default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Ritesh Raj"
download as .bib file
@article{DBLP:journals/access/MauryaMR24,
author = {Ritesh Maurya and
Satyajit Mahapatra and
Lucky Rajput},
title = {A Lightweight Meta-Ensemble Approach for Plant Disease Detection Suitable
for IoT-Based Environments},
journal = {{IEEE} Access},
volume = {12},
pages = {28096--28108},
year = {2024},
url = {https://doi.org/10.1109/ACCESS.2024.3367443},
doi = {10.1109/ACCESS.2024.3367443},
timestamp = {Sat, 16 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/MauryaMR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/KumarPC24,
author = {Ritesh Kumar and
Rajesh Panwar and
Vijay Kumar Chaurasiya},
title = {Urban traffic forecasting using attention based model with {GCN} and
{GRU}},
journal = {Multim. Tools Appl.},
volume = {83},
number = {16},
pages = {47751--47774},
year = {2024},
url = {https://doi.org/10.1007/s11042-023-17248-y},
doi = {10.1007/S11042-023-17248-Y},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/KumarPC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/RajLS24,
author = {Ritesh Raj and
Narendra D. Londhe and
Rajendra S. Sonawane},
title = {Objective scoring of psoriasis area and severity index in 2D {RGB}
images using deep learning},
journal = {Multim. Tools Appl.},
volume = {83},
number = {26},
pages = {68253--68279},
year = {2024},
url = {https://doi.org/10.1007/s11042-024-18138-7},
doi = {10.1007/S11042-024-18138-7},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/RajLS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/RajLS23,
author = {Ritesh Raj and
Narendra D. Londhe and
Rajendra S. Sonawane},
title = {PsLSNetV2: End to end deep learning system for measurement of area
score of psoriasis regions in color images},
journal = {Biomed. Signal Process. Control.},
volume = {79},
number = {Part},
pages = {104138},
year = {2023},
url = {https://doi.org/10.1016/j.bspc.2022.104138},
doi = {10.1016/J.BSPC.2022.104138},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bspc/RajLS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecoi/RNSARMR23,
author = {Mani Murali R. and
Reshma K. N. and
Santhosh Kumar S. and
Ritesh Agrawal and
Ratheesh Ramakrishnan and
Sreejith K. M. and
A. S. Rajawat},
title = {Land subsidence studies in the Godavari Delta regions of the East
coast of India using {ALOS} and Sentinel 1 data},
journal = {Ecol. Informatics},
volume = {78},
pages = {102373},
year = {2023},
url = {https://doi.org/10.1016/j.ecoinf.2023.102373},
doi = {10.1016/J.ECOINF.2023.102373},
timestamp = {Mon, 01 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ecoi/RNSARMR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/saem/SharmaKS23a,
author = {Ritesh Sharma and
Sanjeev Kumar and
Rajeev Saha},
title = {Enhancing surface quality of {SLM} produced AlSi10Mg components through
chemical polishing},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {14},
number = {5},
pages = {1955--1960},
year = {2023},
url = {https://doi.org/10.1007/s13198-023-02038-4},
doi = {10.1007/S13198-023-02038-4},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/saem/SharmaKS23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/MauryaKAJ23,
author = {Arvind Kumar Maurya and
Ritesh Kumar and
Venugopal Arumuru and
Rajan Jha},
title = {An All-Optical System for Transit Time Estimation in Fluids Using
Single Source and Detector},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {72},
pages = {1--8},
year = {2023},
url = {https://doi.org/10.1109/TIM.2023.3301072},
doi = {10.1109/TIM.2023.3301072},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/MauryaKAJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/CaoGWRB23,
author = {Shu{-}Jie Cao and
Ritesh Goenka and
Chau{-}Wai Wong and
Ajit Rajwade and
Dror Baron},
title = {Group Testing With Side Information via Generalized Approximate Message
Passing},
journal = {{IEEE} Trans. Signal Process.},
volume = {71},
pages = {2366--2375},
year = {2023},
url = {https://doi.org/10.1109/TSP.2023.3287671},
doi = {10.1109/TSP.2023.3287671},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsp/CaoGWRB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/SharmaSSKSS22,
author = {Ritesh Sharma and
Sameer Shrivastava and
Sanjay Kumar Singh and
Abhinav Kumar and
Sonal Saxena and
Raj Kumar Singh},
title = {Deep-AFPpred: identifying novel antifungal peptides using pretrained
embeddings from seq2vec with 1DCNN-BiLSTM},
journal = {Briefings Bioinform.},
volume = {23},
number = {1},
year = {2022},
url = {https://doi.org/10.1093/bib/bbab422},
doi = {10.1093/BIB/BBAB422},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/SharmaSSKSS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ic3i/RajanVHKRM22,
author = {S. Dheva Rajan and
Sivajee Vavilapalli and
Shahriar Hasan and
Ritesh Kumar and
Nafisa Rafa and
Iskandar Muda},
title = {A Survey on the Impact of Data Analytics and Machine Learning Techniques
in E-commerce},
booktitle = {5th International Conference on Contemporary Computing and Informatics,
{IC3I} 2022, Uttar Pradesh, India, December 14-16, 2022},
pages = {1117--1122},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IC3I56241.2022.10072652},
doi = {10.1109/IC3I56241.2022.10072652},
timestamp = {Sat, 25 Mar 2023 16:32:21 +0100},
biburl = {https://dblp.org/rec/conf/ic3i/RajanVHKRM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/BatsurenGKHKBLN22,
author = {Khuyagbaatar Batsuren and
Omer Goldman and
Salam Khalifa and
Nizar Habash and
Witold Kieras and
G{\'{a}}bor Bella and
Brian Leonard and
Garrett Nicolai and
Kyle Gorman and
Yustinus Ghanggo Ate and
Maria Ryskina and
Sabrina J. Mielke and
Elena Budianskaya and
Charbel El{-}Khaissi and
Tiago Pimentel and
Michael Gasser and
William Abbott Lane and
Mohit Raj and
Matt Coler and
Jaime Rafael Montoya Samame and
Delio Siticonatzi Camaiteri and
Esa{\'{u}} Zumaeta Rojas and
Didier L{\'{o}}pez Francis and
Arturo Oncevay and
Juan L{\'{o}}pez Bautista and
Gema Celeste Silva Villegas and
Lucas Torroba Hennigen and
Adam Ek and
David Guriel and
Peter Dirix and
Jean{-}Philippe Bernardy and
Andrey Scherbakov and
Aziyana Bayyr{-}ool and
Antonios Anastasopoulos and
Roberto Zariquiey and
Karina Sheifer and
Sofya Ganieva and
Hilaria Cruz and
Ritv{\'{a}}n Karah{\'{o}}ga and
Stella Markantonatou and
George Pavlidis and
Matvey Plugaryov and
Elena Klyachko and
Ali Salehi and
Candy Angulo and
Jatayu Baxi and
Andrew Krizhanovsky and
Natalia Krizhanovskaya and
Elizabeth Salesky and
Clara Vania and
Sardana Ivanova and
Jennifer C. White and
Rowan Hall Maudslay and
Josef Valvoda and
Ran Zmigrod and
Paula Czarnowska and
Irene Nikkarinen and
Aelita Salchak and
Brijesh Bhatt and
Christopher Straughn and
Zoey Liu and
Jonathan North Washington and
Yuval Pinter and
Duygu Ataman and
Marcin Wolinski and
Totok Suhardijanto and
Anna Yablonskaya and
Niklas Stoehr and
Hossep Dolatian and
Zahroh Nuriah and
Shyam Ratan and
Francis M. Tyers and
Edoardo M. Ponti and
Grant Aiton and
Aryaman Arora and
Richard J. Hatcher and
Ritesh Kumar and
Jeremiah Young and
Daria Rodionova and
Anastasia Yemelina and
Taras Andrushko and
Igor Marchenko and
Polina Mashkovtseva and
Alexandra Serova and
Emily Prud'hommeaux and
Maria Nepomniashchaya and
Fausto Giunchiglia and
Eleanor Chodroff and
Mans Hulden and
Miikka Silfverberg and
Arya D. McCarthy and
David Yarowsky and
Ryan Cotterell and
Reut Tsarfaty and
Ekaterina Vylomova},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Jan Odijk and
Stelios Piperidis},
title = {UniMorph 4.0: Universal Morphology},
booktitle = {Proceedings of the Thirteenth Language Resources and Evaluation Conference,
{LREC} 2022, Marseille, France, 20-25 June 2022},
pages = {840--855},
publisher = {European Language Resources Association},
year = {2022},
url = {https://aclanthology.org/2022.lrec-1.89},
timestamp = {Wed, 12 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/BatsurenGKHKBLN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ltedi/GuptaKP22,
author = {Vishesh Gupta and
Ritesh Kumar and
Rajendra Pamula},
editor = {Bharathi Raja Chakravarthi and
B. Bharathi and
John P. McCrae and
Manel Zarrouk and
Kalika Bali and
Paul Buitelaar},
title = {{IIT} Dhanbad @LT-EDI-ACL2022- Hope Speech Detection for Equality,
Diversity, and Inclusion},
booktitle = {Proceedings of the Second Workshop on Language Technology for Equality,
Diversity and Inclusion, {LT-EDI} 2022, Dublin, Ireland, May 27, 2022},
pages = {229--233},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.ltedi-1.32},
doi = {10.18653/V1/2022.LTEDI-1.32},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ltedi/GuptaKP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semeval/BarnwalKP22,
author = {Shubham Barnwal and
Ritesh Kumar and
Rajendra Pamula},
editor = {Guy Emerson and
Natalie Schluter and
Gabriel Stanovsky and
Ritesh Kumar and
Alexis Palmer and
Nathan Schneider and
Siddharth Singh and
Shyam Ratan},
title = {{IIT} {DHANBAD} {CODECHAMPS} at SemEval-2022 Task 5: {MAMI} - Multimedia
Automatic Misogyny Identification},
booktitle = {Proceedings of the 16th International Workshop on Semantic Evaluation,
SemEval@NAACL 2022, Seattle, Washington, United States, July 14-15,
2022},
pages = {733--735},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.semeval-1.101},
doi = {10.18653/V1/2022.SEMEVAL-1.101},
timestamp = {Mon, 01 Aug 2022 17:09:21 +0200},
biburl = {https://dblp.org/rec/conf/semeval/BarnwalKP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-12633,
author = {Mohit Raj and
Shyam Ratan and
Deepak Alok and
Ritesh Kumar and
Atul Kr. Ojha},
title = {Developing Universal Dependency Treebanks for Magahi and Braj},
journal = {CoRR},
volume = {abs/2204.12633},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.12633},
doi = {10.48550/ARXIV.2204.12633},
eprinttype = {arXiv},
eprint = {2204.12633},
timestamp = {Thu, 28 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-12633.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-03608,
author = {Khuyagbaatar Batsuren and
Omer Goldman and
Salam Khalifa and
Nizar Habash and
Witold Kieras and
G{\'{a}}bor Bella and
Brian Leonard and
Garrett Nicolai and
Kyle Gorman and
Yustinus Ghanggo Ate and
Maria Ryskina and
Sabrina J. Mielke and
Elena Budianskaya and
Charbel El{-}Khaissi and
Tiago Pimentel and
Michael Gasser and
William Lane and
Mohit Raj and
Matt Coler and
Jaime Rafael Montoya Samame and
Delio Siticonatzi Camaiteri and
Esa{\'{u}} Zumaeta Rojas and
Didier L{\'{o}}pez Francis and
Arturo Oncevay and
Juan L{\'{o}}pez Bautista and
Gema Celeste Silva Villegas and
Lucas Torroba Hennigen and
Adam Ek and
David Guriel and
Peter Dirix and
Jean{-}Philippe Bernardy and
Andrey Scherbakov and
Aziyana Bayyr{-}ool and
Antonios Anastasopoulos and
Roberto Zariquiey and
Karina Sheifer and
Sofya Ganieva and
Hilaria Cruz and
Ritv{\'{a}}n Karah{\'{o}}ga and
Stella Markantonatou and
George Pavlidis and
Matvey Plugaryov and
Elena Klyachko and
Ali Salehi and
Candy Angulo and
Jatayu Baxi and
Andrew Krizhanovsky and
Natalia Krizhanovskaya and
Elizabeth Salesky and
Clara Vania and
Sardana Ivanova and
Jennifer C. White and
Rowan Hall Maudslay and
Josef Valvoda and
Ran Zmigrod and
Paula Czarnowska and
Irene Nikkarinen and
Aelita Salchak and
Brijesh Bhatt and
Christopher Straughn and
Zoey Liu and
Jonathan North Washington and
Yuval Pinter and
Duygu Ataman and
Marcin Wolinski and
Totok Suhardijanto and
Anna Yablonskaya and
Niklas Stoehr and
Hossep Dolatian and
Zahroh Nuriah and
Shyam Ratan and
Francis M. Tyers and
Edoardo M. Ponti and
Grant Aiton and
Aryaman Arora and
Richard J. Hatcher and
Ritesh Kumar and
Jeremiah Young and
Daria Rodionova and
Anastasia Yemelina and
Taras Andrushko and
Igor Marchenko and
Polina Mashkovtseva and
Alexandra Serova and
Emily Prud'hommeaux and
Maria Nepomniashchaya and
Fausto Giunchiglia and
Eleanor Chodroff and
Mans Hulden and
Miikka Silfverberg and
Arya D. McCarthy and
David Yarowsky and
Ryan Cotterell and
Reut Tsarfaty and
Ekaterina Vylomova},
title = {UniMorph 4.0: Universal Morphology},
journal = {CoRR},
volume = {abs/2205.03608},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.03608},
doi = {10.48550/ARXIV.2205.03608},
eprinttype = {arXiv},
eprint = {2205.03608},
timestamp = {Wed, 12 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-03608.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-12931,
author = {Ritesh Kumar and
Siddharth Singh and
Shyam Ratan and
Mohit Raj and
Sonal Sinha and
Bornini Lahiri and
Vivek Seshadri and
Kalika Bali and
Atul Kr. Ojha},
title = {Annotated Speech Corpus for Low Resource Indian Languages: Awadhi,
Bhojpuri, Braj and Magahi},
journal = {CoRR},
volume = {abs/2206.12931},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.12931},
doi = {10.48550/ARXIV.2206.12931},
eprinttype = {arXiv},
eprint = {2206.12931},
timestamp = {Thu, 25 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-12931.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-03731,
author = {Shu{-}Jie Cao and
Ritesh Goenka and
Chau{-}Wai Wong and
Ajit Rajwade and
Dror Baron},
title = {Group Testing with Side Information via Generalized Approximate Message
Passing},
journal = {CoRR},
volume = {abs/2211.03731},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.03731},
doi = {10.48550/ARXIV.2211.03731},
eprinttype = {arXiv},
eprint = {2211.03731},
timestamp = {Thu, 10 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-03731.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/SharmaSS0SS21,
author = {Ritesh Sharma and
Sameer Shrivastava and
Sanjay Kumar Singh and
Abhinav Kumar and
Sonal Saxena and
Raj Kumar Singh},
title = {AniAMPpred: artificial intelligence guided discovery of novel antimicrobial
peptides in animal kingdom},
journal = {Briefings Bioinform.},
volume = {22},
number = {6},
year = {2021},
url = {https://doi.org/10.1093/bib/bbab242},
doi = {10.1093/BIB/BBAB242},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/SharmaSS0SS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/SharmaSSKSS21,
author = {Ritesh Sharma and
Sameer Shrivastava and
Sanjay Kumar Singh and
Abhinav Kumar and
Sonal Saxena and
Raj Kumar Singh},
title = {Deep-ABPpred: identifying antibacterial peptides in protein sequences
using bidirectional {LSTM} with word2vec},
journal = {Briefings Bioinform.},
volume = {22},
number = {5},
year = {2021},
url = {https://doi.org/10.1093/bib/bbab065},
doi = {10.1093/BIB/BBAB065},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/SharmaSSKSS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/RajLS21,
author = {Ritesh Raj and
Narendra D. Londhe and
Rajendra S. Sonawane},
title = {Automated psoriasis lesion segmentation from unconstrained environment
using residual U-Net with transfer learning},
journal = {Comput. Methods Programs Biomed.},
volume = {206},
pages = {106123},
year = {2021},
url = {https://doi.org/10.1016/j.cmpb.2021.106123},
doi = {10.1016/J.CMPB.2021.106123},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/RajLS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/NicholsAAAAAAAA21,
author = {Emma Nichols and
Foad Abd{-}Allah and
Amir Abdoli and
Ahmed Abualhasan and
Eman Abu{-}Gharbieh and
Ashkan Afshin and
Rufus Akinyemi and
Fahad Mashhour Alanezi and
Vahid Alipour and
Amir Almasi{-}Hashiani and
Jalal Arabloo and
Amir Ashraf{-}Ganjouei and
Getinet Ayano and
Jos{\'{e}} Luis Ayuso{-}Mateos and
Atif Amin Baig and
Maciej Banach and
Miguel A. Barboza and
Suzanne Lyn Barker{-}Collo and
Bernhard T. Baune and
Akshaya Srikanth Bhagavathula and
Krittika Bhattacharyya and
Ali Bijani and
Atanu Biswas and
Archith Boloor and
Carol Brayne and
Hermann Brenner and
Katrin Burkart and
Sharath Burugina Nagaraja and
Felix Carvalho and
Luis F. S. Castro{-}de{-}Araujo and
Ferr{\'{a}}n Catal{\'{a}}{-}L{\'{o}}pez and
Ester Cerin and
Nicolas Cherbuin and
Dinh{-}Toi Chu and
Xiaochen Dai and
Antonio Reis de S{\'{a}}{-}Junior and
Shirin Djalalinia and
Abdel Douiri and
David Edvardsson and
Shaimaa I. El{-}Jaafary and
Sharareh Eskandarieh and
Andre Faro and
Farshad Farzadfar and
Valery Feigin and
Seyed{-}Mohammad Fereshtehnejad and
Eduarda Fernandes and
Pietro Ferrara and
Irina Filip and
Florian Fischer and
Shilpa Gaidhane and
Lucia Galluzzo and
Gebreamlak Gebremedhn Gebremeskel and
Ahmad Ghashghaee and
Alessandro Gialluisi and
Elena V. Gnedovskaya and
Mahaveer Golechha and
Rajeev Gupta and
Vladimir Hachinski and
Mohammad R. Haider and
Teklehaimanot Gereziher Haile and
Mohammad Hamiduzzaman and
Graeme J. Hankey and
Simon I. Hay and
Golnaz Heidari and
Reza Heidari{-}Soureshjani and
Hung Chak Ho and
Mowafa S. Househ and
Bing{-}Fang Hwang and
Licia Iacoviello and
Olayinka Stephen Ilesanmi and
Irena M. Ilic and
Milena D. Ilic and
Seyed Sina Naghibi Irvani and
Masao Iwagami and
Ihoghosa Osamuyi Iyamu and
Ravi Prakash Jha and
Rizwan Kalani and
Andr{\'{e}} Karch and
Ayele Semachew Kasa and
Yousef S. Khader and
Ejaz Ahmad Khan and
Mahalaqua Nazli Khatib and
Yun Jin Kim and
Sezer Kisa and
Adnan Kisa and
Mika Kivim{\"{a}}ki and
Ai Koyanagi and
Manasi Kumar and
Iv{\'{a}}n Landires and
Savita Lasrado and
Bingyu Li and
Stephen S. Lim and
Xuefeng Liu and
Shilpashree Madhava Kunjathur and
Azeem Majeed and
Preeti Malik and
Man Mohan Mehndiratta and
Ritesh G. Menezes and
Yousef Mohammad and
Salahuddin Mohammed and
Ali H. Mokdad and
Mohammad Ali Moni and
Gabriele Nagel and
Muhammad Naveed and
Vinod C. Nayak and
Cuong Tat Nguyen and
Thi Lan Huong Nguyen and
Virginia Nunez{-}Samudio and
Andrew T. Olagunju and
Samuel M. Ostroff and
Nikita Otstavnov and
Mayowa Owolabi and
Fatemeh Pashazadeh Kan and
Urvish K. Patel and
Michael R. Phillips and
Michael A. Piradov and
Constance Dimity Pond and
Faheem Hyder Pottoo and
Sergio I. Prada and
Amir Radfar and
Fakher Rahim and
Juwel Rana and
Vahid Rashedi and
Salman Rawaf and
David Laith Rawaf and
Nickolas Reinig and
Andre M. N. Renzaho and
Nima Rezaei and
Aziz Rezapour and
Michele Romoli and
Gholamreza Roshandel and
Perminder S. Sachdev and
Amirhossein Sahebkar and
Mohammad Ali Sahraian and
Mehrnoosh Samaei and
Mete Saylan and
Feng Sha and
Masood Ali Shaikh and
Kenji Shibuya and
Mika Shigematsu and
Jae Il Shin and
Rahman Shiri and
Diego Augusto Santos Silva and
Jasvinder A. Singh and
Deepika Singhal and
Valentin Yurievich Skryabin and
Anna Aleksandrovna Skryabina and
Amin Soheili and
Houman Sotoudeh and
Emma Elizabeth Spurlock and
Cassandra E. I. Szoeke and
Rafael Tabar{\'{e}}s{-}Seisdedos and
Biruk Wogayehu Taddele and
Marcos Roberto Tovani{-}Palone and
Gebiyaw Wudie Tsegaye and
Marco Vacante and
Narayanaswamy Venketasubramanian and
Simone Vidale and
Vasily Vlassov and
Giang Thu Vu and
Yuan{-}Pang Wang and
Jordan Weiss and
Abrha Hailay Weldemariam and
Ronny Westerman and
Anders Wimo and
Andrea Sylvia Winkler and
Chenkai Wu and
Ali Yadollahpour and
Metin Yesiltepe and
Naohiro Yonemoto and
Chuanhua Yu and
Mikhail Sergeevich Zastrozhin and
Anasthasia Zastrozhina and
Zhi{-}Jiang Zhang and
Christopher J. L. Murray and
Theo Vos},
title = {Use of multidimensional item response theory methods for dementia
prevalence prediction: an example using the Health and Retirement
Survey and the Aging, Demographics, and Memory Study},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {21},
number = {1},
pages = {241},
year = {2021},
url = {https://doi.org/10.1186/s12911-021-01590-y},
doi = {10.1186/S12911-021-01590-Y},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/midm/NicholsAAAAAAAA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/suscom/GoelYVR21,
author = {Rajkumar Goel and
Chandra Shekhar Yadav and
Shweta Vishnoi and
Ritesh Rastogi},
title = {Smart agriculture - Urgent need of the day in developing countries},
journal = {Sustain. Comput. Informatics Syst.},
volume = {30},
pages = {100512},
year = {2021},
url = {https://doi.org/10.1016/j.suscom.2021.100512},
doi = {10.1016/J.SUSCOM.2021.100512},
timestamp = {Fri, 08 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/suscom/GoelYVR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fire/KumarGP21,
author = {Ritesh Kumar and
Vishesh Gupta and
Rajendra Pamula},
editor = {Parth Mehta and
Thomas Mandl and
Prasenjit Majumder and
Mandar Mitra},
title = {Hate Speech and Offensive Content Identification in English Tweets},
booktitle = {Working Notes of {FIRE} 2021 - Forum for Information Retrieval Evaluation,
Gandhinagar, India, December 13-17, 2021},
series = {{CEUR} Workshop Proceedings},
volume = {3159},
pages = {104--109},
publisher = {CEUR-WS.org},
year = {2021},
url = {https://ceur-ws.org/Vol-3159/T1-10.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:30 +0100},
biburl = {https://dblp.org/rec/conf/fire/KumarGP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/GoenkaCWRB21,
author = {Ritesh Goenka and
Shu{-}Jie Cao and
Chau{-}Wai Wong and
Ajit Rajwade and
Dror Baron},
title = {Contact Tracing Enhances the Efficiency of Covid-19 Group Testing},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2021, Toronto, ON, Canada, June 6-11, 2021},
pages = {8168--8172},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICASSP39728.2021.9414034},
doi = {10.1109/ICASSP39728.2021.9414034},
timestamp = {Sat, 26 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/GoenkaCWRB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sepln/KumarPP21,
author = {Ritesh Kumar and
Soumya Pal and
Rajendra Pamula},
editor = {Manuel Montes and
Paolo Rosso and
Julio Gonzalo and
Mario Ezra Arag{\'{o}}n and
Rodrigo Agerri and
Miguel {\'{A}}ngel {\'{A}}lvarez{-}Carmona and
Elena {\'{A}}lvarez Mellado and
Jorge Carrillo{-}de{-}Albornoz and
Luis Chiruzzo and
Larissa A. de Freitas and
Helena G{\'{o}}mez{-}Adorno and
Yoan Guti{\'{e}}rrez and
Salud Mar{\'{\i}}a Jim{\'{e}}nez{-}Zafra and
Salvador Lima and
Flor Miriam Plaza del Arco and
Mariona Taul{\'{e}}},
title = {Sexism Detection in English and Spanish Tweets},
booktitle = {Proceedings of the Iberian Languages Evaluation Forum (IberLEF 2021)
co-located with the Conference of the Spanish Society for Natural
Language Processing {(SEPLN} 2021), {XXXVII} International Conference
of the Spanish Society for Natural Language Processing., M{\'{a}}laga,
Spain, September, 2021},
series = {{CEUR} Workshop Proceedings},
volume = {2943},
pages = {500--505},
publisher = {CEUR-WS.org},
year = {2021},
url = {https://ceur-ws.org/Vol-2943/exist\_paper17.pdf},
timestamp = {Mon, 05 Aug 2024 13:24:56 +0200},
biburl = {https://dblp.org/rec/conf/sepln/KumarPP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-02699,
author = {Ritesh Goenka and
Shu{-}Jie Cao and
Chau{-}Wai Wong and
Ajit Rajwade and
Dror Baron},
title = {Contact Tracing Information Improves the Performance of Group Testing
Algorithms},
journal = {CoRR},
volume = {abs/2106.02699},
year = {2021},
url = {https://arxiv.org/abs/2106.02699},
eprinttype = {arXiv},
eprint = {2106.02699},
timestamp = {Sat, 26 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-02699.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/air/KumarP20,
author = {Ritesh Kumar and
Rajendra Pamula},
title = {Social Book Search: a survey},
journal = {Artif. Intell. Rev.},
volume = {53},
number = {1},
pages = {95--139},
year = {2020},
url = {https://doi.org/10.1007/s10462-018-9647-x},
doi = {10.1007/S10462-018-9647-X},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/air/KumarP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/DashLGRS20,
author = {Manoranjan Dash and
Narendra D. Londhe and
Subhojit Ghosh and
Ritesh Raj and
Rajendra S. Sonawane},
title = {A cascaded deep convolution neural network based CADx system for psoriasis
lesion segmentation and severity assessment},
journal = {Appl. Soft Comput.},
volume = {91},
pages = {106240},
year = {2020},
url = {https://doi.org/10.1016/j.asoc.2020.106240},
doi = {10.1016/J.ASOC.2020.106240},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/asc/DashLGRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/KumarJM20,
author = {Raj Kumar and
Ritesh Kumar Jaiswal and
Ram Awadh Mishra},
title = {Perspective and Opportunities of Modulo 2n-1 Multipliers in Residue
Number System: {A} Review},
journal = {J. Circuits Syst. Comput.},
volume = {29},
number = {11},
pages = {2030008:1--2030008:24},
year = {2020},
url = {https://doi.org/10.1142/S0218126620300081},
doi = {10.1142/S0218126620300081},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcsc/KumarJM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/SinhaKKM20,
author = {Abhinav Sinha and
Ritesh Kumar and
Rishemjit Kaur and
Rajiv Kumar Mishra},
title = {Consensus-Based Odor Source Localization by Multiagent Systems Under
Resource Constraints},
journal = {{IEEE} Trans. Cybern.},
volume = {50},
number = {7},
pages = {3254--3263},
year = {2020},
url = {https://doi.org/10.1109/TCYB.2019.2924328},
doi = {10.1109/TCYB.2019.2924328},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcyb/SinhaKKM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibm/RajLS20,
author = {Ritesh Raj and
Narendra D. Londhe and
Rajendra S. Sonawane},
editor = {Taesung Park and
Young{-}Rae Cho and
Xiaohua Hu and
Illhoi Yoo and
Hyun Goo Woo and
Jianxin Wang and
Julio C. Facelli and
Seungyoon Nam and
Mingon Kang},
title = {Automatic Psoriasis Lesion Segmentation from Raw Color Images using
Deep Learning},
booktitle = {{IEEE} International Conference on Bioinformatics and Biomedicine,
{BIBM} 2020, Virtual Event, South Korea, December 16-19, 2020},
pages = {723--728},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/BIBM49941.2020.9313356},
doi = {10.1109/BIBM49941.2020.9313356},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibm/RajLS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wmt/OjhaRBCKM20,
author = {Atul Kr. Ojha and
Priya Rani and
Akanksha Bansal and
Bharathi Raja Chakravarthi and
Ritesh Kumar and
John P. McCrae},
editor = {Lo{\"{\i}}c Barrault and
Ondrej Bojar and
Fethi Bougares and
Rajen Chatterjee and
Marta R. Costa{-}juss{\`{a}} and
Christian Federmann and
Mark Fishel and
Alexander Fraser and
Yvette Graham and
Paco Guzman and
Barry Haddow and
Matthias Huck and
Antonio Jimeno{-}Yepes and
Philipp Koehn and
Andr{\'{e}} Martins and
Makoto Morishita and
Christof Monz and
Masaaki Nagata and
Toshiaki Nakazawa and
Matteo Negri},
title = {NUIG-Panlingua-KMI Hindi-Marathi {MT} Systems for Similar Language
Translation Task @ {WMT} 2020},
booktitle = {Proceedings of the Fifth Conference on Machine Translation, WMT@EMNLP
2020, Online, November 19-20, 2020},
pages = {418--423},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://aclanthology.org/2020.wmt-1.49/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wmt/OjhaRBCKM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/apin/KumarGP19,
author = {Ritesh Kumar and
Bhanodai Guggilla and
Rajendra Pamula},
title = {Book search using social information, user profiles and query expansion
with Pseudo Relevance Feedback},
journal = {Appl. Intell.},
volume = {49},
number = {6},
pages = {2178--2200},
year = {2019},
url = {https://doi.org/10.1007/s10489-018-1383-z},
doi = {10.1007/S10489-018-1383-Z},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/apin/KumarGP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/VarnaiGGPS19,
author = {Tam{\'{a}}s V{\'{a}}rnai and
Charles K. Gatebe and
Ritesh Gautam and
Rajesh Poudyal and
Wenying Su},
title = {Developing an Aircraft-Based Angular Distribution Model of Solar Reflection
from Wildfire Smoke to Aid Satellite-Based Radiative Flux Estimation},
journal = {Remote. Sens.},
volume = {11},
number = {13},
pages = {1509},
year = {2019},
url = {https://doi.org/10.3390/rs11131509},
doi = {10.3390/RS11131509},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/VarnaiGGPS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/KumarPKP19,
author = {Ritesh Kumar and
Shivansh Prakash and
Shashank Kumar and
Rajendra Pamula},
editor = {Linda Cappellato and
Nicola Ferro and
David E. Losada and
Henning M{\"{u}}ller},
title = {Check That! Automatic Identification and Verification of Claims: {IIT(ISM)}
@CLEF'19 Check Worthiness},
booktitle = {Working Notes of {CLEF} 2019 - Conference and Labs of the Evaluation
Forum, Lugano, Switzerland, September 9-12, 2019},
series = {{CEUR} Workshop Proceedings},
volume = {2380},
publisher = {CEUR-WS.org},
year = {2019},
url = {https://ceur-ws.org/Vol-2380/paper\_232.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:41 +0100},
biburl = {https://dblp.org/rec/conf/clef/KumarPKP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semeval/KumarGPC19,
author = {Ritesh Kumar and
Bhanodai Guggilla and
Rajendra Pamula and
Maheshwar Reddy Chennuru},
editor = {Jonathan May and
Ekaterina Shutova and
Aur{\'{e}}lie Herbelot and
Xiaodan Zhu and
Marianna Apidianaki and
Saif M. Mohammad},
title = {bhanodaig at SemEval-2019 Task 6: Categorizing Offensive Language
in social media},
booktitle = {Proceedings of the 13th International Workshop on Semantic Evaluation,
SemEval@NAACL-HLT 2019, Minneapolis, MN, USA, June 6-7, 2019},
pages = {547--550},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/s19-2098},
doi = {10.18653/V1/S19-2098},
timestamp = {Mon, 18 Dec 2023 11:22:01 +0100},
biburl = {https://dblp.org/rec/conf/semeval/KumarGPC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/JaiswalKM18,
author = {Ritesh Kumar Jaiswal and
Raj Kumar and
Ram Awadh Mishra},
title = {Area Efficient Memoryless Reverse Converter for New Four Moduli Set
\{2n-1, 2n-1, 2n+1, 22n+1-1\}},
journal = {J. Circuits Syst. Comput.},
volume = {27},
number = {5},
pages = {1850075:1--1850075:13},
year = {2018},
url = {https://doi.org/10.1142/S0218126618500755},
doi = {10.1142/S0218126618500755},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcsc/JaiswalKM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/KumarGPC18,
author = {Ritesh Kumar and
Bhanodai Guggilla and
Rajendra Pamula and
Maheshwar Reddy Chennuru},
editor = {Ritesh Kumar and
Atul Kr. Ojha and
Marcos Zampieri and
Shervin Malmasi},
title = {{TRAC-1} Shared Task on Aggression Identification: IIT(ISM){\textdollar}@{\textdollar}COLING'18},
booktitle = {Proceedings of the First Workshop on Trolling, Aggression and Cyberbullying,
TRAC@COLING 2018, Santa Fe, New Mexico, USA, August 25, 2018},
pages = {58--65},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/W18-4407/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/KumarGPC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/SinghGGP17,
author = {Manoj Kumar Singh and
Ritesh Gautam and
Charles K. Gatebe and
Rajesh Poudyal},
title = {Corrigendum to "PolarBRDF: {A} general purpose Python package for
visualization and quantitative analysis of multi-angular remote sensing
measurements [Comput. Geosci. 96(2016) 173-180]"},
journal = {Comput. Geosci.},
volume = {98},
pages = {93},
year = {2017},
url = {https://doi.org/10.1016/j.cageo.2016.09.012},
doi = {10.1016/J.CAGEO.2016.09.012},
timestamp = {Fri, 25 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/gandc/SinghGGP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ises/RajputPT17,
author = {Amit Singh Rajput and
Manisha Pattanaik and
Ritesh Kumar Tiwari},
title = {Design and Analysis of Schmitt Trigger Based 10T {SRAM} in 32 nm Technology},
booktitle = {{IEEE} International Symposium on Nanoelectronic and Information Systems,
iNIS 2017, Bhopal, India, December 18-20, 2017},
pages = {234--237},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.ieeecomputersociety.org/10.1109/iNIS.2017.56},
doi = {10.1109/INIS.2017.56},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ises/RajputPT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/SinghGGP16,
author = {Manoj Kumar Singh and
Ritesh Gautam and
Charles K. Gatebe and
Rajesh Poudyal},
title = {PolarBRDF: {A} general purpose Python package for visualization and
quantitative analysis of multi-angular remote sensing measurements},
journal = {Comput. Geosci.},
volume = {96},
pages = {173--180},
year = {2016},
url = {https://doi.org/10.1016/j.cageo.2016.08.015},
doi = {10.1016/J.CAGEO.2016.08.015},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gandc/SinghGGP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/KumarGP16,
author = {Ritesh Kumar and
Bhanodai Guggilla and
Rajendra Pamula},
editor = {Krisztian Balog and
Linda Cappellato and
Nicola Ferro and
Craig Macdonald},
title = {Social Book Search Track: ISM@CLEF'16 Suggestion Task},
booktitle = {Working Notes of {CLEF} 2016 - Conference and Labs of the Evaluation
forum, {\'{E}}vora, Portugal, 5-8 September, 2016},
series = {{CEUR} Workshop Proceedings},
volume = {1609},
pages = {1130--1135},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1609/16091130.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:40 +0100},
biburl = {https://dblp.org/rec/conf/clef/KumarGP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ChaudhuriCR15,
author = {Arindam Chaudhuri and
Dipak Chatterjee and
Ritesh Rajput},
title = {Fuzzy Mixed Integer Linear Programming for Air Vehicles Operations
Optimization},
journal = {CoRR},
volume = {abs/1503.04222},
year = {2015},
url = {http://arxiv.org/abs/1503.04222},
eprinttype = {arXiv},
eprint = {1503.04222},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ChaudhuriCR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/KunchukuttanMCSB14,
author = {Anoop Kunchukuttan and
Abhijit Mishra and
Rajen Chatterjee and
Ritesh M. Shah and
Pushpak Bhattacharyya},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Hrafn Loftsson and
Bente Maegaard and
Joseph Mariani and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Shata-Anuvadak: Tackling Multiway Translation of Indian Languages},
booktitle = {Proceedings of the Ninth International Conference on Language Resources
and Evaluation, {LREC} 2014, Reykjavik, Iceland, May 26-31, 2014},
pages = {1781--1787},
publisher = {European Language Resources Association {(ELRA)}},
year = {2014},
url = {http://www.lrec-conf.org/proceedings/lrec2014/summaries/414.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/KunchukuttanMCSB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wmt/DungarwalCMKSB14,
author = {Piyush Dungarwal and
Rajen Chatterjee and
Abhijit Mishra and
Anoop Kunchukuttan and
Ritesh M. Shah and
Pushpak Bhattacharyya},
title = {The {IIT} Bombay Hindi-English Translation System at {WMT} 2014},
booktitle = {Proceedings of the Ninth Workshop on Statistical Machine Translation,
WMT@ACL 2014, June 26-27, 2014, Baltimore, Maryland, {USA}},
pages = {90--96},
publisher = {The Association for Computer Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/w14-3308},
doi = {10.3115/V1/W14-3308},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wmt/DungarwalCMKSB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/SoundarabaiSTVP14,
author = {P. Beaulah Soundarabai and
Ritesh Sahai and
J. Thriveni and
K. R. Venugopal and
Lalit M. Patnaik},
title = {Improved Bully Election Algorithm for Distributed Systems},
journal = {CoRR},
volume = {abs/1403.3255},
year = {2014},
url = {http://arxiv.org/abs/1403.3255},
eprinttype = {arXiv},
eprint = {1403.3255},
timestamp = {Mon, 23 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/SoundarabaiSTVP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/GuptaPS12,
author = {Rohit Gupta and
Raj Nath Patel and
Ritesh Shah},
editor = {Karthik Visweswariah and
Ananthakrishnan Ramanathan and
Mitesh M. Khapra},
title = {Learning Improved Reordering Models for Urdu, Farsi and Italian using
{SMT}},
booktitle = {Proceedings of the Workshop on Reordering for Statistical Machine
Translation@COLING 2012, Mumbai, India, December 9, 2012},
pages = {37--46},
publisher = {The {COLING} 2012 Organizing Committee},
year = {2012},
url = {https://aclanthology.org/W12-5905/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/GuptaPS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
author = {Socrates D. Vamvakos and
Bendik Kleveland and
Dipak K. Sikdar and
B. K. Ahuja and
Haidang Lin and
Jayaprakash Balachandran and
Wignes Balakrishnan and
Aldo Bottelli and
Jawji Chen and
Xiaole Chen and
Jae Choi and
Jeong Choi and
Rajesh Chopra and
Sanjay Dabral and
Kalyan Dasari and
Ronald B. David and
Shaishav Desai and
Claude R. Gauthier and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Ramosan Canagasaby and
Jeff Kumala and
E. P. Kwon and
Ben Lee and
Ming Liu and
Gurupada Mandal and
Sundari Mitra and
Byeong Cheol Na and
Siddharth Panwar and
Jay Patel and
Chethan Rao and
Vithal Rao and
Richard Rouse and
Ritesh Saraf and
Subramanian Seshadri and
Jae{-}K. Sim and
Clement Szeto and
Alvin Wang and
Jason Yeung},
title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
ns latency},
booktitle = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
2012, Bordeaux, France, September 17-21, 2012},
pages = {458--461},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ESSCIRC.2012.6341354},
doi = {10.1109/ESSCIRC.2012.6341354},
timestamp = {Thu, 26 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgis/SatapathyVKS10,
author = {Deepty Ranjan Satapathy and
Ritesh Vijay and
Swapnil R. Kamble and
Rajiv A. Sohony},
title = {Remote Sensing of Turbidity and Phosphate in Creeks and Coast of Mumbai:
An Effect of Organic Matter},
journal = {Trans. {GIS}},
volume = {14},
number = {6},
pages = {811--832},
year = {2010},
url = {https://doi.org/10.1111/j.1467-9671.2010.01234.x},
doi = {10.1111/J.1467-9671.2010.01234.X},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgis/SatapathyVKS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/RajoreNJ09,
author = {Ritesh Rajore and
S. K. Nandy and
H. S. Jamadagni},
title = {Architecture of Run-Time Reconfigurable Channel Decoder},
booktitle = {Proceedings of {IEEE} International Conference on Communications,
{ICC} 2009, Dresden, Germany, 14-18 June 2009},
pages = {1--6},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ICC.2009.5198763},
doi = {10.1109/ICC.2009.5198763},
timestamp = {Tue, 27 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icc/RajoreNJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/masa/TailorT08,
author = {Rajesh Tailor and
Ritesh Tailor},
title = {Estimation of finite population mean using two auxiliary variables
in sample surveys},
journal = {Model. Assist. Stat. Appl.},
volume = {3},
number = {4},
pages = {297--303},
year = {2008},
url = {https://doi.org/10.3233/MAS-2008-3402},
doi = {10.3233/MAS-2008-3402},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/masa/TailorT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asap/RajoreGJN08,
author = {Ritesh Rajore and
Ganesh Garga and
H. S. Jamadagni and
S. K. Nandy},
title = {Reconfigurable Viterbi decoder on mesh connected multiprocessor architecture},
booktitle = {19th {IEEE} International Conference on Application-Specific Systems,
Architectures and Processors, {ASAP} 2008, July 2-4, 2008, Leuven,
Belgium},
pages = {49--54},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ASAP.2008.4580153},
doi = {10.1109/ASAP.2008.4580153},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asap/RajoreGJN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/comsware/VatsaRKPD07,
author = {Omanand Jha Vatsa and
Mayank Raj and
Ritesh Kumar Kalle and
Deepak Panigrahy and
Debabrata Das},
editor = {Sanjoy Paul and
Henning Schulzrinne and
G. Venkatesh},
title = {Adaptive Power Saving Algorithm for Mobile Subscriber Station in 802.16e},
booktitle = {Proceedings of the Second International Conference on COMmunication
System softWAre and MiddlewaRE {(COMSWARE} 2007), January 7-12, 2007,
Bangalore, India},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/COMSWA.2007.382607},
doi = {10.1109/COMSWA.2007.382607},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/comsware/VatsaRKPD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aiccsa/JiEZRR05,
author = {Feng Ji and
Ramez Elmasri and
Yiming Zhang and
B. Ritesh and
Zoe Raja},
title = {Incorporating concepts for bioingormatics data modeling into {EER}
models},
booktitle = {2005 {ACS} / {IEEE} International Conference on Computer Systems and
Applications {(AICCSA} 2005), January 3-6, 2005, Cairo, Egypt},
pages = {189--192},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/AICCSA.2005.1387039},
doi = {10.1109/AICCSA.2005.1387039},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aiccsa/JiEZRR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-10-04 01:19 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
