis Quantification through advanced Image Processing
Techniques},
booktitle = {28th International Conference of the {IEEE} Engineering in Medicine
and Biology Society, {EMBC} 2006, New York City, NY, USA, August 30
- September 3, 2006, Main Volume},
pages = {2345--2348},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IEMBS.2006.260675},
doi = {10.1109/IEMBS.2006.260675},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/DoukasMCP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iih-msp/QiaoWWX06,
author = {Xiao{-}hua Qiao and
Shuxun Wang and
Quan Wen and
Zhao Xu},
title = {A Robust Watermarking Algorithm Adopting Double Embedding},
booktitle = {Second International Conference on Intelligent Information Hiding
and Multimedia Signal Processing {(IIH-MSP} 2006), Pasadena, California,
USA, December 18-20, 2006, Proceedings},
pages = {63--66},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/IIH-MSP.2006.265120},
doi = {10.1109/IIH-MSP.2006.265120},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iih-msp/QiaoWWX06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/PanDL06,
author = {Guanyu Pan and
Quansheng Dou and
Xiaohua Liu},
title = {Performance of two Improved Particle Swarm Optimization In Dynamic
Optimization Environments},
booktitle = {Proceedings of the Sixth International Conference on Intelligent Systems
Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan,
China},
pages = {1024--1028},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ISDA.2006.253752},
doi = {10.1109/ISDA.2006.253752},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isda/PanDL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recomb/ChiangABHL06,
author = {Tsung{-}Han Chiang and
Mehmet Serkan Apaydin and
Douglas L. Brutlag and
David Hsu and
Jean{-}Claude Latombe},
editor = {Alberto Apostolico and
Concettina Guerra and
Sorin Istrail and
Pavel A. Pevzner and
Michael S. Waterman},
title = {Predicting Experimental Quantities in Protein Folding Kinetics Using
Stochastic Roadmap Simulation},
booktitle = {Research in Computational Molecular Biology, 10th Annual International
Conference, {RECOMB} 2006, Venice, Italy, April 2-5, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3909},
pages = {410--424},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11732990\_34},
doi = {10.1007/11732990\_34},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/recomb/ChiangABHL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gc/FengK05,
author = {Rongquan Feng and
Jin Ho Kwak},
title = {Circulant Double Coverings of a Circulant Graph of Valency Four},
journal = {Graphs Comb.},
volume = {21},
number = {4},
pages = {385--400},
year = {2005},
url = {https://doi.org/10.1007/s00373-005-0623-2},
doi = {10.1007/S00373-005-0623-2},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gc/FengK05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/IvanciucIK05,
author = {Teodora Ivanciuc and
Ovidiu Ivanciuc and
Douglas J. Klein},
title = {Posetic Quantitative Superstructure/Activity Relationships (QSSARs)
for Chlorobenzenes},
journal = {J. Chem. Inf. Model.},
volume = {45},
number = {4},
pages = {870--879},
year = {2005},
url = {https://doi.org/10.1021/ci0501342},
doi = {10.1021/CI0501342},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/IvanciucIK05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/Korotkov05,
author = {Alexander N. Korotkov},
title = {Quantum feedback of a double-dot qubit},
journal = {Microelectron. J.},
volume = {36},
number = {3-6},
pages = {253--255},
year = {2005},
url = {https://doi.org/10.1016/j.mejo.2005.02.019},
doi = {10.1016/J.MEJO.2005.02.019},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/Korotkov05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/Rodriguez-VargasG05,
author = {Isaac Rodr{\'{\i}}guez{-}Vargas and
Luis Manuel Gaggero{-}Sager},
title = {Thomas-Fermi approximation of double n-type delta-doped GaAs quantum
wells: sub-band and transport calculations},
journal = {Microelectron. J.},
volume = {36},
number = {3-6},
pages = {404--406},
year = {2005},
url = {https://doi.org/10.1016/j.mejo.2005.02.031},
doi = {10.1016/J.MEJO.2005.02.031},
timestamp = {Tue, 16 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/Rodriguez-VargasG05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/AhnCD05,
author = {Hyo{-}Sung Ahn and
YangQuan Chen and
Huifang Dou},
title = {State-periodic adaptive compensation of cogging and Coulomb friction
in permanent magnet linear motors},
booktitle = {American Control Conference, {ACC} 2005, Portland, OR, USA, 8-10 June,
2005},
pages = {3036--3041},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/ACC.2005.1470437},
doi = {10.1109/ACC.2005.1470437},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/amcc/AhnCD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/EstradaJ05,
author = {Francisco J. Estrada and
Allan D. Jepson},
title = {Quantitative Evaluation of a Novel Image Segmentation Algorithm},
booktitle = {2005 {IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition {(CVPR} 2005), 20-26 June 2005, San Diego, CA, {USA}},
pages = {1132--1139},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/CVPR.2005.284},
doi = {10.1109/CVPR.2005.284},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/EstradaJ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isnn/DouZPLL05,
author = {Quansheng Dou and
Chunguang Zhou and
Guanyu Pan and
Hongwen Luo and
Quan Liu},
editor = {Jun Wang and
Xiaofeng Liao and
Zhang Yi},
title = {Neural Particle Swarm Optimization for Casing Damage Prediction},
booktitle = {Advances in Neural Networks - {ISNN} 2005, Second International Symposium
on Neural Networks, Chongqing, China, May 30 - June 1, 2005, Proceedings,
Part {III}},
series = {Lecture Notes in Computer Science},
volume = {3498},
pages = {903--907},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11427469\_143},
doi = {10.1007/11427469\_143},
timestamp = {Tue, 20 Aug 2024 07:54:44 +0200},
biburl = {https://dblp.org/rec/conf/isnn/DouZPLL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vrst/NarayanWZBB05,
author = {Michael Narayan and
Leo Waugh and
Xiaoyu Zhang and
Pradyut Bafna and
Doug A. Bowman},
editor = {Gurminder Singh and
Rynson W. H. Lau and
Yiorgos Chrysanthou and
Rudolph P. Darken},
title = {Quantifying the benefits of immersion for collaboration in virtual
environments},
booktitle = {Proceedings of the {ACM} Symposium on Virtual Reality Software and
Technology, {VRST} 2005, Monterey, CA, USA, November 7-9, 2005},
pages = {78--81},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1101616.1101632},
doi = {10.1145/1101616.1101632},
timestamp = {Thu, 05 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vrst/NarayanWZBB05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccr/CurcicFCDWFC04,
author = {Tatjana Curcic and
Mark E. Filipkowski and
Almadena Yu. Chtchelkanova and
Philip A. D'Ambrosio and
Stuart A. Wolf and
Michael Foster and
Douglas Cochran},
title = {Quantum networks: from quantum cryptography to quantum architecture},
journal = {Comput. Commun. Rev.},
volume = {34},
number = {5},
pages = {3--8},
year = {2004},
url = {https://doi.org/10.1145/1039111.1039117},
doi = {10.1145/1039111.1039117},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccr/CurcicFCDWFC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/FengK04,
author = {Rongquan Feng and
Jin Ho Kwak},
title = {Typical circulant double coverings of a circulant graph},
journal = {Discret. Math.},
volume = {277},
number = {1-3},
pages = {73--85},
year = {2004},
url = {https://doi.org/10.1016/S0012-365X(03)00245-0},
doi = {10.1016/S0012-365X(03)00245-0},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/FengK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/LiY04,
author = {Yiming Li and
Shao{-}Ming Yu},
title = {A Two-Dimensional Quantum Transport Simulation of Nanoscale Double-Gate
MOSFETs Using Parallel Adaptive Technique},
journal = {{IEICE} Trans. Inf. Syst.},
volume = {87-D},
number = {7},
pages = {1751--1758},
year = {2004},
url = {http://search.ieice.org/bin/summary.php?id=e87-d\_7\_1751},
timestamp = {Fri, 24 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieicet/LiY04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmmsc/FukudaK04,
author = {Daijiro Fukuda and
Ken'ichi Kuga},
title = {Twisted quantum doubles},
journal = {Int. J. Math. Math. Sci.},
volume = {2004},
number = {28},
pages = {1477--1486},
year = {2004},
url = {https://doi.org/10.1155/S016117120430236X},
doi = {10.1155/S016117120430236X},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmmsc/FukudaK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/SimonLCFV04,
author = {Geoffroy Simon and
Amaury Lendasse and
Marie Cottrell and
Jean{-}Claude Fort and
Michel Verleysen},
title = {Double quantization of the regressor space for long-term time series
prediction: method and proof of stability},
journal = {Neural Networks},
volume = {17},
number = {8-9},
pages = {1169--1181},
year = {2004},
url = {https://doi.org/10.1016/j.neunet.2004.08.008},
doi = {10.1016/J.NEUNET.2004.08.008},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nn/SimonLCFV04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/TadicD04,
author = {Vladislav B. Tadic and
Amaud Doucet},
title = {A simulation based algorithm for optimal quantization in non-linear/non-Gaussian
state-space models},
booktitle = {Proceedings of the 2004 American Control Conference, {ACC} 2004, Boston,
MA, USA, June 30 - July 2, 2004},
pages = {5408--5413},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.23919/ACC.2004.1384713},
doi = {10.23919/ACC.2004.1384713},
timestamp = {Thu, 24 Nov 2022 09:21:27 +0100},
biburl = {https://dblp.org/rec/conf/amcc/TadicD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/etra/SantellaD04,
author = {Anthony Santella and
Douglas DeCarlo},
editor = {Andrew T. Duchowski and
Roel Vertegaal},
title = {Robust clustering of eye movement recordings for quantification of
visual interest},
booktitle = {Proceedings of the Eye Tracking Research {\&} Application Symposium,
{ETRA} 2004, San Antonio, Texas, USA, March 22-24, 2004},
pages = {27--34},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/968363.968368},
doi = {10.1145/968363.968368},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/etra/SantellaD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LiYT04,
author = {Tao Li and
Shao{-}quan Yang and
Jian{-}long Tang},
title = {Instantaneous frequency estimation using double-sided exponentially
forgetting transform},
booktitle = {2004 {IEEE} International Conference on Acoustics, Speech, and Signal
Processing, {ICASSP} 2004, Montreal, Quebec, Canada, May 17-21, 2004},
pages = {749--752},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ICASSP.2004.1326366},
doi = {10.1109/ICASSP.2004.1326366},
timestamp = {Mon, 22 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/LiYT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/BoadaDWTKBL04,
author = {Fernando E. Boada and
Denise Davis and
Kevin Walter and
Alejandro Torres{-}Trejo and
Douglas Kondziolka and
Walter Bartynski and
Frank Lieberman},
title = {Triple Quantum Filtered Sodium {MRI} of Primary Brain Tumors},
booktitle = {Proceedings of the 2004 {IEEE} International Symposium on Biomedical
Imaging: From Nano to Macro, Arlington, VA, USA, 15-18 April 2004},
pages = {1215--1218},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ISBI.2004.1398763},
doi = {10.1109/ISBI.2004.1398763},
timestamp = {Wed, 04 Oct 2023 16:23:55 +0200},
biburl = {https://dblp.org/rec/conf/isbi/BoadaDWTKBL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/ChenXD04,
author = {YangQuan Chen and
Dingyii Xue and
Huifang Dou},
title = {Fractional Calculus and Biomimetic Control},
booktitle = {2004 {IEEE} International Conference on Robotics and Biomimetics,
{ROBIO} 2004, Shenyang, China, August 22-26, 2004},
pages = {901--906},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ROBIO.2004.1521904},
doi = {10.1109/ROBIO.2004.1521904},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/robio/ChenXD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sca/RasmussenENMSGH04,
author = {Nick Rasmussen and
Douglas Enright and
Duc Quang Nguyen and
Sebastian Marino and
Nigel Sumner and
Willi Geiger and
Samir Hoon and
Ronald Fedkiw},
editor = {Norman I. Badler and
Mathieu Desbrun and
Ronan Boulic and
Dinesh K. Pai},
title = {Directable photorealistic liquids},
booktitle = {Proceedings of the 2004 {ACM} SIGGRAPH/Eurographics Symposium on Computer
Animation, Grenoble, France, August 27-29, 2004},
pages = {193--202},
publisher = {The Eurographics Association},
year = {2004},
url = {https://doi.org/10.2312/SCA/SCA04/193-202},
doi = {10.2312/SCA/SCA04/193-202},
timestamp = {Tue, 06 Nov 2018 11:06:53 +0100},
biburl = {https://dblp.org/rec/conf/sca/RasmussenENMSGH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vl/Bryant04,
author = {Sallyann Bryant},
title = {Double Trouble: Mixing Qualitative and Quantitative Methods in the
Study of eXtreme Programmers},
booktitle = {2004 {IEEE} Symposium on Visual Languages and Human-Centric Computing
{(VL/HCC} 2004), 26-29 September 2004, Rome, Italy},
pages = {55--61},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/VLHCC.2004.20},
doi = {10.1109/VLHCC.2004.20},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vl/Bryant04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/ThomasH03,
author = {Douglas J. Thomas and
Steven T. Hackman},
title = {A committed delivery strategy with fixed frequency and quantity},
journal = {Eur. J. Oper. Res.},
volume = {148},
number = {2},
pages = {363--373},
year = {2003},
url = {https://doi.org/10.1016/S0377-2217(02)00398-3},
doi = {10.1016/S0377-2217(02)00398-3},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/ThomasH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/SidlesGDC03,
author = {John A. Sidles and
Joseph L. Garbini and
William M. Dougherty and
Shih{-}hui Chao},
title = {The classical and quantum theory of thermal magnetic noise, with applications
in spintronics and quantum microscopy},
journal = {Proc. {IEEE}},
volume = {91},
number = {5},
pages = {799--816},
year = {2003},
url = {https://doi.org/10.1109/JPROC.2003.811796},
doi = {10.1109/JPROC.2003.811796},
timestamp = {Mon, 30 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/SidlesGDC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasII/RomboutsRW03,
author = {Pieter Rombouts and
Johan Raman and
Ludo Weyten},
title = {An approach to tackle quantization noise folding in double-sampling
{\(\Sigma\)}{\(\Delta\)} modulation {A/D} converters},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {50},
number = {4},
pages = {157--163},
year = {2003},
url = {https://doi.org/10.1109/TCSII.2003.810485},
doi = {10.1109/TCSII.2003.810485},
timestamp = {Tue, 27 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcasII/RomboutsRW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/BounouhPPGA03,
author = {A. Bounouh and
Wilfrid Poirier and
Fran{\c{c}}ois P. M. Piquemal and
G{\'{e}}rard Genev{\`{e}}s and
J. P. Andr{\'{e}}},
title = {Quantum resistance standards with double 2DEG},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {52},
number = {2},
pages = {555--558},
year = {2003},
url = {https://doi.org/10.1109/TIM.2003.811655},
doi = {10.1109/TIM.2003.811655},
timestamp = {Sat, 12 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/BounouhPPGA03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/appt/DouWJH03,
author = {Lei Dou and
Quanyuan Wu and
Yan Jia and
Weihong Han},
editor = {Xingming Zhou and
Stefan J{\"{a}}hnichen and
Ming Xu and
Jiannong Cao},
title = {A Dynamic Reconfiguration Platform Based on Distributed Component
Technology {CCM}},
booktitle = {Advanced Parallel Programming Technologies, 5th International Workshop,
{APPT} 2003, Xiamen, China, September 17-19, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2834},
pages = {520--524},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-39425-9\_61},
doi = {10.1007/978-3-540-39425-9\_61},
timestamp = {Tue, 14 Apr 2020 13:23:11 +0200},
biburl = {https://dblp.org/rec/conf/appt/DouWJH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/MeedenNBK03,
author = {Lisa Meeden and
Tia Newhall and
Douglas S. Blank and
Deepak Kumar},
editor = {Vassilios Dagdilelis and
Maya Satratzemi and
David Finkel and
Roger D. Boyle and
Georgios Evangelidis},
title = {Using departmental surveys to assess computing culture: quantifying
gender differences in the classroom},
booktitle = {Proceedings of the 8th Annual {SIGCSE} Conference on Innovation and
Technology in Computer Science Education, ITiCSE 2003, Thessaloniki,
Greece, June 30 - July 2, 2003},
pages = {188--192},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/961511.961563},
doi = {10.1145/961511.961563},
timestamp = {Tue, 09 Mar 2021 16:21:56 +0100},
biburl = {https://dblp.org/rec/conf/iticse/MeedenNBK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/DzhunushalievS02,
author = {Vladimir Dzhunushaliev and
Douglas Singleton},
title = {Algorithmic Complexity in Cosmology and Quantum Gravity},
journal = {Entropy},
volume = {4},
number = {1},
pages = {3--31},
year = {2002},
url = {https://doi.org/10.3390/e4010003},
doi = {10.3390/E4010003},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/DzhunushalievS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/XiangLZZHFDP02,
author = {Y. H. Xiang and
Mancang Liu and
X. Y. Zhang and
Ruisheng Zhang and
Zhide Hu and
Bo Tao Fan and
Jean{-}Pierre Doucet and
Annick Panaye},
title = {Quantitative Prediction of Liquid Chromatography Retention of N-Benzylideneanilines
Based on Quantum Chemical Parameters and Radial Basis Function Neural
Network},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {42},
number = {3},
pages = {592--597},
year = {2002},
url = {https://doi.org/10.1021/ci010067l},
doi = {10.1021/CI010067L},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/XiangLZZHFDP02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/SchuppGOMSLL02,
author = {Sibylle Schupp and
Douglas P. Gregor and
B. Osman and
David R. Musser and
Jeremy G. Siek and
Lie{-}Quan Lee and
Andrew Lumsdaine},
title = {Concept-Based Component Libraries and Optimizing Compilers},
booktitle = {16th International Parallel and Distributed Processing Symposium {(IPDPS}
2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts
Proceedings},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/IPDPS.2002.1016576},
doi = {10.1109/IPDPS.2002.1016576},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/SchuppGOMSLL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/RomboutsRW02,
author = {Pieter Rombouts and
Johan Raman and
Ludo Weyten},
title = {An efficient technique to eliminate quantisation noise folding in
double-sampling Sigma-Delta modulators},
booktitle = {Proceedings of the 2002 International Symposium on Circuits and Systems,
{ISCAS} 2002, Scottsdale, Arizona, USA, May 26-29, 2002},
pages = {707--710},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/ISCAS.2002.1010322},
doi = {10.1109/ISCAS.2002.1010322},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/RomboutsRW02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semweb/McDermottD02,
author = {Drew V. McDermott and
Dejing Dou},
editor = {Ian Horrocks and
James A. Hendler},
title = {Representing Disjunction and Quantifiers in {RDF}},
booktitle = {The Semantic Web - {ISWC} 2002, First International Semantic Web Conference,
Sardinia, Italy, June 9-12, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2342},
pages = {250--263},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-48005-6\_20},
doi = {10.1007/3-540-48005-6\_20},
timestamp = {Tue, 12 Apr 2022 14:46:29 +0200},
biburl = {https://dblp.org/rec/conf/semweb/McDermottD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/KatritzkyPTBBKM01,
author = {Alan R. Katritzky and
Ruslan Petrukhin and
Douglas B. Tatham and
Subhash C. Basak and
Emilio Benfenati and
Mati Karelson and
Uko Maran},
title = {Interpretation of Quantitative Structure-Property and -Activity Relationships},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {41},
number = {3},
pages = {679--685},
year = {2001},
url = {https://doi.org/10.1021/ci000134w},
doi = {10.1021/CI000134W},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/KatritzkyPTBBKM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/KatritzkyTM01a,
author = {Alan R. Katritzky and
Douglas B. Tatham and
Uko Maran},
title = {Theoretical Descriptors for the Correlation of Aquatic Toxicity of
Environmental Pollutants by Quantitative Structure-Toxicity Relationships},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {41},
number = {5},
pages = {1162--1176},
year = {2001},
url = {https://doi.org/10.1021/ci010011r},
doi = {10.1021/CI010011R},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/KatritzkyTM01a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/PanayiotopoulosDC01,
author = {Ilias Panayiotopoulos and
Demosthenes G. Doumenis and
Phillip Constantinou},
title = {Anti-hangup binary quantized {DPLL} technique for timing recovery
in {QAM} symbol-rate sampled receivers},
journal = {{IEEE} Trans. Commun.},
volume = {49},
number = {2},
pages = {360--374},
year = {2001},
url = {https://doi.org/10.1109/26.905900},
doi = {10.1109/26.905900},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/PanayiotopoulosDC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/TanDCL01,
author = {Kok Kiong Tan and
Huifang Dou and
YangQuan Chen and
Tong Heng Lee},
title = {High precision linear motor control via relay-tuning and iterative
learning based on zero-phase filtering},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {9},
number = {2},
pages = {244--253},
year = {2001},
url = {https://doi.org/10.1109/87.911376},
doi = {10.1109/87.911376},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcst/TanDCL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/Desbleds-MansardACONDM01,
author = {Catherine Desbleds{-}Mansard and
Alfred Anwander and
Linda Chaabane and
Maciej Orkisz and
Bruno Neyran and
Philippe Douek and
Isabelle E. Magnin},
editor = {Wladyslaw Skarbek},
title = {Dynamic Active Contour Model for Size Independent Blood Vessel Lumen
Segmentation and Quantification in High-Resolution Magnetic Resonance
Images},
booktitle = {Computer Analysis of Images and Patterns, 9th International Conference,
{CAIP} 2001 Warsaw, Poland, September 5-7, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2124},
pages = {264--273},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-44692-3\_33},
doi = {10.1007/3-540-44692-3\_33},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/caip/Desbleds-MansardACONDM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/FazelK01,
author = {Ahmad R. Fazel and
Amir K. Khandani},
title = {Single and double frame quantization of {LSF} parameters using noise
feedback coding},
booktitle = {{IEEE} International Conference on Communications, {ICC} 2001, June
11-14, Helsinki, Finland},
pages = {2449--2452},
publisher = {{IEEE}},
year = {2001},
url = {https://doi.org/10.1109/ICC.2001.936587},
doi = {10.1109/ICC.2001.936587},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/icc/FazelK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/Desbleds-MansardACONDM01,
author = {Catherine Desbleds{-}Mansard and
Alfred Anwander and
Linda Chaabane and
Maciej Orkisz and
Bruno Neyran and
Philippe Douek and
Isabelle E. Magnin},
editor = {Wiro J. Niessen and
Max A. Viergever},
title = {Size Independent Active Contour Model for Blood Vessel Lumen Quantification
in High-Resolution Magnetic Resonance Images},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2001, 4th International Conference, Utrecht, The Netherlands, October
14-17, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2208},
pages = {854--861},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45468-3\_102},
doi = {10.1007/3-540-45468-3\_102},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/miccai/Desbleds-MansardACONDM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/KirillovM00,
author = {Anatol N. Kirillov and
Toshiaki Maeno},
title = {Quantum double Schubert polynomials, quantum Schubert polynomials
and Vafa-Intriligator formula},
journal = {Discret. Math.},
volume = {217},
number = {1-3},
pages = {191--223},
year = {2000},
url = {https://doi.org/10.1016/S0012-365X(99)00263-0},
doi = {10.1016/S0012-365X(99)00263-0},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/KirillovM00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jilp/SkadronMC00,
author = {Kevin Skadron and
Margaret Martonosi and
Douglas W. Clark},
title = {Speculative Updates of Local and Global Branch History: {A} Quantitative
Analysis},
journal = {J. Instr. Level Parallelism},
volume = {2},
year = {2000},
url = {http://www.jilp.org/vol2/v2paper1.pdf},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jilp/SkadronMC00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/Hernandez-HoyosAORDM00,
author = {Marcela Hern{\'{a}}ndez Hoyos and
Alfred Anwander and
Maciej Orkisz and
Jean{-}Pierre Roux and
Philippe Douek and
Isabelle E. Magnin},
editor = {Scott L. Delp and
Anthony M. DiGioia and
Branislav Jaramaz},
title = {A Deformable Vessel Model with Single Point Initialization for Segmentation,
Quantification and Visualization of Blood Vessels in 3D {MRA}},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2000, Third International Conference, Pittsburgh, Pennsylvania, USA,
October 11-14, 2000, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1935},
pages = {735--745},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/978-3-540-40899-4\_76},
doi = {10.1007/978-3-540-40899-4\_76},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/miccai/Hernandez-HoyosAORDM00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/LoBT99,
author = {Shih{-}Hsien Lo and
Douglas A. Buchanan and
Yuan Taur},
title = {Modeling and characterization of quantization, polysilicon depletion,
and direct tunneling effects in MOSFETs with ultrathin oxides},
journal = {{IBM} J. Res. Dev.},
volume = {43},
number = {3},
pages = {327--338},
year = {1999},
url = {https://doi.org/10.1147/rd.433.0327},
doi = {10.1147/RD.433.0327},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/LoBT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/SihZBO99,
author = {Haris J. Sih and
Douglas P. Zipes and
Edward J. Berbari and
Jeffrey E. Olgin},
title = {A high-temporal resolution algorithm for quantifying organization
during atrial fibrillation},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {46},
number = {4},
pages = {440--450},
year = {1999},
url = {https://doi.org/10.1109/10.752941},
doi = {10.1109/10.752941},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/SihZBO99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/WoodD99,
author = {Barry M. Wood and
Robert J. Douglas},
title = {Quantifying demonstrated equivalence},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {48},
number = {2},
pages = {162--165},
year = {1999},
url = {https://doi.org/10.1109/19.769553},
doi = {10.1109/19.769553},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/WoodD99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icai/MahapatraCB99,
author = {Nihar R. Mahapatra and
Douglas E. Covelli and
Yuval Beres},
editor = {Hamid R. Arabnia},
title = {A Quantitative Evaluation of Limited-Memory Branch-and-Bound Algorithms},
booktitle = {Proceedings of the International Conference on Artificial Intelligence,
{IC-AI} '99, June 28 - July 1, 1999, Las Vegas, Nevada, USA, Volume
1},
pages = {84--90},
publisher = {{CSREA} Press},
year = {1999},
timestamp = {Fri, 26 Mar 2004 13:51:06 +0100},
biburl = {https://dblp.org/rec/conf/icai/MahapatraCB99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hf/GillanWHC98,
author = {Douglas J. Gillan and
Christopher D. Wickens and
Justin G. Hollands and
C. Melody Carswell},
title = {Guidelines for Presenting Quantitative Data in {HFES} Publications},
journal = {Hum. Factors},
volume = {40},
number = {1},
pages = {28--41},
year = {1998},
url = {https://doi.org/10.1518/001872098779480640},
doi = {10.1518/001872098779480640},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hf/GillanWHC98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/JensenB98,
author = {Vidar R. Jensen and
Knut J. B{\o}rve},
title = {An investigation of the quantum chemical description of the ethylenic
double bond in reactions: {II.} Insertion of ethylene into a titanium-carbon
bond},
journal = {J. Comput. Chem.},
volume = {19},
number = {8},
pages = {947--960},
year = {1998},
url = {https://doi.org/10.1002/(SICI)1096-987X(199806)19:8\<947::AID-JCC13\>3.0.CO;2-4},
doi = {10.1002/(SICI)1096-987X(199806)19:8\<947::AID-JCC13\>3.0.CO;2-4},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/JensenB98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/DouglasZS98,
author = {Scott C. Douglas and
Quanhong Zhu and
Kent F. Smith},
title = {A pipelined {LMS} adaptive {FIR} filter architecture without adaptation
delay},
journal = {{IEEE} Trans. Signal Process.},
volume = {46},
number = {3},
pages = {775--779},
year = {1998},
url = {https://doi.org/10.1109/78.661345},
doi = {10.1109/78.661345},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsp/DouglasZS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vlsi/KrauseMTW98,
author = {Paul G. Krause and
Rachel M. Mueller and
P. Douglas Tougaw and
Janelle M. Weidner},
title = {An Alternative Geometry for Quantum Cellular Automata},
journal = {{VLSI} Design},
volume = {8},
number = {1-4},
pages = {549--553},
year = {1998},
url = {https://doi.org/10.1155/1998/63047},
doi = {10.1155/1998/63047},
timestamp = {Mon, 08 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vlsi/KrauseMTW98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/DoulamisDD98,
author = {Anastasios D. Doulamis and
Nikolaos D. Doulamis and
Anastasios Delopoulos},
title = {Optimal subband analysis filters compensating for quantization and
additive noise},
booktitle = {9th European Signal Processing Conference, {EUSIPCO} 1998, Island
of Rhodes, Greece, 8-11 September, 1998},
pages = {1--4},
publisher = {{IEEE}},
year = {1998},
url = {https://ieeexplore.ieee.org/document/7089812/},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/DoulamisDD98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/Dougherty98,
author = {Geoffrey Dougherty},
editor = {Kenneth M. Hanson},
title = {Quantitative assessment of mammographic image quality},
booktitle = {Medical Imaging 1998: Image Processing, San Diego, CA, United States,
21-26 February 1998},
series = {{SPIE} Proceedings},
volume = {3338},
publisher = {{SPIE}},
year = {1998},
url = {https://doi.org/10.1117/12.310963},
doi = {10.1117/12.310963},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miip/Dougherty98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qcqc/BowdenDH98,
author = {Charles M. Bowden and
Jonathan P. Dowling and
Steven P. Hotaling},
editor = {Colin P. Williams},
title = {Quantum Computing Using Electron-Nuclear Double Resonances},
booktitle = {Quantum Computing and Quantum Communications, First {NASA} International
Conference, QCQC'98, Palm Springs, California, USA, February 17-20,
1998, Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {1509},
pages = {364--372},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/3-540-49208-9\_33},
doi = {10.1007/3-540-49208-9\_33},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/qcqc/BowdenDH98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/imst/BoadaGNST97,
author = {Fernando E. Boada and
Joseph S. Gillen and
Douglas C. Noll and
Gary X. Shen and
Keith R. Thulborn},
title = {Data acquisition and postprocessing strategies for fast quantitative
sodium imaging},
journal = {Int. J. Imaging Syst. Technol.},
volume = {8},
number = {6},
pages = {544--550},
year = {1997},
url = {https://doi.org/10.1002/(SICI)1098-1098(1997)8:6\<544::AID-IMA6\>3.0.CO;2-A},
doi = {10.1002/(SICI)1098-1098(1997)8:6\<544::AID-IMA6\>3.0.CO;2-A},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/imst/BoadaGNST97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jphil/Delmas-Rigoutsos97,
author = {Yannis Delmas{-}Rigoutsos},
title = {A Double Deduction System for Quantum Logic Based On Natural Deduction},
journal = {J. Philos. Log.},
volume = {26},
number = {1},
pages = {57--67},
year = {1997},
url = {https://doi.org/10.1023/A:1017941704456},
doi = {10.1023/A:1017941704456},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jphil/Delmas-Rigoutsos97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/LentT97,
author = {Craig S. Lent and
P. Douglas Tougaw},
title = {A device architecture for computing with quantum dots},
journal = {Proc. {IEEE}},
volume = {85},
number = {4},
pages = {541--557},
year = {1997},
url = {https://doi.org/10.1109/5.573740},
doi = {10.1109/5.573740},
timestamp = {Mon, 04 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/LentT97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ZhuDS97,
author = {Quanhong Zhu and
Scott C. Douglas and
Kent F. Smith},
title = {A pipelined architecture for {LMS} adaptive {FIR} filters without
adaptation delay},
booktitle = {1997 {IEEE} International Conference on Acoustics, Speech, and Signal
Processing, {ICASSP} '97, Munich, Germany, April 21-24, 1997},
pages = {1933--1936},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/ICASSP.1997.598920},
doi = {10.1109/ICASSP.1997.598920},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/ZhuDS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/Zhang96b,
author = {Cun{-}Quan Zhang},
title = {Nowhere-zero 4-flows and cycle double covers},
journal = {Discret. Math.},
volume = {154},
number = {1-3},
pages = {245--253},
year = {1996},
url = {https://doi.org/10.1016/0012-365X(95)00047-Z},
doi = {10.1016/0012-365X(95)00047-Z},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/Zhang96b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/NunnPM96,
author = {Douglas Nunn and
Alan Purvis and
Peter D. Manning},
title = {Acoustic Quanta},
booktitle = {Proceedings of the 1996 International Computer Music Conference, {ICMC}
1996, Hong Kong, August 19-24, 1996},
publisher = {Michigan Publishing},
year = {1996},
url = {https://hdl.handle.net/2027/spo.bbp2372.1996.014},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/NunnPM96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/VriesH95,
author = {Douwe K. de Vries and
Paul M. J. Van den Hof},
title = {Quantification of uncertainty in transfer function estimation: a mixed
probabilistic-worst-case approach},
journal = {Autom.},
volume = {31},
number = {4},
pages = {543--557},
year = {1995},
url = {https://doi.org/10.1016/0005-1098(95)98483-M},
doi = {10.1016/0005-1098(95)98483-M},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/automatica/VriesH95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/HsuP95,
author = {Ping{-}Yu Hsu and
Douglas Stott Parker Jr.},
editor = {Philip S. Yu and
Arbee L. P. Chen},
title = {Improving {SQL} with Generalized Quantifiers},
booktitle = {Proceedings of the Eleventh International Conference on Data Engineering,
March 6-10, 1995, Taipei, Taiwan},
pages = {298--305},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/ICDE.1995.380381},
doi = {10.1109/ICDE.1995.380381},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icde/HsuP95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/LaiYZ94,
author = {Hong{-}Jian Lai and
Xingxing Yu and
Cun{-}Quan Zhang},
title = {Small Circuit Double Covers of Cubic Multigraphs},
journal = {J. Comb. Theory {B}},
volume = {60},
number = {2},
pages = {177--194},
year = {1994},
url = {https://doi.org/10.1006/jctb.1994.1012},
doi = {10.1006/JCTB.1994.1012},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/LaiYZ94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/NamdarL94,
author = {Ardeshir Namdar and
Bosco H. Leung},
title = {Quantization Noise of 1-Bit Double-Loop Sigma-Delta Modulator},
booktitle = {1994 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
1994, London, England, UK, May 30 - June 2, 1994},
pages = {73--76},
publisher = {{IEEE}},
year = {1994},
url = {https://doi.org/10.1109/ISCAS.1994.409529},
doi = {10.1109/ISCAS.1994.409529},
timestamp = {Tue, 05 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/NamdarL94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cascon/PalacioBR93,
author = {Frances L. Palacio and
Douglas R. Bloch and
Carol Righi},
editor = {Ann Gawman and
Evelyn Kidd and
Per{-}{\AA}ke Larson},
title = {A comparison of interobserver agreement and quantity of usability
data obtained using graphics-based and text-based data collection
tools},
booktitle = {Proceedings of the 1993 Conference of the Centre for Advanced Studies
on Collaborative Research, October 24-28, 1993, Toronto, Ontario,
Canada, 2 Volumes},
pages = {1053--1058},
publisher = {{IBM}},
year = {1993},
url = {https://dl.acm.org/citation.cfm?id=962409},
timestamp = {Fri, 30 Nov 2018 02:24:54 +0100},
biburl = {https://dblp.org/rec/conf/cascon/PalacioBR93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/KalinowskiIH92,
author = {Douglas P. Kalinowski and
Sharon Illenye and
Ben Van Houten},
title = {Analysis of {DNA} damage and repair in murine leukemia {L1210} cells
using a quantitative polymerase chain reaction assay},
journal = {Nucleic Acids Res.},
volume = {20},
number = {13},
pages = {3485--3494},
year = {1992},
url = {https://doi.org/10.1093/nar/20.13.3485},
doi = {10.1093/NAR/20.13.3485},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/KalinowskiIH92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/BhattacharjyaBR92,
author = {Anoop K. Bhattacharjya and
Douglas E. Becker and
Badrinath Roysam},
title = {A genetic algorithm for intelligent imaging from quantum-limited data},
journal = {Signal Process.},
volume = {28},
number = {3},
pages = {335--348},
year = {1992},
url = {https://doi.org/10.1016/0165-1684(92)90047-Z},
doi = {10.1016/0165-1684(92)90047-Z},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/BhattacharjyaBR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/WillettW92,
author = {Peter Willett and
Douglas J. Warren},
title = {The suboptimality of randomized tests in distributed and quantized
detection systems},
journal = {{IEEE} Trans. Inf. Theory},
volume = {38},
number = {2},
pages = {355--361},
year = {1992},
url = {https://doi.org/10.1109/18.119692},
doi = {10.1109/18.119692},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tit/WillettW92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/KrishnamurthyAMC90,
author = {Ashok K. Krishnamurthy and
Stanley C. Ahalt and
Douglas E. Melton and
Prakoon Chen},
title = {Neural Networks for Vector Quantization of Speech and Images},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {8},
number = {8},
pages = {1449--1457},
year = {1990},
url = {https://doi.org/10.1109/49.62823},
doi = {10.1109/49.62823},
timestamp = {Tue, 13 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/KrishnamurthyAMC90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/AhaltKCM90,
author = {Stanley C. Ahalt and
Ashok K. Krishnamurthy and
Prakoon Chen and
Douglas E. Melton},
title = {Competitive learning algorithms for vector quantization},
journal = {Neural Networks},
volume = {3},
number = {3},
pages = {277--290},
year = {1990},
url = {https://doi.org/10.1016/0893-6080(90)90071-R},
doi = {10.1016/0893-6080(90)90071-R},
timestamp = {Tue, 13 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nn/AhaltKCM90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ReadCCF89,
author = {Christopher J. Read and
Douglas M. Chabries and
Richard W. Christiansen and
J. Kelly Flanagan},
title = {A method for computing the {DFT} of vector quantized data},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '89, Glasgow, Scotland, May 23-26, 1989},
pages = {1015--1018},
publisher = {{IEEE}},
year = {1989},
url = {https://doi.org/10.1109/ICASSP.1989.266603},
doi = {10.1109/ICASSP.1989.266603},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/icassp/ReadCCF89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stoc/Ierardi89,
author = {Doug Ierardi},
editor = {David S. Johnson},
title = {Quantifier Elimination in the Theory of an Algebraically-closed Field},
booktitle = {Proceedings of the 21st Annual {ACM} Symposium on Theory of Computing,
May 14-17, 1989, Seattle, Washington, {USA}},
pages = {138--147},
publisher = {{ACM}},
year = {1989},
url = {https://doi.org/10.1145/73007.73020},
doi = {10.1145/73007.73020},
timestamp = {Wed, 24 Nov 2021 12:15:31 +0100},
biburl = {https://dblp.org/rec/conf/stoc/Ierardi89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/annals/Medwick88,
author = {Paul A. Medwick},
title = {Douglas Hartree and Early Computations in Quantum Mechanics},
journal = {{IEEE} Ann. Hist. Comput.},
volume = {10},
number = {2},
pages = {105--111},
year = {1988},
url = {https://doi.org/10.1109/MAHC.1988.10014},
doi = {10.1109/MAHC.1988.10014},
timestamp = {Fri, 07 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/annals/Medwick88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsc/DavenportH88,
author = {James H. Davenport and
Joos Heintz},
title = {Real Quantifier Elimination is Doubly Exponential},
journal = {J. Symb. Comput.},
volume = {5},
number = {1/2},
pages = {29--35},
year = {1988},
url = {https://doi.org/10.1016/S0747-7171(88)80004-X},
doi = {10.1016/S0747-7171(88)80004-X},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsc/DavenportH88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Moran88,
author = {Douglas B. Moran},
editor = {Jerry R. Hobbs},
title = {Quantifier Scoping in the {SRI} Core Language Engine},
booktitle = {26th Annual Meeting of the Association for Computational Linguistics,
7-10 June 1988, State Univerity of New York at Buffalo, Buffalo, New
York, USA, Proceedings},
pages = {33--40},
publisher = {{ACL}},
year = {1988},
url = {https://aclanthology.org/P88-1005/},
doi = {10.3115/982023.982028},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Moran88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/BudgeSCC88,
author = {Scott E. Budge and
Thomas G. Stockham Jr. and
Douglas M. Chabries and
Richard W. Christiansen},
title = {Vector quantization of color digital images within a human visual
model},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '88, New York, New York, USA, April 11-14, 1988},
pages = {816--819},
publisher = {{IEEE}},
year = {1988},
url = {https://doi.org/10.1109/ICASSP.1988.196710},
doi = {10.1109/ICASSP.1988.196710},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/icassp/BudgeSCC88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/OShaughnessy88,
author = {Douglas D. O'Shaughnessy},
title = {Speech enhancement using vector quantization and a formant distance
measure},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '88, New York, New York, USA, April 11-14, 1988},
pages = {549--552},
publisher = {{IEEE}},
year = {1988},
url = {https://doi.org/10.1109/ICASSP.1988.196642},
doi = {10.1109/ICASSP.1988.196642},
timestamp = {Thu, 12 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/OShaughnessy88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsyml/Hoover87,
author = {Douglas N. Hoover},
title = {An Analytic Completeness Theorem for Logics with Probability Quantifiers},
journal = {J. Symb. Log.},
volume = {52},
number = {3},
pages = {802--816},
year = {1987},
url = {https://doi.org/10.1017/S0022481200029789},
doi = {10.1017/S0022481200029789},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsyml/Hoover87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigact/Wiedemann86,
author = {Douglas H. Wiedemann},
title = {Quantum cryptography},
journal = {{SIGACT} News},
volume = {18},
number = {2},
pages = {48--51},
year = {1986},
url = {https://doi.org/10.1145/24652.24654},
doi = {10.1145/24652.24654},
timestamp = {Wed, 28 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigact/Wiedemann86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/SherwoodB86,
author = {Douglas T. Sherwood and
Neil J. Bershad},
title = {Nonlinear quantization effects in the frequency domain complex scalar
{LMS} adaptive algorithm},
journal = {{IEEE} Trans. Acoust. Speech Signal Process.},
volume = {34},
number = {1},
pages = {140--151},
year = {1986},
url = {https://doi.org/10.1109/TASSP.1986.1164795},
doi = {10.1109/TASSP.1986.1164795},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsp/SherwoodB86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-11-09 02:16 CET from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
